1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479
|
LOCUS NC_002058 7440 bp ss-RNA linear VRL 08-DEC-2008
DEFINITION Poliovirus, complete genome.
ACCESSION NC_002058
VERSION NC_002058.3 GI:12408699
DBLINK BioProject: PRJNA15288
DBLINK Project:100,200,300
DBLINK NC_002058.3
KEYWORDS coat protein; complementary DNA; genome; polyprotein.
SOURCE Human enterovirus C
ORGANISM Human enterovirus C
Viruses; ssRNA positive-strand viruses, no DNA stage;
Picornavirales; Picornaviridae; Enterovirus.
REFERENCE 1 (sites)
AUTHORS Dorner,A.J., Dorner,L.F., Larsen,G.R., Wimmer,E. and Anderson,C.W.
TITLE Identification of the initiation site of poliovirus polyprotein
synthesis
JOURNAL J. Virol. 42 (3), 1017-1028 (1982)
PUBMED 6284987
REFERENCE 2 (sites)
AUTHORS Emini,E.A., Elzinga,M. and Wimmer,E.
TITLE Carboxy-terminal analysis of poliovirus proteins: termination of
poliovirus RNA translation and location of unique poliovirus
polyprotein cleavage sites
JOURNAL J. Virol. 42 (1), 194-199 (1982)
PUBMED 6283138
REFERENCE 3 (bases 1 to 7440)
AUTHORS Racaniello,V.R. and Baltimore,D.
TITLE Molecular cloning of poliovirus cDNA and determination of the
complete nucleotide sequence of the viral genome
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 78 (8), 4887-4891 (1981)
PUBMED 6272282
REFERENCE 4 (bases 1 to 7440)
AUTHORS Kitamura,N., Semler,B.L., Rothberg,P.G., Larsen,G.R., Adler,C.J.,
Dorner,A.J., Emini,E.A., Hanecak,R., Lee,J.J., van der Werf,S.,
Anderson,C.W. and Wimmer,E.
TITLE Primary structure, gene organization and polypeptide expression of
poliovirus RNA
JOURNAL Nature 291 (5816), 547-553 (1981)
PUBMED 6264310
REFERENCE 5 (bases 5360 to 5527)
AUTHORS Kitamura,N., Adler,C.J., Rothberg,P.G., Martinko,J., Nathenson,S.G.
and Wimmer,E.
TITLE The genome-linked protein of picornaviruses. VII. Genetic mapping
of poliovirus VPg by protein and RNA sequence studies
JOURNAL Cell 21 (1), 295-302 (1980)
PUBMED 6250717
REFERENCE 6 (bases 6383 to 7440)
AUTHORS Kitamura,N. and Wimmer,E.
TITLE Sequence of 1060 3'-terminal nucleotides of poliovirus RNA as
determined by a modification of the dideoxynucleotide method
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (6), 3196-3200 (1980)
PUBMED 6158042
REFERENCE 7 (bases 1 to 7440)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (01-AUG-2000) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from V01149.
On Jan 24, 2001 this sequence version replaced gi:12331600.
See also entries V01148 (POLIO1A, for another version of this
genome) and V01150 (POLIOS1, for the genome of the Sabin 1 strain).
See the entry V01148 (POLIO1A) for the sequence reported in [3].
Mature peptides were added to the annotation by NCBI RefSeq Genomes
staff.
