1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348
|
<entrySet level="1" version="1" xmlns="net:sf:psidev:mi" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="net:sf:psidev:mi http://psidev.sourceforge.net/mi/xml/src/MIF.xsd">
<entry>
<source releaseDate="2005-12-05">
<names>
<shortLabel>European Bioinformatics Institute</shortLabel>
</names>
<bibref>
<xref>
<primaryRef db="pubmed" id="14681455"/>
</xref>
</bibref>
<xref>
<primaryRef db="psi-mi" id="MI:0469"/>
</xref>
<attributeList>
<attribute name="postalAddress">Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SD, United Kingdom</attribute>
<attribute name="url">http://www.ebi.ac.uk</attribute>
</attributeList>
</source>
<experimentList>
<experimentDescription id="EBI-617684">
<names>
<shortLabel>eyckerman-2001-1</shortLabel>
<fullName>Design and application of a cytokine-receptor-based interaction trap.</fullName>
</names>
<bibref>
<xref>
<primaryRef db="pubmed" id="11781573"/>
</xref>
</bibref>
<xref>
<primaryRef db="intact" id="EBI-617684" secondary="eyckerman-2001-1"/>
<secondaryRef db="newt" id="10090" secondary="mouse"/>
<secondaryRef db="newt" id="10633" secondary="sv40"/>
<secondaryRef db="newt" id="9606" secondary="human"/>
</xref>
<hostOrganism ncbiTaxId="9606">
<names>
<shortLabel>human-293t</shortLabel>
<fullName>Homo sapiens 293 cells transformed with SV40 large T antigen</fullName>
</names>
<cellType>
<names>
<shortLabel>293t</shortLabel>
<fullName>293 cells expressing SV40 large T antigen.</fullName>
</names>
<xref>
<primaryRef db="pubmed" id="3031469"/>
<secondaryRef db="cabri" id="ICLC HTL04001"/>
</xref>
</cellType>
</hostOrganism>
<interactionDetection>
<names>
<shortLabel>mappit</shortLabel>
<fullName>mammalian protein protein interaction trap</fullName>
</names>
<xref>
<primaryRef db="psi-mi" id="MI:0231"/>
<secondaryRef db="pubmed" id="12853652"/>
</xref>
</interactionDetection>
<participantDetection>
<names>
<shortLabel>predetermined</shortLabel>
<fullName>predetermined participant</fullName>
</names>
<xref>
<primaryRef db="psi-mi" id="MI:0396"/>
<secondaryRef db="pubmed" id="7940758"/>
<secondaryRef db="pubmed" id="14755292"/>
</xref>
</participantDetection>
<attributeList>
<attribute name="exp-modification">MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a region of the bait protein is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation.</attribute>
<attribute name="figure-legend">2b, 2c, 5</attribute>
<attribute name="contact-email">jan.tavernier@ugent.be</attribute>
<attribute name="author-list">Eyckerman S., Verhee A., der Heyden JV., Lemmens I., Ostade XV., Vandekerckhove J., Tavernier J.</attribute>
</attributeList>
</experimentDescription>
</experimentList>
<interactorList>
<proteinInteractor id="EBI-617698">
<names>
<shortLabel>tala_sv40</shortLabel>
<fullName>Large T antigen</fullName>
</names>
<xref>
<primaryRef db="uniprotkb" id="P03070" secondary="tala_sv40" version="SP_48"/>
<secondaryRef db="interpro" id="IPR001623" secondary="DnaJ_N"/>
<secondaryRef db="interpro" id="IPR010932" secondary="Polyoma_lg_T_C"/>
<secondaryRef db="interpro" id="IPR003133" secondary="T_Ag_DNA_bind"/>
<secondaryRef db="intact" id="EBI-617698" secondary="tala_sv40"/>
</xref>
<organism ncbiTaxId="10633">
<names>
<shortLabel>sv40</shortLabel>
<fullName>Simian virus 40</fullName>
</names>
</organism>
