1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839
|
<HTML>
<HEAD>
<TITLE>
EMBOSS: merger
</TITLE>
</HEAD>
<BODY BGCOLOR="#FFFFFF" text="#000000">
<table align=center border=0 cellspacing=0 cellpadding=0>
<tr><td valign=top>
<A HREF="/" ONMOUSEOVER="self.status='Go to the EMBOSS home page';return true"><img border=0 src="emboss_icon.jpg" alt="" width=150 height=48></a>
</td>
<td align=left valign=middle>
<b><font size="+6">
merger
</font></b>
</td></tr>
</table>
<br>
<p>
<H2>
Function
</H2>
Merge two overlapping sequences
<H2>
Description
</H2>
This joins two overlapping nucleic acid sequences into one merged
sequence.
<p>
It uses a global alignment algorithm (Needleman & Wunsch) to optimally
align the sequences and then it creates the merged sequence from the
alignment. When there is a mismatch in the alignment between the two
sequences, the correct base to include in the resulting sequence is
chosen by using the base from the sequence which has the best local
sequence quality score. The following heuristic is used to find the
sequence quality score:
<p>
If one of the bases is a 'N', then the other sequence's base is used,
else:
<p>
A window size around the disputed base is used to find the local quality
score. This window size is increased from 5, to 10 to 20 bases or until
there is a clear decision on the best choice. If there is no best
choice after using a window of 20, then the base in the first sequence
is used.
<p>
To calculate the quality of a window of a sequence around a base:
<ul>
<li>quality = sequence value/length under window either side of the base
<li>sequence value = sum of points in that window
<li>unambiguous bases (ACGTU) score 2 points
<li>ambiguous bases (MRWSYKVHDB) score 1 point
<li>Ns score 0 points
<li>off end of the sequence scores 0 points
</ul>
<p>
N.B. This heavily discriminates against the iffy bits at the end of
sequence reads.
<p>
This program was originally written to aid in the reconstruction of mRNA
sequences which had been sequenced from both ends as a 5' and 3' EST
(cDNA). eg. joining two reads produced by primer walking sequencing.
<p>
Care should be taken to reverse one of the sequences (e.g. using the
qualifier '-sreverse2') if this is required to get them both in the
correct orientation.
<p>
Because it uses a Needleman & Wunsch alignment the required memory may
be greater than the available memory when attempting to merge large
(cosmid-sized or greater) sequences.
<p>
The gap open and gap extension penalties have been set at a higher level
than is usual (50 and 5). This was experimentally determined to give
the best results with a set of poor quality EST test sequences.
<H2>
Usage
</H2>
<b>Here is a sample session with merger</b>
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>merger </b>
Merge two overlapping sequences
Input sequence: <b>tembl:v00295</b>
Second sequence: <b>tembl:x51872</b>
Output alignment [v00295.merger]: <b></b>
output sequence [v00295.fasta]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#input.1">Go to the input files for this example</a><br><a href="#output.1">Go to the output files for this example</a><p><p>
<p>
Typically, one of the sequences will need to be reverse-complemented to put it
into the correct orientation to make it join. For example:
<p>
<pre>
% merger file1.seq file2.seq -sreverse2 -outseq merged.seq
</pre>
<H2>
Command line arguments
</H2>
<table CELLSPACING=0 CELLPADDING=3 BGCOLOR="#f5f5ff" ><tr><td>
<pre>
Standard (Mandatory) qualifiers:
[-asequence] sequence Sequence filename and optional format, or
reference (input USA)
[-bsequence] sequence Sequence filename and optional format, or
reference (input USA)
[-outfile] align [*.merger] Output alignment file name
[-outseq] seqout [<sequence>.<format>] Sequence filename and
optional format (output USA)
Additional (Optional) qualifiers:
-datafile matrixf [EBLOSUM62 for protein, EDNAFULL for DNA]
This is the scoring matrix file used when
comparing sequences. By default it is the
file 'EBLOSUM62' (for proteins) or the file
'EDNAFULL' (for nucleic sequences). These
files are found in the 'data' directory of
the EMBOSS installation.
