1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610
|
<HTML>
<HEAD>
<TITLE>
EMBOSS: cpgplot
</TITLE>
</HEAD>
<BODY BGCOLOR="#FFFFFF" text="#000000">
<table align=center border=0 cellspacing=0 cellpadding=0>
<tr><td valign=top>
<A HREF="/" ONMOUSEOVER="self.status='Go to the EMBOSS home page';return true"><img border=0 src="emboss_icon.jpg" alt="" width=150 height=48></a>
</td>
<td align=left valign=middle>
<b><font size="+6">
cpgplot
</font></b>
</td></tr>
</table>
<br>
<p>
<H2>
Function
</H2>
Plot CpG rich areas
<H2>
Description
</H2>
CpG refers to a C nucleotide immediately followed by a G. The 'p' in
'CpG' refers to the phosphate group linking the two bases.
<p>
Detection of regions of genomic sequences that are rich in the CpG
pattern is important because such regions are resistant to methylation
and tend to be associated with genes which are frequently switched on.
Regions rich in the CpG pattern are known as CpG islands.
<p>
It has been estimated that about half of all mammalian genes have a
CpG-rich region around their 5' end. It is said that all mammalian
house-keeping genes have a CpG island!
<p>
Non-mammalian vertebrates have some CpG islands that are associated with
genes, but the association gets equivocal in the farther taxonomic
groups.
<p>
Finding a CpG island upstream of predicted exons or genes is good
contributory evidence.
<p>
By default, this program defines a CpG island as a region where, over an
average of 10 windows, the calculated % composition is over 50% and the
calculated Obs/Exp (i.e. Observed/Expected) ratio is over 0.6 and the
conditions hold for a minimum of 200 bases. These conditions can be
modified by setting the values of the appropriate parameters.
<p>
The Observed number of CpG patterns in a window is simply the count of
the number of times a 'C' is found followed immediately by a 'G'.
<p>
The Expected number of CpG patterns is calculated for each window as the
number of CpG dinucleotides you would expect to see in that window based
on the frequency of C's and G's in that window. Thus, the Expected
frequency of CpG's in a window is calculated as the number of 'C's in
the window multiplied by the number of 'G's in the window, divided by
the window length.
<p>
<pre>
Expected = (number of C's * number of G's) / window length
</pre>
<p>
This program reads in one or more sequences and calculates the Obs/Exp
ratio, the percentage CpG over a window which is moved along the
sequence. These calculated values can be plotted, together with the
regions which match this program's definition of a CpG island.
<H2>
Usage
</H2>
<b>Here is a sample session with cpgplot</b>
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>cpgplot tembl:u68037 -graph cps </b>
Plot CpG rich areas
Window size [100]: <b></b>
Minimum length of an island [200]: <b></b>
Minimum observed/expected [0.6]: <b></b>
Minimum percentage [50.]: <b></b>
Output file [u68037.cpgplot]: <b></b>
Features output [u68037.gff]: <b></b>
Created cpgplot.ps
</pre></td></tr></table><p>
<p>
<a href="#input.1">Go to the input files for this example</a><br><a href="#output.1">Go to the output files for this example</a><p><p>
<H2>
Command line arguments
</H2>
<table CELLSPACING=0 CELLPADDING=3 BGCOLOR="#f5f5ff" ><tr><td>
<pre>
Standard (Mandatory) qualifiers (* if not always prompted):
[-sequence] seqall Nucleotide sequence(s) filename and optional
format, or reference (input USA)
-window integer [100] The percentage CG content and the
Observed frequency of CG is calculated
within a window whose size is set by this
parameter. The window is moved down the
sequence and these statistics are calculated
at each postition that the window is moved
to. (Integer 1 or more)
-minlen integer [200] This sets the minimum length that a
CpG island has to be before it is reported.
(Integer 1 or more)
-minoe float [0.6] This sets the minimum average observed
to expected ratio of C plus G to CpG in a
set of 10 windows that are required before a
CpG island is reported. (Number from 0.000
to 10.000)
-minpc float [50.] This sets the minimum average
percentage of G plus C a set of 10 windows
that are required before a CpG island is
reported. (Number from 0.000 to 100.000)
[-outfile] outfile [*.cpgplot] This sets the name of the file
holding the report of the input sequence
name, CpG island parameters and the output
details of any CpG islands that are found.
* -graph xygraph [$EMBOSS_GRAPHICS value, or x11] Graph type
(ps, hpgl, hp7470, hp7580, meta, cps, x11,
tekt, tek, none, data, xterm, png, gif)
[-outfeat] featout [unknown.gff] File for output features
Additional (Optional) qualifiers: (none)
Advanced (Unprompted) qualifiers:
-[no]plot toggle [Y] Plot CpG island score
-[no]obsexp boolean [Y] If this is set to true then the graph of
the observed to expected ratio of C plus G
to CpG within a window is displayed.