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..7440
/organism="Human enterovirus C"
/mol_type="genomic RNA"
/strain="Human poliovirus 1 Mahoney"
/db_xref="taxon:138950"
conflict 284..288
/note="CGCUC is GUU in [3]"
/citation=[4]
conflict 352
/note="G is U in [3]"
/citation=[4]
conflict 387
/note="GC is C in [3]"
/citation=[4]
conflict 488
/note="G is GU in [3]"
/citation=[4]
gene 743..7372
/locus_tag="PVgp1"
/db_xref="GeneID:919920"
CDS 743..7372
/locus_tag="PVgp1"
/codon_start=1
/product="polyprotein"
/protein_id="NP_041277.1"
/db_xref="GI:9627037"
/db_xref="GOA:P03300"
/db_xref="UniProtKB/Swiss-Prot:P03300"
/db_xref="GeneID:919920"
/translation="MGAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQ
DFSQDPSKFTEPIKDVLIKTAPMLNSPNIEACGYSDRVLQLTLGNSTITTQEAANSVV
AYGRWPEYLRDSEANPVDQPTEPDVAACRFYTLDTVSWTKESRGWWWKLPDALRDMGL
FGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAVPEMCLAGDSNTTTMHTSYQNAN
PGEKGGTFTGTFTPDNNQTSPARRFCPVDYLLGNGTLLGNAFVFPHQIINLRTNNCAT
LVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFASESSPEIPITLTIAPMCCEFNGLRN
ITLPRLQGLPVMNTPGSNQYLTADNFQSPCALPEFDVTPPIDIPGEVKNMMELAEIDT
MIPFDLSATKKNTMEMYRVRLSDKPHTDDPILCLSLSPASDPRLSHTMLGEILNYYTH
WAGSLKFTFLFCGFMMATGKLLVSYAPPGADPPKKRKEAMLGTHVIWDIGLQSSCTMV
VPWISNTTYRQTIDDSFTEGGYISVFYQTRIVVPLSTPREMDILGFVSACNDFSVRLL
RDTTHIEQKALAQGLGQMLESMIDNTVRETVGAATSRDALPNTEASGPTHSKEIPALT
AVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNPASTTNKDK
LFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVP
PGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKD
QSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAV
AYYGPGVDYKDGTLTPLSTKDLTTYGFGHQNKAVYTAGYKICNYHLATQDDLQNAVNV
MWSRDLLVTESRAQGTDSIARCNCNAGVYYCESRRKYYPVSFVGPTFQYMEANNYYPA
RYQSHMLIGHGFASPGDCGGILRCHHGVIGIITAGGEGLVAFSDIRDLYAYEEEAMEQ
GITNYIESLGAAFGSGFTQQISDKITELTNMVTSTITEKLLKNLIKIISSLVIITRNY
EDTTTVLATLALLGCDASPWQWLRKKACDVLEIPYVIKQGDSWLKKFTEACNAAKGLE
WVSNKISKFIDWLKEKIIPQARDKLEFVTKLRQLEMLENQISTIHQSCPSQEHQEILF
NNVRWLSIQSKRFAPLYAVEAKRIQKLEHTINNYIQFKSKHRIEPVCLLVHGSPGTGK
SVATNLIARAIAERENTSTYSLPPDPSHFDGYKQQGVVIMDDLNQNPDGADMKLFCQM
VSTVEFIPPMASLEEKGILFTSNYVLASTNSSRISPPTVAHSDALARRFAFDMDIQVM
NEYSRDGKLNMAMATEMCKNCHQPANFKRCCPLVCGKAIQLMDKSSRVRYSIDQITTM
IINERNRRSNIGNCMEALFQGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCE
KKGWIVNITSQVQTERNINRAMTILQAVTTFAAVAGVVYVMYKLFAGHQGAYTGLPNK
KPNVPTIRTAKVQGPGFDYAVAMAKRNIVTATTSKGEFTMLGVHDNVAILPTHASPGE
SIVIDGKEVEILDAKALEDQAGTNLEITIITLKRNEKFRDIRPHIPTQITETNDGVLI
VNTSKYPNMYVPVGAVTEQGYLNLGGRQTARTLMYNFPTRAGQCGGVITCTGKVIGMH
VGGNGSHGFAAALKRSYFTQSQGEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEG
VKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQ
MCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINL
PLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAV
GCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYL
NHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAY
GDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKY
PFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIG
RALLLPEYSTLYRRWLDSF"
mat_peptide 746..949
/locus_tag="PVgp1"
/product="coat protein VP4"
/protein_id="NP_740468.1"
/db_xref="GI:25121840"
mat_peptide 950..1765
/locus_tag="PVgp1"
/product="coat protein VP2"
/protein_id="NP_740469.1"
/db_xref="GI:25121841"
mat_peptide 1766..2479
/locus_tag="PVgp1"
/product="coat protein VP3"
/protein_id="NP_740470.1"
/db_xref="GI:25121842"
mat_peptide 2480..3385
/locus_tag="PVgp1"
/product="coat protein VP1"
/protein_id="NP_740471.1"
/db_xref="GI:25121843"
mat_peptide 3386..3832
/locus_tag="PVgp1"
/product="Picornain 2A"
/note="Small chymotrypsin-like cysteine proteinase"
/protein_id="NP_740477.1"
/db_xref="GI:25121849"
mat_peptide 3833..4123
/locus_tag="PVgp1"
/product="protein 2B"
/protein_id="NP_740472.1"
/db_xref="GI:25121844"
mat_peptide 4124..5110
/locus_tag="PVgp1"
/product="protein 2C (NTPase)"
/note="Involved in initiation and elongation of RNA
synthesis, RNA encapsidation, virus uncoating and
guanidine resistance (Asn179-Gly mutation). Putative
helicase III."