-gapopen float [@($(acdprotein)? 50.0 : 50.0 )] Gap opening
penalty (Number from 0.000 to 100.000)
-gapextend float [@($(acdprotein)? 5.0 : 5.0)] Gap extension
penalty (Number from 0.000 to 10.000)
Advanced (Unprompted) qualifiers: (none)
Associated qualifiers:
"-asequence" associated qualifiers
-sbegin1 integer Start of the sequence to be used
-send1 integer End of the sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-sformat1 string Input sequence format
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-bsequence" associated qualifiers
-sbegin2 integer Start of the sequence to be used
-send2 integer End of the sequence to be used
-sreverse2 boolean Reverse (if DNA)
-sask2 boolean Ask for begin/end/reverse
-snucleotide2 boolean Sequence is nucleotide
-sprotein2 boolean Sequence is protein
-slower2 boolean Make lower case
-supper2 boolean Make upper case
-sformat2 string Input sequence format
-sdbname2 string Database name
-sid2 string Entryname
-ufo2 string UFO features
-fformat2 string Features format
-fopenfile2 string Features file name
"-outfile" associated qualifiers
-aformat3 string Alignment format
-aextension3 string File name extension
-adirectory3 string Output directory
-aname3 string Base file name
-awidth3 integer Alignment width
-aaccshow3 boolean Show accession number in the header
-adesshow3 boolean Show description in the header
-ausashow3 boolean Show the full USA in the alignment
-aglobal3 boolean Show the full sequence in alignment
"-outseq" associated qualifiers
-osformat4 string Output seq format
-osextension4 string File name extension
-osname4 string Base file name
-osdirectory4 string Output directory
-osdbname4 string Database name to add
-ossingle4 boolean Separate file for each entry
-oufo4 string UFO features
-offormat4 string Features format
-ofname4 string Features file name
-ofdirectory4 string Output directory
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write standard output
-filter boolean Read standard input, write standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
</pre>
</td></tr></table>
<P>
<table border cellspacing=0 cellpadding=3 bgcolor="#ccccff">
<tr bgcolor="#FFFFCC">
<th align="left" colspan=2>Standard (Mandatory) qualifiers</th>
<th align="left">Allowed values</th>
<th align="left">Default</th>
</tr>
<tr>
<td>[-asequence]<br>(Parameter 1)</td>
<td>Sequence filename and optional format, or reference (input USA)</td>
<td>Readable sequence</td>
<td><b>Required</b></td>
</tr>
<tr>
<td>[-bsequence]<br>(Parameter 2)</td>
<td>Sequence filename and optional format, or reference (input USA)</td>
<td>Readable sequence</td>
<td><b>Required</b></td>
</tr>
<tr>
<td>[-outfile]<br>(Parameter 3)</td>
<td>Output alignment file name</td>
<td>Alignment output file</td>
<td><i><*></i>.merger</td>
</tr>
<tr>
<td>[-outseq]<br>(Parameter 4)</td>
<td>Sequence filename and optional format (output USA)</td>
<td>Writeable sequence</td>
<td><i><*></i>.<i>format</i></td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=2>Additional (Optional) qualifiers</th>
<th align="left">Allowed values</th>
<th align="left">Default</th>
</tr>
<tr>
<td>-datafile</td>
<td>This is the scoring matrix file used when comparing sequences. By default it is the file 'EBLOSUM62' (for proteins) or the file 'EDNAFULL' (for nucleic sequences). These files are found in the 'data' directory of the EMBOSS installation.</td>
<td>Comparison matrix file in EMBOSS data path</td>
<td>EBLOSUM62 for protein<br>EDNAFULL for DNA</td>
</tr>
<tr>
<td>-gapopen</td>
<td>Gap opening penalty</td>
<td>Number from 0.000 to 100.000</td>
<td>@($(acdprotein)? 50.0 : 50.0 )</td>
</tr>
<tr>
<td>-gapextend</td>
<td>Gap extension penalty</td>
<td>Number from 0.000 to 10.000</td>
<td>@($(acdprotein)? 5.0 : 5.0)</td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=2>Advanced (Unprompted) qualifiers</th>
<th align="left">Allowed values</th>
<th align="left">Default</th>
</tr>
<tr>
<td colspan=4>(none)</td>
</tr>
</table>
<H2>
Input file format
</H2>
<b>merger</b> reads any two sequence USAs of the same type (protein or
nucleic acid.)