-[no]cg boolean [Y] If this is set to true then the graph of
the regions which have been determined to
be CpG islands is displayed.
-[no]pc boolean [Y] If this is set to true then the graph of
the percentage C plus G within a window is
displayed.
Associated qualifiers:
"-sequence" associated qualifiers
-sbegin1 integer Start of each sequence to be used
-send1 integer End of each sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-sformat1 string Input sequence format
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-outfile" associated qualifiers
-odirectory2 string Output directory
"-graph" associated qualifiers
-gprompt boolean Graph prompting
-gdesc string Graph description
-gtitle string Graph title
-gsubtitle string Graph subtitle
-gxtitle string Graph x axis title
-gytitle string Graph y axis title
-goutfile string Output file for non interactive displays
-gdirectory string Output directory
"-outfeat" associated qualifiers
-offormat3 string Output feature format
-ofopenfile3 string Features file name
-ofextension3 string File name extension
-ofdirectory3 string Output directory
-ofname3 string Base file name
-ofsingle3 boolean Separate file for each entry
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write standard output
-filter boolean Read standard input, write standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
</pre>
</td></tr></table>
<P>
<table border cellspacing=0 cellpadding=3 bgcolor="#ccccff">
<tr bgcolor="#FFFFCC">
<th align="left" colspan=2>Standard (Mandatory) qualifiers</th>
<th align="left">Allowed values</th>
<th align="left">Default</th>
</tr>
<tr>
<td>[-sequence]<br>(Parameter 1)</td>
<td>Nucleotide sequence(s) filename and optional format, or reference (input USA)</td>
<td>Readable sequence(s)</td>
<td><b>Required</b></td>
</tr>
<tr>
<td>-window</td>
<td>The percentage CG content and the Observed frequency of CG is calculated within a window whose size is set by this parameter. The window is moved down the sequence and these statistics are calculated at each postition that the window is moved to.</td>
<td>Integer 1 or more</td>
<td>100</td>
</tr>
<tr>
<td>-minlen</td>
<td>This sets the minimum length that a CpG island has to be before it is reported.</td>
<td>Integer 1 or more</td>
<td>200</td>
</tr>
<tr>
<td>-minoe</td>
<td>This sets the minimum average observed to expected ratio of C plus G to CpG in a set of 10 windows that are required before a CpG island is reported.</td>
<td>Number from 0.000 to 10.000</td>
<td>0.6</td>
</tr>
<tr>
<td>-minpc</td>
<td>This sets the minimum average percentage of G plus C a set of 10 windows that are required before a CpG island is reported.</td>
<td>Number from 0.000 to 100.000</td>
<td>50.</td>
</tr>
<tr>
<td>[-outfile]<br>(Parameter 2)</td>
<td>This sets the name of the file holding the report of the input sequence name, CpG island parameters and the output details of any CpG islands that are found.</td>
<td>Output file</td>
<td><i><*></i>.cpgplot</td>
</tr>
<tr>
<td>-graph</td>
<td>Graph type</td>
<td>EMBOSS has a list of known devices, including ps, hpgl, hp7470, hp7580, meta, cps, x11, tekt, tek, none, data, xterm, png, gif</td>
<td><i>EMBOSS_GRAPHICS</i> value, or x11</td>
</tr>
<tr>
<td>[-outfeat]<br>(Parameter 3)</td>
<td>File for output features</td>
<td>Writeable feature table</td>
<td><i>unknown.gff</i></td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=2>Additional (Optional) qualifiers</th>
<th align="left">Allowed values</th>
<th align="left">Default</th>
</tr>
<tr>
<td colspan=4>(none)</td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=2>Advanced (Unprompted) qualifiers</th>
<th align="left">Allowed values</th>
<th align="left">Default</th>
</tr>
<tr>
<td>-[no]plot</td>
<td>Plot CpG island score</td>
<td>Toggle value Yes/No</td>
<td>Yes</td>
</tr>
<tr>
<td>-[no]obsexp</td>
<td>If this is set to true then the graph of the observed to expected ratio of C plus G to CpG within a window is displayed.</td>
<td>Boolean value Yes/No</td>
<td>Yes</td>
</tr>
<tr>
<td>-[no]cg</td>
<td>If this is set to true then the graph of the regions which have been determined to be CpG islands is displayed.</td>
<td>Boolean value Yes/No</td>
<td>Yes</td>
</tr>
<tr>
<td>-[no]pc</td>
<td>If this is set to true then the graph of the percentage C plus G within a window is displayed.</td>
<td>Boolean value Yes/No</td>
<td>Yes</td>
</tr>
</table>
<H2>
Input file format
</H2>
Any DNA sequence USA.