/protein_id="NP_740473.1"
/db_xref="GI:25121845"
mat_peptide 5111..5371
/locus_tag="PVgp1"
/product="protein 3A"
/protein_id="NP_740474.1"
/db_xref="GI:25121846"
mat_peptide 5372..5437
/locus_tag="PVgp1"
/product="genome linked protein VPg"
/protein_id="NP_740475.1"
/db_xref="GI:25121847"
mat_peptide 5438..5986
/locus_tag="PVgp1"
/product="Picornain 3C"
/note="Chymotrypsin-like cystein proteinase 3C"
/protein_id="NP_740476.2"
/db_xref="GI:62871476"
mat_peptide 5987..7369
/locus_tag="PVgp1"
/product="RNA-directed RNA-polymerase 3D"
/protein_id="NP_740478.2"
/db_xref="GI:62871477"
conflict 1467..1468
/locus_tag="PVgp1"
/note="GG is G in [3]"
/citation=[4]
conflict 1529..1530
/locus_tag="PVgp1"
/note="CC is C in [3]"
/citation=[4]
conflict 1534..1535
/locus_tag="PVgp1"
/note="CC is C in [3]"
/citation=[4]
conflict 1547
/locus_tag="PVgp1"
/note="C is U in [3]"
/citation=[4]
conflict 1579
/locus_tag="PVgp1"
/note="C is A in [3]"
/citation=[4]
conflict 1601
/locus_tag="PVgp1"
/note="A is C in [3]"
/citation=[4]
conflict 1668
/locus_tag="PVgp1"
/note="C is U in [3]"
/citation=[4]
conflict 2001
/locus_tag="PVgp1"
/note="A is C in [3]"
/citation=[4]
conflict 2004..2006
/locus_tag="PVgp1"
/note="AUC is CCU in [3]"
/citation=[4]
conflict 2035
/locus_tag="PVgp1"
/note="U is C in [3]"
/citation=[4]
conflict 2133
/locus_tag="PVgp1"
/note="U is C in [3]"
/citation=[4]
conflict 2286
/locus_tag="PVgp1"
/note="C is G in [3]"
/citation=[4]
conflict 2983
/locus_tag="PVgp1"
/note="G is A in [3]"
/citation=[4]
conflict 3043
/locus_tag="PVgp1"
/note="A is G in [3]"
/citation=[4]
conflict 3303..3304
/locus_tag="PVgp1"
/note="GG is G in [3]"
/citation=[4]
conflict 3308
/locus_tag="PVgp1"
/note="G is GC in [3]"
/citation=[4]
conflict 3657
/locus_tag="PVgp1"
/note="C is U in [3]"
/citation=[4]
conflict 3696
/locus_tag="PVgp1"
/note="C is A in [3]"
/citation=[4]
conflict 3766
/locus_tag="PVgp1"
/note="C is A in [3]"
/citation=[4]
conflict 4158
/locus_tag="PVgp1"
/note="C is CC in [3]"
/citation=[4]
conflict 4163..4164
/locus_tag="PVgp1"
/note="GC is G in [3]"
/citation=[4]
conflict 4174
/locus_tag="PVgp1"
/note="A is C in [3]"
/citation=[4]
conflict 5113
/locus_tag="PVgp1"
/note="A is C in [3]"
/citation=[4]
conflict 5598
/locus_tag="PVgp1"
/note="U is C in [3]"
/citation=[4]
conflict 5619..5623
/locus_tag="PVgp1"
/note="CGCUC is UGUUU in [3]"
/citation=[4]
conflict 5645
/locus_tag="PVgp1"
/note="C is U in [3]"
/citation=[4]