<p>
<a name="input.1"></a>
<h3>Input files for usage example </h3>
'tembl:v00295' is a sequence entry in the example nucleic acid database 'tembl'
<p>
<p><h3>Database entry: tembl:v00295</h3>
<table width="90%"><tr><td bgcolor="#FFCCFF">
<pre>
ID V00295; SV 1; linear; genomic DNA; STD; PRO; 1500 BP.
XX
AC V00295;
XX
DT 09-JUN-1982 (Rel. 01, Created)
DT 07-JUL-1995 (Rel. 44, Last updated, Version 4)
XX
DE E. coli lacY gene (codes for lactose permease).
XX
KW membrane protein.
XX
OS Escherichia coli
OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC Enterobacteriaceae; Escherichia.
XX
RN [1]
RP 1-1500
RX DOI; 10.1038/283541a0.
RX PUBMED; 6444453.
RA Buechel D.E., Gronenborn B., Mueller-Hill B.;
RT "Sequence of the lactose permease gene";
RL Nature 283(5747):541-545(1980).
XX
CC lacZ is a beta-galactosidase and lacA is transacetylase.
CC KST ECO.LACY
XX
FH Key Location/Qualifiers
FH
FT source 1..1500
FT /organism="Escherichia coli"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:562"
FT CDS <1..54
FT /codon_start=1
FT /transl_table=11
FT /note="reading frame (lacZ)"
FT /db_xref="GOA:P00722"
FT /db_xref="PDB:1BGL"
FT /db_xref="PDB:1BGM"
FT /db_xref="PDB:1DP0"
FT /db_xref="PDB:1F49"
FT /db_xref="PDB:1F4A"
FT /db_xref="PDB:1F4H"
FT /db_xref="PDB:1GHO"
FT /db_xref="PDB:1HN1"
FT /db_xref="PDB:1JYN"
FT /db_xref="PDB:1JYV"
FT /db_xref="PDB:1JYW"
FT /db_xref="PDB:1JYX"
FT /db_xref="PDB:1JYY"
<font color=red> [Part of this file has been deleted for brevity]</font>
FT /db_xref="PDB:2CFP"
FT /db_xref="PDB:2CFQ"
FT /db_xref="UniProtKB/Swiss-Prot:P02920"
FT /protein_id="CAA23571.1"
FT /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT INNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT LSGPGPLSLLRRQVNEVA"
FT CDS 1423..>1500
FT /transl_table=11
FT /note="reading frame (lacA)"
FT /db_xref="GOA:P07464"
FT /db_xref="PDB:1KQA"
FT /db_xref="PDB:1KRR"
FT /db_xref="PDB:1KRU"
FT /db_xref="PDB:1KRV"
FT /db_xref="UniProtKB/Swiss-Prot:P07464"
FT /protein_id="CAA23572.1"
FT /translation="MNMPMTERIRAGKLFTDMCEGLPEKR"
XX
SQ Sequence 1500 BP; 315 A; 342 C; 357 G; 486 T; 0 other;
ttccagctga gcgccggtcg ctaccattac cagttggtct ggtgtcaaaa ataataataa 60
ccgggcaggc catgtctgcc cgtatttcgc gtaaggaaat ccattatgta ctatttaaaa 120
aacacaaact tttggatgtt cggtttattc tttttctttt acttttttat catgggagcc 180