<p>
<a name="input.1"></a>
<h3>Input files for usage example </h3>
'tembl:u68037' is a sequence entry in the example nucleic acid database 'tembl'
<p>
<p><h3>Database entry: tembl:u68037</h3>
<table width="90%"><tr><td bgcolor="#FFCCFF">
<pre>
ID U68037; SV 1; linear; mRNA; STD; ROD; 1218 BP.
XX
AC U68037;
XX
DT 23-SEP-1996 (Rel. 49, Created)
DT 04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE Rattus norvegicus EP1 prostanoid receptor mRNA, complete cds.
XX
KW .
XX
OS Rattus norvegicus (Norway rat)
OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC Muridae; Murinae; Rattus.
XX
RN [1]
RP 1-1218
RA Abramovitz M., Boie Y.;
RT "Cloning of the rat EP1 prostanoid receptor";
RL Unpublished.
XX
RN [2]
RP 1-1218
RA Abramovitz M., Boie Y.;
RT ;
RL Submitted (26-AUG-1996) to the EMBL/GenBank/DDBJ databases.
RL Biochemistry & Molecular Biology, Merck Frosst Center for Therapeutic
RL Research, P. O. Box 1005, Pointe Claire - Dorval, Quebec H9R 4P8, Canada
XX
FH Key Location/Qualifiers
FH
FT source 1..1218
FT /organism="Rattus norvegicus"
FT /strain="Sprague-Dawley"
FT /mol_type="mRNA"
FT /db_xref="taxon:10116"
FT CDS 1..1218
FT /codon_start=1
FT /product="EP1 prostanoid receptor"
FT /note="family 1 G-protein coupled receptor"
FT /db_xref="GOA:P70597"
FT /db_xref="InterPro:IPR000276"
FT /db_xref="InterPro:IPR000708"
FT /db_xref="InterPro:IPR001244"
FT /db_xref="InterPro:IPR008365"
FT /db_xref="UniProtKB/Swiss-Prot:P70597"
FT /protein_id="AAB07735.1"
FT /translation="MSPYGLNLSLVDEATTCVTPRVPNTSVVLPTGGNGTSPALPIFSM
FT TLGAVSNVLALALLAQVAGRLRRRRSTATFLLFVASLLAIDLAGHVIPGALVLRLYTAG
FT RAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALALL
FT AAMALAVALLPLVHVGHYELQYPGTWCFISLGPPGGWRQALLAGLFAGLGLAALLAALV
FT CNTLSGLALLRARWRRRRSRRFRENAGPDDRRRWGSRGLRLASASSASSITSTTAALRS
FT SRGGGSARRVHAHDVEMVGQLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAV
FT RLASWNQILDPWVYILLRQAMLRQLLRLLPLRVSAKGGPTELSLTKSAWEASSLRSSRH
FT SGFSHL"
XX
SQ Sequence 1218 BP; 162 A; 397 C; 387 G; 272 T; 0 other;
atgagcccct acgggcttaa cctgagccta gtggatgagg caacaacgtg tgtaacaccc 60
agggtcccca atacatctgt ggtgctgcca acaggcggta acggcacatc accagcgctg 120
cctatcttct ccatgacgct gggtgctgtg tccaacgtgc tggcgctggc gctgctggcc 180
caggttgcag gcagactgcg gcgccgccgc tcgactgcca ccttcctgtt gttcgtcgcc 240
agcctgcttg ccatcgacct agcaggccat gtgatcccgg gcgccttggt gcttcgcctg 300
tatactgcag gacgtgcgcc cgctggcggg gcctgtcatt tcctgggcgg ctgtatggtc 360
ttctttggcc tgtgcccact tttgcttggc tgtggcatgg ccgtggagcg ctgcgtgggt 420
gtcacgcagc cgctgatcca cgcggcgcgc gtgtccgtag cccgcgcacg cctggcacta 480
gccctgctgg ccgccatggc tttggcagtg gcgctgctgc cactagtgca cgtgggtcac 540
tacgagctac agtaccctgg cacttggtgt ttcattagcc ttgggcctcc tggaggttgg 600
cgccaggcgt tgcttgcggg cctcttcgcc ggccttggcc tggctgcgct ccttgccgca 660
ctagtgtgta atacgctcag cggcctggcg ctccttcgtg cccgctggag gcggcgtcgc 720
tctcgacgtt tccgagagaa cgcaggtccc gatgatcgcc ggcgctgggg gtcccgtgga 780
ctccgcttgg cctccgcctc gtctgcgtca tccatcactt caaccacagc tgccctccgc 840
agctctcggg gaggcggctc cgcgcgcagg gttcacgcac acgacgtgga aatggtgggc 900
cagctcgtgg gcatcatggt ggtgtcgtgc atctgctgga gccccctgct ggtattggtg 960
gtgttggcca tcgggggctg gaactctaac tccctgcagc ggccgctctt tctggctgta 1020
cgcctcgcgt cgtggaacca gatcctggac ccatgggtgt acatcctgct gcgccaggct 1080
atgctgcgcc aacttcttcg cctcctaccc ctgagggtta gtgccaaggg tggtccaacg 1140
gagctgagcc taaccaagag tgcctgggag gccagttcac tgcgtagctc ccggcacagt 1200
ggcttcagcc acttgtga 1218
//
</pre>
