1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113
|
# -*-Perl-*- Test Harness script for Bioperl
# $Id: gcg.t 15112 2008-12-08 18:12:38Z sendu $
use strict;
BEGIN {
use lib '.';
use Bio::Root::Test;
test_begin(-tests => 17,
-requires_modules => [],
-requires_networking => 0,
);
use_ok('Bio::SeqIO::gcg');
}
my $verbose = test_debug();
my $format = 'gcg';
my $seqio_obj = Bio::SeqIO->new(-file => test_input_file("test.$format"),
-format => $format);
isa_ok($seqio_obj, 'Bio::SeqIO');
my @methods = qw(next_seq write_seq);
foreach my $method (@methods) {
can_ok($seqio_obj, $method) ||
diag "$method method not implemented for $format";
}
# checking the first sequence object
my $seq_obj = $seqio_obj->next_seq();
isa_ok($seq_obj, 'Bio::Seq');
isa_ok($seq_obj, 'Bio::Seq::RichSeq');
my %expected = ('seq' => 'MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGL' .
'DYRTTDENLKAHEKWGNIVDVVVMKDPRTKRSRGFGFI' .
'TYSHSSMIDEAQKSRPHKIDGRVEPKRAVPRQDIDSPN' .
'AGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDNIVI' .
'DKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVD' .
'VKKALPKNDQQGGGGGRGGPGGRAGGNRGNMGGGNYGN' .
'QNGGGNWNNGGNNWGNNRGNDNWGNNSFGGGGGGGGGY' .
'GGGNNSWGNNNPWDNGNGGGNFGGGGNNWNGGNDFGGY' .
'QQNYGGGPQRGGGNFNNNRMQPYQGGGGFKAGGGNQGN' .
'YGNNQGFNNGGNNRRY',
'length' => '358',
'primary_id' => 'roa1_drome',
'description' => qr(Rea guano receptor type III),
);
is ($seq_obj->seq(), $expected{'seq'}, 'sequence');
is ($seq_obj->length(), $expected{'length'}, 'length');
TODO: {
local $TODO = 'possible bug: RichSeq not setting primary_id?';
is ($seq_obj->primary_id(), $expected{'primary_id'}, 'primary_id');
}
like ($seq_obj->description(), $expected{'description'}, 'description');
# test DOS linefeeds in gcg parser
my $str = Bio::SeqIO->new(-file => test_input_file('test_badlf.gcg'),
-verbose => $verbose,
-format => 'GCG');
ok($str);
my $seq = $str->next_seq();
isa_ok ($seq, 'Bio::SeqI');
is(length($seq->seq), $seq->length);
print "Sequence 1 of 1 from GCG stream:\n", $seq->seq, "\n" if( $verbose);
# from testformats.pl
SKIP: {
test_skip(-tests => 4, -requires_modules => [qw(Algorithm::Diff
IO::ScalarArray
IO::String)]);
use_ok('Algorithm::Diff');
eval "use Algorithm::Diff qw(diff LCS);";
use_ok('IO::ScalarArray');
use_ok('IO::String');
my ($file, $type) = ("test.$format", $format);
my $filename = test_input_file($file);
print "processing file $filename\n" if $verbose;
open(FILE, "< $filename") or die("cannot open $filename");
my @datain = <FILE>;
my $in = new IO::String(join('', @datain));
my $seqin = new Bio::SeqIO( -fh => $in,
-format => $type);
my $out = new IO::String;
my $seqout = new Bio::SeqIO( -fh => $out,
-format => $type);
my $seq;
while( defined($seq = $seqin->next_seq) ) {
$seqout->write_seq($seq);
}
$seqout->close();
$seqin->close();
my $strref = $out->string_ref;
my @dataout = map { $_."\n"} split(/\n/, $$strref );
my @diffs = &diff( \@datain, \@dataout);
is(@diffs, 0, "$format format can round-trip");
if(@diffs && $verbose) {
foreach my $d ( @diffs ) {
foreach my $diff ( @$d ) {
chomp($diff->[2]);
print $diff->[0], $diff->[1], "\n>", $diff->[2], "\n";
}
}
print "in is \n", join('', @datain), "\n";
print "out is \n", join('',@dataout), "\n";
}
}
|