tacttcccgt ttttcccgat ttggctacat gacatcaacc atatcagcaa aagtgatacg 240
ggtattattt ttgccgctat ttctctgttc tcgctattat tccaaccgct gtttggtctg 300
ctttctgaca aactcgggct gcgcaaatac ctgctgtgga ttattaccgg catgttagtg 360
atgtttgcgc cgttctttat ttttatcttc gggccactgt tacaatacaa cattttagta 420
ggatcgattg ttggtggtat ttatctaggc ttttgtttta acgccggtgc gccagcagta 480
gaggcattta ttgagaaagt cagccgtcgc agtaatttcg aatttggtcg cgcgcggatg 540
tttggctgtg ttggctgggc gctgtgtgcc tcgattgtcg gcatcatgtt caccatcaat 600
aatcagtttg ttttctggct gggctctggc tgtgcactca tcctcgccgt tttactcttt 660
ttcgccaaaa cggatgcgcc ctcttctgcc acggttgcca atgcggtagg tgccaaccat 720
tcggcattta gccttaagct ggcactggaa ctgttcagac agccaaaact gtggtttttg 780
tcactgtatg ttattggcgt ttcctgcacc tacgatgttt ttgaccaaca gtttgctaat 840
ttctttactt cgttctttgc taccggtgaa cagggtacgc gggtatttgg ctacgtaacg 900
acaatgggcg aattacttaa cgcctcgatt atgttctttg cgccactgat cattaatcgc 960
atcggtggga aaaacgccct gctgctggct ggcactatta tgtctgtacg tattattggc 1020
tcatcgttcg ccacctcagc gctggaagtg gttattctga aaacgctgca tatgtttgaa 1080
gtaccgttcc tgctggtggg ctgctttaaa tatattacca gccagtttga agtgcgtttt 1140
tcagcgacga tttatctggt ctgtttctgc ttctttaagc aactggcgat gatttttatg 1200
tctgtactgg cgggcaatat gtatgaaagc atcggtttcc agggcgctta tctggtgctg 1260
ggtctggtgg cgctgggctt caccttaatt tccgtgttca cgcttagcgg ccccggcccg 1320
ctttccctgc tgcgtcgtca ggtgaatgaa gtcgcttaag caatcaatgt cggatgcggc 1380
gcgacgctta tccgaccaac atatcataac ggagtgatcg cattgaacat gccaatgacc 1440
gaaagaataa gagcaggcaa gctatttacc gatatgtgcg aaggcttacc ggaaaaaaga 1500
//
</pre>
</td></tr></table><p>
<p><h3>Database entry: tembl:x51872</h3>
<table width="90%"><tr><td bgcolor="#FFCCFF">
<pre>
ID X51872; SV 1; linear; genomic DNA; STD; PRO; 1832 BP.
XX
AC X51872;
XX
DT 17-APR-1990 (Rel. 23, Created)
DT 05-JUL-1999 (Rel. 60, Last updated, Version 5)
XX
DE Escherichia coli lacA gene for thiogalactoside transacetylase
XX
KW lac operon; lacA gene; lacY gene; thiogalactoside transacetylase.
XX
OS Escherichia coli
OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC Enterobacteriaceae; Escherichia.
XX
RN [1]
RC (1-1832)
RP 1-1832
RX PUBMED; 3901000.
RA Hediger M.A, Johnson D.F., Nierlich D.P., Zabin I.;
RT "DNA sequence of the lactose operon: the lacA gene and the transcriptional
RT termination region.";
RL Proc. Natl. Acad. Sci. U.S.A. 82(19):6414-6418(1985).