<sequence>MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEFSVPKTLQARFVKQIDFRAKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET</sequence>
</proteinInteractor>
<proteinInteractor id="EBI-474016">
<names>
<shortLabel>p53_mouse</shortLabel>
<fullName>Cellular tumor antigen p53</fullName>
</names>
<xref>
<primaryRef db="uniprotkb" id="P02340" secondary="p53_mouse" version="SP_48"/>
<secondaryRef db="go" id="GO:0005829" secondary="C:cytosol"/>
<secondaryRef db="go" id="GO:0005739" secondary="C:mitochondrion"/>
<secondaryRef db="go" id="GO:0005730" secondary="C:nucleolus"/>
<secondaryRef db="go" id="GO:0005524" secondary="F:ATP binding"/>
<secondaryRef db="go" id="GO:0005507" secondary="F:copper ion binding"/>
<secondaryRef db="go" id="GO:0000739" secondary="F:DNA strand annealing activit"/>
<secondaryRef db="go" id="GO:0005515" secondary="F:protein binding"/>
<secondaryRef db="go" id="GO:0003700" secondary="F:transcription factor activit"/>
<secondaryRef db="go" id="GO:0006915" secondary="P:apoptosis"/>
<secondaryRef db="go" id="GO:0006284" secondary="P:base-excision repair"/>
<secondaryRef db="go" id="GO:0008635" secondary="P:caspase activation via cytoc"/>
<secondaryRef db="go" id="GO:0007569" secondary="P:cell aging"/>
<secondaryRef db="go" id="GO:0007050" secondary="P:cell cycle arrest"/>
<secondaryRef db="go" id="GO:0030154" secondary="P:cell differentiation"/>
<secondaryRef db="go" id="GO:0042771" secondary="P:DNA damage response, signal"/>
<secondaryRef db="go" id="GO:0043066" secondary="P:negative regulation of apopt"/>
<secondaryRef db="go" id="GO:0030308" secondary="P:negative regulation of cell"/>
<secondaryRef db="go" id="GO:0008156" secondary="P:negative regulation of DNA r"/>
<secondaryRef db="go" id="GO:0048147" secondary="P:negative regulation of fibro"/>
<secondaryRef db="go" id="GO:0006289" secondary="P:nucleotide-excision repair"/>
<secondaryRef db="go" id="GO:0000060" secondary="P:protein-nucleus import, tran"/>
<secondaryRef db="go" id="GO:0042127" secondary="P:regulation of cell prolifera"/>
<secondaryRef db="go" id="GO:0006355" secondary="P:regulation of transcription,"/>
<secondaryRef db="go" id="GO:0006974" secondary="P:response to DNA damage stimu"/>
<secondaryRef db="go" id="GO:0009411" secondary="P:response to UV"/>
<secondaryRef db="go" id="GO:0010165" secondary="P:response to X-ray"/>
<secondaryRef db="interpro" id="IPR002117" secondary="P53"/>
<secondaryRef db="interpro" id="IPR011615" secondary="p53_DNA_bind"/>
<secondaryRef db="interpro" id="IPR010991" secondary="p53_tetrameristn"/>
<secondaryRef db="uniprotkb" id="Q9QUP3" secondary="p53_mouse" version="SP_48"/>
<secondaryRef db="go" id="GO:0005657" secondary="C:replication fork"/>
<secondaryRef db="go" id="GO:0045941" secondary="P:positive regulation of trans"/>
<secondaryRef db="interpro" id="IPR012346" secondary="P53_RUNT_DNA_bd"/>
<secondaryRef db="intact" id="EBI-474016" secondary="p53_mouse"/>
</xref>
<organism ncbiTaxId="10090">
<names>
<shortLabel>mouse</shortLabel>
<fullName>Mus musculus</fullName>
</names>
</organism>
<sequence>MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD</sequence>
</proteinInteractor>
<proteinInteractor id="EBI-617321">
<names>
<shortLabel>epor_human</shortLabel>
<fullName>Erythropoietin receptor precursor</fullName>
</names>
<xref>
<primaryRef db="uniprotkb" id="P19235" secondary="epor_human" version="SP_48"/>
<secondaryRef db="go" id="GO:0005887" secondary="C:integral to plasma membrane"/>