conflict 5786
/locus_tag="PVgp1"
/note="G is C in [3]"
/citation=[4]
conflict 5903..5905
/locus_tag="PVgp1"
/note="AAA is AA in [3]"
/citation=[4]
conflict 5927..5931
/locus_tag="PVgp1"
/note="GGGAA is GGA in [3]"
/citation=[4]
conflict 5970..5971
/locus_tag="PVgp1"
/note="AC is UA in [3]"
/citation=[4]
conflict 5997
/locus_tag="PVgp1"
/note="A is C in [3]"
/citation=[4]
conflict 6019
/locus_tag="PVgp1"
/note="A is C in [3]"
/citation=[4]
conflict 6021
/locus_tag="PVgp1"
/note="U is C in [3]"
/citation=[4]
conflict 6261
/locus_tag="PVgp1"
/note="C is U in [3]"
/citation=[4]
conflict 6845..6847
/locus_tag="PVgp1"
/note="CCA is CA in [2]"
/citation=[5]
conflict 6978..6979
/locus_tag="PVgp1"
/note="UU is UUU in [2]"
/citation=[5]
conflict 7258
/locus_tag="PVgp1"
/note="U is UU in [2]"
/citation=[5]
conflict 7410
/note="U is C in [3] and [2]"
/citation=[4]
/citation=[5]
conflict 7440
/note="G is GG in [3] and [2]"
/citation=[4]
/citation=[5]
ORIGIN
1 ttaaaacagc tctggggttg tacccacccc agaggcccac gtggcggcta gtactccggt
61 attgcggtac ccttgtacgc ctgttttata ctcccttccc gtaacttaga cgcacaaaac
121 caagttcaat agaagggggt acaaaccagt accaccacga acaagcactt ctgtttcccc
181 ggtgatgtcg tatagactgc ttgcgtggtt gaaagcgacg gatccgttat ccgcttatgt
241 acttcgagaa gcccagtacc acctcggaat cttcgatgcg ttgcgctcag cactcaaccc
301 cagagtgtag cttaggctga tgagtctgga catccctcac cggtgacggt ggtccaggct
361 gcgttggcgg cctacctatg gctaacgcca tgggacgcta gttgtgaaca aggtgtgaag
421 agcctattga gctacataag aatcctccgg cccctgaatg cggctaatcc caacctcgga
481 gcaggtggtc acaaaccagt gattggcctg tcgtaacgcg caagtccgtg gcggaaccga
541 ctactttggg tgtccgtgtt tccttttatt ttattgtggc tgcttatggt gacaatcaca
601 gattgttatc ataaagcgaa ttggattggc catccggtga aagtgagact cattatctat
661 ctgtttgctg gatccgctcc attgagtgtg tttactctaa gtacaatttc aacagttatt
721 tcaatcagac aattgtatca taatgggtgc tcaggtttca tcacagaaag tgggcgcaca
781 tgaaaactca aatagagcgt atggtggttc taccattaat tacaccacca ttaattatta
841 tagagattca gctagtaacg cggcttcgaa acaggacttc tctcaagacc cttccaagtt
901 caccgagccc atcaaggatg tcctgataaa aacagcccca atgctaaact cgccaaacat
961 agaggcttgc gggtatagcg atagagtact gcaattaaca ctgggaaact ccactataac
1021 cacacaggag gcggctaatt cagtagtcgc ttatgggcgt tggcctgaat atctgaggga
1081 cagcgaagcc aatccagtgg accagccgac agaaccagac gtcgctgcat gcaggtttta
1141 tacgctagac accgtgtctt ggacgaaaga gtcgcgaggg tggtggtgga agttgcctga
1201 tgcactgagg gacatgggac tctttgggca aaatatgtac taccactacc taggtaggtc