XX
FH Key Location/Qualifiers
FH
FT source 1..1832
FT /organism="Escherichia coli"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:562"
FT CDS <1..18
FT /codon_start=1
FT /transl_table=11
FT /product="lacY gene product"
FT /protein_id="CAA36161.1"
FT /translation="VNEVA"
FT CDS 82..693
FT /transl_table=11
FT /gene="lacA"
FT /product="thiogalactoside transacetylase"
FT /db_xref="GOA:P07464"
FT /db_xref="InterPro:IPR001451"
FT /db_xref="InterPro:IPR011004"
FT /db_xref="PDB:1KQA"
FT /db_xref="PDB:1KRR"
FT /db_xref="PDB:1KRU"
FT /db_xref="PDB:1KRV"
FT /db_xref="UniProtKB/Swiss-Prot:P07464"
FT /protein_id="CAA36162.1"
FT /translation="MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVE
FT KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
FT APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
FT VTKDIPPNVVAAGVPCRVIREINDRDKHYYFKDYKVESSV"
XX
SQ Sequence 1832 BP; 519 A; 510 C; 450 G; 353 T; 0 other;
gtgaatgaag tcgcttaagc aatcaatgtc ggatgcggcg cgacgcttat ccgaccaaca 60
tatcataacg gagtgatcgc attgaacatg ccaatgaccg aaagaataag agcaggcaag 120
ctatttaccg atatgtgcga aggcttaccg gaaaaaagac ttcgtgggaa aacgttaatg 180
tatgagttta atcactcgca tccatcagaa gttgaaaaaa gagaaagcct gattaaagaa 240
atgtttgcca cggtagggga aaacgcctgg gtagaaccgc ctgtctattt ctcttacggt 300
tccaacatcc atataggccg caatttttat gcaaatttca atttaaccat tgtcgatgac 360
tacacggtaa caatcggtga taacgtactg attgcaccca acgttactct ttccgttacg 420
ggacaccctg tacaccatga attgagaaaa aacggcgaga tgtactcttt tccgataacg 480
attggcaata acgtctggat cggaagtcat gtggttatta atccaggcgt caccatcggg 540
gataattctg ttattggcgc gggtagtatc gtcacaaaag acattccacc aaacgtcgtg 600
gcggctggcg ttccttgtcg ggttattcgc gaaataaacg accgggataa gcactattat 660
ttcaaagatt ataaagttga atcgtcagtt taaattataa aaattgcctg atacgctgcg 720
cttatcaggc ctacaagttc agcgatctac attagccgca tccggcatga acaaagcgca 780
ggaacaagcg tcgcatcatg cctctttgac ccacagctgc ggaaaacgta ctggtgcaaa 840
acgcagggtt atgatcatca gcccaacgac gcacagcgca tgaaatgccc agtccatcag 900
gtaattgccg ctgatactac gcagcacgcc agaaaaccac ggggcaagcc cggcgatgat 960
aaaaccgatt ccctgcataa acgccaccag cttgccagca atagccggtt gcacagagtg 1020
atcgagcgcc agcagcaaac agagcggaaa cgcgccgccc agacctaacc cacacaccat 1080
cgcccacaat accggcaatt gcatcggcag ccagataaag ccgcagaacc ccaccagttg 1140
taacaccagc gccagcatta acagtttgcg ccgatcctga tggcgagcca tagcaggcat 1200
cagcaaagct cctgcggctt gcccaagcgt catcaatgcc agtaaggaac cgctgtactg 1260
cgcgctggca ccaatctcaa tatagaaagc gggtaaccag gcaatcaggc tggcgtaacc 1320
gccgttaatc agaccgaagt aaacacccag cgtccacgcg cggggagtga ataccacgcg 1380
aaccggagtg gttgttgtct tgtgggaaga ggcgacctcg cgggcgcttt gccaccacca 1440
ggcaaagagc gcaacaacgg caggcagcgc caccaggcga gtgtttgata ccaggtttcg 1500
ctatgttgaa ctaaccaggg cgttatggcg gcaccaagcc caccgccgcc catcagagcc 1560
gcggaccaca gccccatcac cagtggcgtg cgctgctgaa accgccgttt aatcaccgaa 1620
gcatcaccgc ctgaatgatg ccgatcccca ccccaccaag cagtgcgctg ctaagcagca 1680
gcgcactttg cgggtaaagc tcacgcatca atgcaccgac ggcaatcagc aacagactga 1740
tggcgacact gcgacgttcg ctgacatgct gatgaagcca gcttccggcc agcgccagcc 1800
cgcccatggt aaccaccggc agagcggtcg ac 1832
//
</pre>
</td></tr></table><p>
<H2>
Output file format
</H2>
The output <i>sequence file</i> contains the joined sequence, by default in
FASTA format. Where there is a mismatch in the alignment, the chosen
base is written to the output sequence in uppercase.