<secondaryRef db="go" id="GO:0004900" secondary="F:erythropoietin receptor acti"/>
<secondaryRef db="go" id="GO:0007165" secondary="P:signal transduction"/>
<secondaryRef db="interpro" id="IPR002996" secondary="Cytkn_recept_B/G"/>
<secondaryRef db="interpro" id="IPR009167" secondary="EPO_receptor"/>
<secondaryRef db="interpro" id="IPR003961" secondary="FN_III"/>
<secondaryRef db="interpro" id="IPR008957" secondary="FN_III-like"/>
<secondaryRef db="interpro" id="IPR003528" secondary="HemptreceptL_F1"/>
<secondaryRef db="uniprotkb" id="Q15443" secondary="epor_human" version="SP_48"/>
<secondaryRef db="intact" id="EBI-617321" secondary="epor_human"/>
</xref>
<organism ncbiTaxId="9606">
<names>
<shortLabel>human</shortLabel>
<fullName>Homo sapiens</fullName>
</names>
</organism>
<sequence>MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS</sequence>
</proteinInteractor>
<proteinInteractor id="EBI-617489">
<names>
<shortLabel>cish_mouse</shortLabel>
<fullName>Cytokine-inducible SH2-containing protein</fullName>
</names>
<xref>
<primaryRef db="uniprotkb" id="Q62225" secondary="cish_mouse" version="SP_48"/>
<secondaryRef db="go" id="GO:0005886" secondary="C:plasma membrane"/>
<secondaryRef db="go" id="GO:0005515" secondary="F:protein binding"/>
<secondaryRef db="go" id="GO:0007205" secondary="P:protein kinase C activation"/>
<secondaryRef db="interpro" id="IPR000980" secondary="SH2"/>
<secondaryRef db="interpro" id="IPR001496" secondary="SOCS_C"/>
<secondaryRef db="intact" id="EBI-617489" secondary="cish_mouse"/>
</xref>
<organism ncbiTaxId="10090">
<names>
<shortLabel>mouse</shortLabel>
<fullName>Mus musculus</fullName>
</names>
</organism>
<sequence>MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQAENEPKVLDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAPTPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL</sequence>
</proteinInteractor>
<proteinInteractor id="EBI-617737">
<names>
<shortLabel>socs2_human</shortLabel>
<fullName>Suppressor of cytokine signaling 2</fullName>
</names>
<xref>
<primaryRef db="uniprotkb" id="O14508" secondary="socs2_human" version="SP_49"/>
<secondaryRef db="go" id="GO:0005737" secondary="C:cytoplasm"/>
<secondaryRef db="go" id="GO:0005131" secondary="F:growth hormone receptor bind"/>
<secondaryRef db="go" id="GO:0005159" secondary="F:insulin-like growth factor r"/>
<secondaryRef db="go" id="GO:0008269" secondary="F:JAK pathway signal transduct"/>
<secondaryRef db="go" id="GO:0005148" secondary="F:prolactin receptor binding"/>
<secondaryRef db="go" id="GO:0005070" secondary="F:SH3/SH2 adaptor activity"/>
<secondaryRef db="go" id="GO:0006916" secondary="P:anti-apoptosis"/>
<secondaryRef db="go" id="GO:0007259" secondary="P:JAK-STAT cascade"/>
<secondaryRef db="go" id="GO:0045666" secondary="P:positive regulation of neuro"/>
<secondaryRef db="go" id="GO:0040014" secondary="P:regulation of body size"/>
<secondaryRef db="go" id="GO:0001558" secondary="P:regulation of cell growth"/>
<secondaryRef db="go" id="GO:0009966" secondary="P:regulation of signal transdu"/>
<secondaryRef db="interpro" id="IPR000980" secondary="SH2"/>
<secondaryRef db="interpro" id="IPR001496" secondary="SOCS_C"/>
<secondaryRef db="uniprotkb" id="O14542" secondary="socs2_human" version="SP_49"/>
<secondaryRef db="uniprotkb" id="O95102" secondary="socs2_human" version="SP_49"/>