1261 cgggtacacc gtgcatgtac agtgtaacgc ctccaaattc caccaggggg cactaggggt
1321 attcgccgta ccagagatgt gtctggccgg ggatagcaac accactacca tgcacaccag
1381 ctatcaaaat gccaatcctg gcgagaaagg aggcactttc acgggtacgt tcactcctga
1441 caacaaccag acatcacctg cccgcaggtt ctgcccggtg gattacctcc ttggaaatgg
1501 cacgttgttg gggaatgcct ttgtgttccc gcaccagata ataaacctac ggaccaacaa
1561 ctgtgctaca ctggtactcc cttacgtgaa ctccctctcg atagatagta tggtaaagca
1621 caataattgg ggaattgcaa tattaccatt ggccccatta aattttgcta gtgagtcctc
1681 cccagagatt ccaatcacct tgaccatagc ccctatgtgc tgtgagttca atggattaag
1741 aaacatcacc ctgccacgct tacagggcct gccggtcatg aacacccctg gtagcaatca
1801 atatcttact gcagacaact tccagtcacc gtgtgcgctg cctgaatttg atgtgacccc
1861 acctattgac atacccggtg aagtaaagaa catgatggaa ttggcagaaa tcgacaccat
1921 gattcccttt gacttaagtg ccacaaaaaa gaacaccatg gaaatgtata gggttcggtt
1981 aagtgacaaa ccacatacag acgatcccat actctgcctg tcactctctc cagcttcaga
2041 tcctaggttg tcacatacta tgcttggaga aatcctaaat tactacacac actgggcagg
2101 atccctgaag ttcacgtttc tgttctgtgg attcatgatg gcaactggca aactgttggt
2161 gtcatacgcg cctcctggag ccgacccacc aaagaagcgt aaggaggcga tgttgggaac
2221 acatgtgatc tgggacatag gactgcagtc ctcatgtact atggtagtgc catggattag
2281 caacaccacg tatcggcaaa ccatagatga tagtttcacc gaaggcggat acatcagcgt
2341 cttctaccaa actagaatag tcgtccctct ttcgacaccc agagagatgg acatccttgg
2401 ttttgtgtca gcgtgtaatg acttcagcgt gcgcttgttg cgagatacca cacatataga
2461 gcaaaaagcg ctagcacagg ggttaggtca gatgcttgaa agcatgattg acaacacagt
2521 ccgtgaaacg gtgggggcgg caacatctag agacgctctc ccaaacactg aagccagtgg
2581 accaacacac tccaaggaaa ttccggcact caccgcagtg gaaactgggg ccacaaatcc
2641 actagtccct tctgatacag tgcaaaccag acatgttgta caacataggt caaggtcaga
2701 gtctagcata gagtctttct tcgcgcgggg tgcatgcgtg accattatga ccgtggataa
2761 cccagcttcc accacgaata aggataagct atttgcagtg tggaagatca cttataaaga
2821 tactgtccag ttacggagga aattggagtt cttcacctat tctagatttg atatggaact
2881 tacctttgtg gttactgcaa atttcactga gactaacaat gggcatgcct taaatcaagt
2941 gtaccaaatt atgtacgtac caccaggcgc tccagtgccc gagaaatggg acgactacac
3001 atggcaaacc tcatcaaatc catcaatctt ttacacctac ggaacagctc cagcccggat
3061 ctcggtaccg tatgttggta tttcgaacgc ctattcacac ttttacgacg gtttttccaa
3121 agtaccactg aaggaccagt cggcagcact aggtgactcc ctttatggtg cagcatctct
3181 aaatgacttc ggtattttgg ctgttagagt agtcaatgat cacaacccga ccaaggtcac
3241 ctccaaaatc agagtgtatc taaaacccaa acacatcaga gtctggtgcc cgcgtccacc