<p>
<p>
The output is a standard EMBOSS alignment file.
<p>
The results can be output in one of several styles by using the
command-line qualifier <b>-aformat xxx</b>, where 'xxx' is replaced by
the name of the required format. Some of the alignment formats can cope
with an unlimited number of sequences, while others are only for pairs
of sequences.
<p>
The available multiple alignment format names are: unknown, multiple,
simple, fasta, msf, trace, srs
<p>
The available pairwise alignment format names are: pair, markx0, markx1,
markx2, markx3, markx10, srspair, score
<p>
See:
<A href="http://emboss.sf.net/docs/themes/AlignFormats.html">
http://emboss.sf.net/docs/themes/AlignFormats.html</A>
for further information on alignment formats.
<p>
<p>
The output <i>report file</i> contains descriptions of the positions where
there is a mismatch in the alignment and shows the alignment. Where
there is a mismatch in the alignment, the chosen base is written in
uppercase.
<p>
<a name="output.1"></a>
<h3>Output files for usage example </h3>
<p><h3>File: v00295.merger</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
########################################
# Program: merger
# Rundate: Sun 15 Jul 2007 12:00:00
# Commandline: merger
# -asequence tembl:v00295
# -bsequence tembl:x51872
# Align_format: simple
# Report_file: v00295.merger
########################################
#=======================================
#
# Aligned_sequences: 2
# 1: V00295
# 2: X51872
# Matrix: EDNAFULL
# Gap_penalty: 50.0
# Extend_penalty: 5.0
#
# Length: 3173
# Identity: 159/3173 ( 5.0%)
# Similarity: 159/3173 ( 5.0%)
# Gaps: 3014/3173 (95.0%)
# Score: 795.0
#
#
#=======================================
V00295 1 ttccagctgagcgccggtcgctaccattaccagttggtctggtgtcaaaa 50
X51872 1 -------------------------------------------------- 0
V00295 51 ataataataaccgggcaggccatgtctgcccgtatttcgcgtaaggaaat 100
X51872 1 -------------------------------------------------- 0
V00295 101 ccattatgtactatttaaaaaacacaaacttttggatgttcggtttattc 150
X51872 1 -------------------------------------------------- 0
V00295 151 tttttcttttacttttttatcatgggagcctacttcccgtttttcccgat 200
X51872 1 -------------------------------------------------- 0
V00295 201 ttggctacatgacatcaaccatatcagcaaaagtgatacgggtattattt 250
X51872 1 -------------------------------------------------- 0
V00295 251 ttgccgctatttctctgttctcgctattattccaaccgctgtttggtctg 300
<font color=red> [Part of this file has been deleted for brevity]</font>
X51872 1310 ctggcgtaaccgccgttaatcagaccgaagtaaacacccagcgtccacgc 1359
V00295 1501 -------------------------------------------------- 1500
X51872 1360 gcggggagtgaataccacgcgaaccggagtggttgttgtcttgtgggaag 1409
V00295 1501 -------------------------------------------------- 1500
X51872 1410 aggcgacctcgcgggcgctttgccaccaccaggcaaagagcgcaacaacg 1459
V00295 1501 -------------------------------------------------- 1500
X51872 1460 gcaggcagcgccaccaggcgagtgtttgataccaggtttcgctatgttga 1509
V00295 1501 -------------------------------------------------- 1500
X51872 1510 actaaccagggcgttatggcggcaccaagcccaccgccgcccatcagagc 1559
V00295 1501 -------------------------------------------------- 1500
X51872 1560 cgcggaccacagccccatcaccagtggcgtgcgctgctgaaaccgccgtt 1609
V00295 1501 -------------------------------------------------- 1500
X51872 1610 taatcaccgaagcatcaccgcctgaatgatgccgatccccaccccaccaa 1659
V00295 1501 -------------------------------------------------- 1500
X51872 1660 gcagtgcgctgctaagcagcagcgcactttgcgggtaaagctcacgcatc 1709
V00295 1501 -------------------------------------------------- 1500
X51872 1710 aatgcaccgacggcaatcagcaacagactgatggcgacactgcgacgttc 1759
V00295 1501 -------------------------------------------------- 1500
X51872 1760 gctgacatgctgatgaagccagcttccggccagcgccagcccgcccatgg 1809
V00295 1501 ----------------------- 1500
X51872 1810 taaccaccggcagagcggtcgac 1832
#---------------------------------------
#
# Conflicts: V00295 X51872
# position base position base Using
#
#
#---------------------------------------
</pre>
</td></tr></table><p>
<p><h3>File: v00295.fasta</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
>V00295 V00295.1 E. coli lacY gene (codes for lactose permease).