<secondaryRef db="uniprotkb" id="Q9UKS5" secondary="socs2_human" version="SP_49"/>
<secondaryRef db="go" id="GO:0005515" secondary="F:protein binding"/>
<secondaryRef db="intact" id="EBI-617737" secondary="socs2_human"/>
</xref>
<organism ncbiTaxId="9606">
<names>
<shortLabel>human</shortLabel>
<fullName>Homo sapiens</fullName>
</names>
</organism>
<sequence>MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV</sequence>
</proteinInteractor>
</interactorList>
<interactionList>
<interaction>
<names>
<shortLabel>sv40-tp53-1</shortLabel>
<fullName>Interactions between SV40 large T antigen and murine p53 demonstrated by MAPPIT</fullName>
</names>
<experimentList>
<experimentRef ref="EBI-617684"/>
</experimentList>
<participantList>
<proteinParticipant>
<proteinInteractorRef ref="EBI-617698"/>
<role>prey</role>
</proteinParticipant>
<proteinParticipant>
<proteinInteractorRef ref="EBI-474016"/>
<role>bait</role>
</proteinParticipant>
</participantList>
<interactionType>
<names>
<shortLabel>physical interaction</shortLabel>
<fullName>physical interaction</fullName>
</names>
<xref>
<primaryRef db="psi-mi" id="MI:0218"/>
<secondaryRef db="pubmed" id="14755292"/>
</xref>
</interactionType>
<xref>
<primaryRef db="intact" id="EBI-617704" secondary="sv40-tp53-1"/>
</xref>
<attributeList>
<attribute name="kd">1.0</attribute>
</attributeList>
</interaction>
<interaction>
<names>
<shortLabel>epor-cish-4</shortLabel>
<fullName>Interaction between human EpoR and Murine CIS-1 demonstrated by MAPPIT</fullName>
</names>
<experimentList>
<experimentRef ref="EBI-617684"/>
</experimentList>
<participantList>
<proteinParticipant>
<proteinInteractorRef ref="EBI-617321"/>
<role>bait</role>
</proteinParticipant>
<proteinParticipant>
<proteinInteractorRef ref="EBI-617489"/>
<role>prey</role>
</proteinParticipant>
</participantList>
<interactionType>
<names>
<shortLabel>physical interaction</shortLabel>
<fullName>physical interaction</fullName>
</names>
<xref>
<primaryRef db="psi-mi" id="MI:0218"/>
<secondaryRef db="pubmed" id="14755292"/>
</xref>
</interactionType>
<xref>
<primaryRef db="intact" id="EBI-617720" secondary="epor-cish-4"/>
</xref>
<attributeList>
<attribute name="kd">1.0</attribute>
</attributeList>
</interaction>
<interaction>
<names>
<shortLabel>epor-socs2-3</shortLabel>
<fullName>Interaction between human EpoR and SOCS2 demonstrated by MAPPIT</fullName>
</names>
<experimentList>
<experimentRef ref="EBI-617684"/>
</experimentList>
<participantList>
<proteinParticipant>
<proteinInteractorRef ref="EBI-617737"/>
<role>prey</role>
</proteinParticipant>
<proteinParticipant>
<proteinInteractorRef ref="EBI-617321"/>
<role>bait</role>
</proteinParticipant>
</participantList>
<interactionType>
<names>
<shortLabel>physical interaction</shortLabel>
<fullName>physical interaction</fullName>
</names>
<xref>
<primaryRef db="psi-mi" id="MI:0218"/>
<secondaryRef db="pubmed" id="14755292"/>
</xref>
</interactionType>
<xref>
<primaryRef db="intact" id="EBI-617778" secondary="epor-socs2-3"/>
</xref>
<attributeList>
<attribute name="caution">SOCS2 described as fragment but no detail given</attribute>
<attribute name="agonist">Erythropoietin</attribute>
<attribute name="resulting-ptm">Phosphorylation of SOCS2 - dependent on treatment of cells with erythropoietin</attribute>
<attribute name="kd">1.0</attribute>
</attributeList>
</interaction>
</interactionList>
</entry>
</entrySet>
|