3301 gagggcagtg gcgtactacg gccctggagt ggattacaag gatggtacgc ttacacccct
3361 ctccaccaag gatctgacca catatggatt cggacaccaa aacaaagcgg tgtacactgc
3421 aggttacaaa atttgcaact accacttggc cactcaggat gatttgcaaa acgcagtgaa
3481 cgtcatgtgg agtagagacc tcttagtcac agaatcaaga gcccagggca ccgattcaat
3541 cgcaaggtgc aattgcaacg caggggtgta ctactgcgag tctagaagga aatactaccc
3601 agtatccttc gttggcccaa cgttccagta catggaggct aataactatt acccagctag
3661 gtaccagtcc catatgctca ttggccatgg attcgcatct ccaggggatt gtggtggcat
3721 actcagatgt caccacgggg tgatagggat cattactgct ggtggcgaag ggttggttgc
3781 attttcagac attagagact tgtatgccta cgaagaagaa gccatggaac aaggcatcac
3841 caattacata gagtcacttg gggccgcatt tggaagtgga tttactcagc agattagcga
3901 caaaataaca gagttgacca atatggtgac cagtaccatc actgaaaagc tacttaagaa
3961 cttgatcaag atcatatcct cactagttat tataactagg aactatgaag acaccacaac
4021 agtgctcgct accctggccc ttcttgggtg tgatgcttca ccatggcagt ggcttagaaa
4081 gaaagcatgc gatgttctgg agatacctta tgtcatcaag caaggtgaca gttggttgaa
4141 gaagtttact gaagcatgca acgcagctaa gggactggag tgggtgtcaa acaaaatctc
4201 aaaattcatt gattggctca aggagaaaat tatcccacaa gctagagata agttggaatt
4261 tgtaacaaaa cttagacaac tagaaatgct ggaaaaccaa atctcaacta tacaccaatc
4321 atgccctagt caggaacacc aggaaattct attcaataat gtcagatggt tatccatcca
4381 gtctaagagg tttgcccctc tttacgcagt ggaagccaaa agaatacaga aactagagca
4441 tactattaac aactacatac agttcaagag caaacaccgt attgaaccag tatgtttgct
4501 agtacatggc agccccggaa caggtaaatc tgtagcaacc aacctgattg ctagagccat
4561 agctgaaaga gaaaacacgt ccacgtactc gctacccccg gatccatcac acttcgacgg
4621 atacaaacaa cagggagtgg tgattatgga cgacctgaat caaaacccag atggtgcgga
4681 catgaagctg ttctgtcaga tggtatcaac agtggagttt ataccaccca tggcatccct
4741 ggaggagaaa ggaatcctgt ttacttcaaa ttacgttcta gcatccacaa actcaagcag
4801 aatttccccc cccactgtgg cacacagtga tgcattagcc aggcgctttg cgttcgacat
4861 ggacattcag gtcatgaatg agtattctag agatgggaaa ttgaacatgg ccatggctac
4921 tgaaatgtgt aagaactgtc accaaccagc aaactttaag agatgctgtc ctttagtgtg
4981 tggtaaggca attcaattaa tggacaaatc ttccagagtt agatacagta ttgaccagat
5041 cactacaatg attatcaatg agagaaacag aagatccaac attggcaatt gtatggaggc
5101 tttgtttcaa ggaccactcc agtataaaga cttgaaaatt gacatcaaga cgagtccccc
5161 tcctgaatgt atcaatgact tgctccaagc agttgactcc caggaggtga gagattactg
5221 tgagaagaag ggttggatag tcaacatcac cagccaggtt caaacagaaa ggaacatcaa
5281 cagggcaatg acaattctac aagcggtgac aaccttcgcc gcagtggctg gagttgtcta
5341 tgtcatgtat aaactgtttg ctggacacca gggagcatac actggtttac caaacaaaaa