ttccagctgagcgccggtcgctaccattaccagttggtctggtgtcaaaaataataataa
ccgggcaggccatgtctgcccgtatttcgcgtaaggaaatccattatgtactatttaaaa
aacacaaacttttggatgttcggtttattctttttcttttacttttttatcatgggagcc
tacttcccgtttttcccgatttggctacatgacatcaaccatatcagcaaaagtgatacg
ggtattatttttgccgctatttctctgttctcgctattattccaaccgctgtttggtctg
ctttctgacaaactcgggctgcgcaaatacctgctgtggattattaccggcatgttagtg
atgtttgcgccgttctttatttttatcttcgggccactgttacaatacaacattttagta
ggatcgattgttggtggtatttatctaggcttttgttttaacgccggtgcgccagcagta
gaggcatttattgagaaagtcagccgtcgcagtaatttcgaatttggtcgcgcgcggatg
tttggctgtgttggctgggcgctgtgtgcctcgattgtcggcatcatgttcaccatcaat
aatcagtttgttttctggctgggctctggctgtgcactcatcctcgccgttttactcttt
ttcgccaaaacggatgcgccctcttctgccacggttgccaatgcggtaggtgccaaccat
tcggcatttagccttaagctggcactggaactgttcagacagccaaaactgtggtttttg
tcactgtatgttattggcgtttcctgcacctacgatgtttttgaccaacagtttgctaat
ttctttacttcgttctttgctaccggtgaacagggtacgcgggtatttggctacgtaacg
acaatgggcgaattacttaacgcctcgattatgttctttgcgccactgatcattaatcgc
atcggtgggaaaaacgccctgctgctggctggcactattatgtctgtacgtattattggc
tcatcgttcgccacctcagcgctggaagtggttattctgaaaacgctgcatatgtttgaa
gtaccgttcctgctggtgggctgctttaaatatattaccagccagtttgaagtgcgtttt
tcagcgacgatttatctggtctgtttctgcttctttaagcaactggcgatgatttttatg
tctgtactggcgggcaatatgtatgaaagcatcggtttccagggcgcttatctggtgctg
ggtctggtggcgctgggcttcaccttaatttccgtgttcacgcttagcggccccggcccg
ctttccctgctgcgtcgtcaggtgaatgaagtcgcttaagcaatcaatgtcggatgcggc
gcgacgcttatccgaccaacatatcataacggagtgatcgcattgaacatgccaatgacc
gaaagaataagagcaggcaagctatttaccgatatgtgcgaaggcttaccggaaaaaaga
cttcgtgggaaaacgttaatgtatgagtttaatcactcgcatccatcagaagttgaaaaa
agagaaagcctgattaaagaaatgtttgccacggtaggggaaaacgcctgggtagaaccg
cctgtctatttctcttacggttccaacatccatataggccgcaatttttatgcaaatttc
aatttaaccattgtcgatgactacacggtaacaatcggtgataacgtactgattgcaccc
aacgttactctttccgttacgggacaccctgtacaccatgaattgagaaaaaacggcgag
atgtactcttttccgataacgattggcaataacgtctggatcggaagtcatgtggttatt
aatccaggcgtcaccatcggggataattctgttattggcgcgggtagtatcgtcacaaaa
gacattccaccaaacgtcgtggcggctggcgttccttgtcgggttattcgcgaaataaac
gaccgggataagcactattatttcaaagattataaagttgaatcgtcagtttaaattata
aaaattgcctgatacgctgcgcttatcaggcctacaagttcagcgatctacattagccgc
atccggcatgaacaaagcgcaggaacaagcgtcgcatcatgcctctttgacccacagctg