</td></tr></table><p>
<H2>
Output file format
</H2>
<a name="output.1"></a>
<h3>Output files for usage example </h3>
<p><h3>File: u68037.cpgplot</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
CPGPLOT islands of unusual CG composition
U68037 from 1 to 1218
Observed/Expected ratio > 0.60
Percent C + Percent G > 50.00
Length > 200
Length 406 (104..509)
Length 329 (596..924)
</pre>
</td></tr></table><p>
<p><h3>File: u68037.gff</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
##gff-version 2.0
##date 2006-07-15
##Type DNA U68037
U68037 cpgplot misc_feature 104 509 0.000 + . Sequence "U68037.1"
U68037 cpgplot misc_feature 596 924 0.000 + . Sequence "U68037.2"
</pre>
</td></tr></table><p>
<p><h3>Graphics File: cpgplot.ps</h3>
<p><img src="cpgplot.1.cpgplot.gif" alt="[cpgplot results]">
<H2>
Notes
</H2>
None.
<H2>
References
</H2>
The original program was described in:
<ol>
<li>
Larsen F, Gundersen G, Lopez R, Prydz H
"CpG islands as gene markers in the human genome."
Genomics 1992 Aug;13(4):1095-107
</ol>
<H2>
Warnings
</H2>
None.
<H2>
Diagnostic Error Messages
</H2>
None.
<H2>
Exit status
</H2>
0 if successful.
<H2>
Known bugs
</H2>
None.
<h2><a name="See also">See also</a></h2>
<table border cellpadding=4 bgcolor="#FFFFF0">
<tr><th>Program name</th><th>Description</th></tr>
<tr>
<td><a href="cpgreport.html">cpgreport</a></td>
<td>Reports all CpG rich regions</td>
</tr>
<tr>
<td><a href="geecee.html">geecee</a></td>
<td>Calculates fractional GC content of nucleic acid sequences</td>
</tr>
<tr>
<td><a href="newcpgreport.html">newcpgreport</a></td>
<td>Report CpG rich areas</td>
</tr>
<tr>
<td><a href="newcpgseek.html">newcpgseek</a></td>
<td>Reports CpG rich regions</td>
</tr>
</table>
<p>
As there is no official definition of what is a cpg island is, and worst
where they begin and end, we have to live with 2 definitions and thus
two methods. These are:
<p>
1. <b>newcpgseek</b> and <b>cpgreport</b> - both declare a putative
island if the score is higher than a threshold (17 at the moment). They
now also displaying the actual CpG count, the % CG and the
observed/expected ration in the region where the score is above the
threshold. This scoring method based on sum/frequencies overpredicts
islands but finds the smaller ones around primary exons.
<b>newcpgseek</b> uses the same method as <b>cpgreport</b> but the
output is different and more readable.
<p>
2. <b>newcpgreport</b> and <b>cpgplot</b> use a sliding window within
which the Obs/Exp ratio of CpG is calculated. The important thing to
note in this method is that an island, in order to be reported, is
defined as a region that satisfies the following contraints:
<p>
<pre>
Obs/Exp ratio > 0.6
% C + % G > 50%
Length > 200.
</pre>
<p>
<p>
For all practical purposes you should probably use newcpgreport. It is
actually used to produce the human cpgisland database you can find on
the EBI's ftp server as well as on the EBI's SRS server.
<p>
<b>geecee</b> measures CG content in the entire input sequence and is
not to be used to detect CpG islands. It can be usefull for detecting
sequences that MIGHT contain an island.
<H2>
Author(s)
</H2>
Alan Bleasby (ajb © ebi.ac.uk)
<br>
European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK
<H2>
History
</H2>
Completed 23rd March 1999.
<H2>
Target users
</H2>
This program is intended to be used by everyone and everything, from naive users to embedded scripts.
<H2>
Comments
</H2>
None
</BODY>
</HTML>
|