5401 acccaacgtg cccaccattc ggacagcaaa ggtacaagga ccagggttcg attacgcagt
5461 ggctatggct aaaagaaaca ttgttacagc aactactagc aagggagagt tcactatgtt
5521 aggagtccac gacaacgtgg ctattttacc aacccacgct tcacctggtg aaagcattgt
5581 gatcgatggc aaagaagtgg agatcttgga tgccaaagcg ctcgaagatc aagcaggaac
5641 caatcttgaa atcactataa tcactctaaa gagaaatgaa aagttcagag acattagacc
5701 acatatacct actcaaatca ctgagacaaa tgatggagtc ttgatcgtga acactagcaa
5761 gtaccccaat atgtatgttc ctgtcggtgc tgtgactgaa cagggatatc taaatctcgg
5821 tgggcgccaa actgctcgta ctctaatgta caactttcca accagagcag gacagtgtgg
5881 tggagtcatc acatgtactg ggaaagtcat cgggatgcat gttggtggga acggttcaca
5941 cgggtttgca gcggccctga agcgatcata cttcactcag agtcaaggtg aaatccagtg
6001 gatgagacct tcgaaggaag tgggatatcc aatcataaat gccccgtcca aaaccaagct
6061 tgaacccagt gctttccact atgtgtttga aggggtgaag gaaccagcag tcctcactaa
6121 aaacgatccc aggcttaaga cagactttga ggaggcaatt ttctccaagt acgtgggtaa
6181 caaaattact gaagtggatg agtacatgaa agaggcagta gaccactatg ctggccagct
6241 catgtcacta gacatcaaca cagaacaaat gtgcttggag gatgccatgt atggcactga
6301 tggtctagaa gcacttgatt tgtccaccag tgctggctac ccttatgtag caatgggaaa
6361 gaagaagaga gacatcttga acaaacaaac cagagacact aaggaaatgc aaaaactgct
6421 cgacacatat ggaatcaacc tcccactggt gacttatgta aaggatgaac ttagatccaa
6481 aacaaaggtt gagcagggga aatccagatt aattgaagct tctagtttga atgactcagt
6541 ggcaatgaga atggcttttg ggaacctata tgctgctttt cacaaaaacc caggagtgat
6601 aacaggttca gcagtggggt gcgatccaga tttgttttgg agcaaaattc cggtattgat
6661 ggaagagaag ctgtttgctt ttgactacac agggtatgat gcatctctca gccctgcttg
6721 gttcgaggca ctaaagatgg tgcttgagaa aatcggattc ggagacagag ttgactacat
6781 cgactaccta aaccactcac accacctgta caagaataaa acatactgtg tcaagggcgg
6841 tatgccatct ggctgctcag gcacttcaat ttttaactca atgattaaca acttgattat
6901 caggacactc ttactgaaaa cctacaaggg catagattta gaccacctaa aaatgattgc
6961 ctatggtgat gatgtaattg cttcctaccc ccatgaagtt gacgctagtc tcctagccca
7021 atcaggaaaa gactatggac taactatgac tccagctgac aaatcagcta catttgaaac
7081 agtcacatgg gagaatgtaa cattcttgaa gagattcttc agggcagacg agaaataccc
7141 atttcttatt catccagtaa tgccaatgaa ggaaattcat gaatcaatta gatggactaa
7201 agatcctagg aacactcagg atcacgttcg ctctctgtgc cttttagctt ggcacaatgg
7261 cgaagaagaa tataacaaat tcctagctaa aatcaggagt gtgccaattg gaagagcttt
7321 attgctccca gagtactcaa cattgtaccg ccgttggctt gactcatttt agtaacccta
7381 cctcagtcga attggattgg gtcatactgt tgtaggggta aatttttctt taattcggag
//
|