cggaaaacgtactggtgcaaaacgcagggttatgatcatcagcccaacgacgcacagcgc
atgaaatgcccagtccatcaggtaattgccgctgatactacgcagcacgccagaaaacca
cggggcaagcccggcgatgataaaaccgattccctgcataaacgccaccagcttgccagc
aatagccggttgcacagagtgatcgagcgccagcagcaaacagagcggaaacgcgccgcc
cagacctaacccacacaccatcgcccacaataccggcaattgcatcggcagccagataaa
gccgcagaaccccaccagttgtaacaccagcgccagcattaacagtttgcgccgatcctg
atggcgagccatagcaggcatcagcaaagctcctgcggcttgcccaagcgtcatcaatgc
cagtaaggaaccgctgtactgcgcgctggcaccaatctcaatatagaaagcgggtaacca
ggcaatcaggctggcgtaaccgccgttaatcagaccgaagtaaacacccagcgtccacgc
gcggggagtgaataccacgcgaaccggagtggttgttgtcttgtgggaagaggcgacctc
gcgggcgctttgccaccaccaggcaaagagcgcaacaacggcaggcagcgccaccaggcg
agtgtttgataccaggtttcgctatgttgaactaaccagggcgttatggcggcaccaagc
ccaccgccgcccatcagagccgcggaccacagccccatcaccagtggcgtgcgctgctga
aaccgccgtttaatcaccgaagcatcaccgcctgaatgatgccgatccccaccccaccaa
gcagtgcgctgctaagcagcagcgcactttgcgggtaaagctcacgcatcaatgcaccga
cggcaatcagcaacagactgatggcgacactgcgacgttcgctgacatgctgatgaagcc
agcttccggccagcgccagcccgcccatggtaaccaccggcagagcggtcgac
</pre>
</td></tr></table><p>
<H2>
Data files
</H2>
It reads the scoring matrix for the alignment from the standard EMBOSS
'data' directory. By default it is the file 'EBLOSUM62' (for proteins)
or the file 'EDNAFULL' (for nucleic sequences).
<H2>
Notes
</H2>
None.
<H2>
References
</H2>
None.
<H2>
Warnings
</H2>
None.
<H2>
Diagnostic Error Messages
</H2>
None.
<H2>
Exit status
</H2>
It exits with a status of 0
<H2>
Known bugs
</H2>
None.
<h2><a name="See also">See also</a></h2>
<table border cellpadding=4 bgcolor="#FFFFF0">
<tr><th>Program name</th><th>Description</th></tr>
<tr>
<td><a href="cons.html">cons</a></td>
<td>Creates a consensus from multiple alignments</td>
</tr>
<tr>
<td><a href="megamerger.html">megamerger</a></td>
<td>Merge two large overlapping nucleic acid sequences</td>
</tr>
</table>
<H2>
Author(s)
</H2>
Gary Williams (gwilliam © rfcgr.mrc.ac.uk)
<br>
MRC Rosalind Franklin Centre for Genomics Research
Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SB, UK
<H2>
History
</H2>
Written (Gary Williams) 1999
<H2>
Target users
</H2>
This program is intended to be used by everyone and everything, from naive users to embedded scripts.
<H2>
Comments
</H2>
None
</BODY>
</HTML>
|