1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775
|
restrict
Function
Finds restriction enzyme cleavage sites
Description
Restrict uses the REBASE database of restriction enzymes to predict
cut sites in a DNA sequence. The program allows you to select a range
of cuts, whether the DNA is circular, whether IUB ambiguity codes are
used, whether blunt or sticky ends or both are reported. You may also
force the reporting of single cleavage sites.
By default, only one of any group of isoschizomers (enzymes that have
the same recognition site and cut positions) is reported (this
behaviour can be turned off by setting the qualifier '-limit' to be
false.) The reported enzyme from any one group of isoschizomers (the
prototype) is specified in the REBASE database and the information is
held in the data file 'embossre.equ'. You may edit this file to set
your own preferred prototype,if you wish.
Usage
Here is a sample session with restrict
% restrict
Finds restriction enzyme cleavage sites
Input nucleotide sequence(s): tembl:x65923
Minimum recognition site length [4]:
Comma separated enzyme list [all]:
Output report [x65923.restrict]:
Go to the input files for this example
Go to the output files for this example
Example 2
This gives the lengths of the restriction fragments produced by
cutting with all of the specified enzymes.
% restrict -fragments
Finds restriction enzyme cleavage sites
Input nucleotide sequence(s): tembl:x65923
Minimum recognition site length [4]:
Comma separated enzyme list [all]:
Output report [x65923.restrict]:
Go to the output files for this example
Example 3
This gives the lengths of the restriction fragments created by cutting
with just one of each of the specified enzymes in turn.
% restrict -solofragment
Finds restriction enzyme cleavage sites
Input nucleotide sequence(s): tembl:x65923
Minimum recognition site length [4]:
Comma separated enzyme list [all]:
Output report [x65923.restrict]:
Go to the output files for this example
Command line arguments
Standard (Mandatory) qualifiers:
[-sequence] seqall Nucleotide sequence(s) filename and optional
format, or reference (input USA)
-sitelen integer [4] This sets the minimum length of the
restriction enzyme recognition site. Any
enzymes with sites shorter than this will be
ignored. (Integer from 2 to 20)
-enzymes string [all] The name 'all' reads in all enzyme
names from the REBASE database. You can
specify enzymes by giving their names with
commas between then, such as:
'HincII,hinfI,ppiI,hindiii'.
The case of the names is not important. You
can specify a file of enzyme names to read
in by giving the name of the file holding
the enzyme names with a '@' character in
front of it, for example, '@enz.list'.
Blank lines and lines starting with a hash
character or '!' are ignored and all other
lines are concatenated together with a comma
character ',' and then treated as the list
of enzymes to search for.
An example of a file of enzyme names is:
! my enzymes
HincII, ppiII
! other enzymes
hindiii
HinfI
PpiI (Any string is accepted)
[-outfile] report [*.restrict] Output report file name
Additional (Optional) qualifiers: (none)
Advanced (Unprompted) qualifiers:
-datafile datafile Restriction enzyme data file (optional)
-min integer [1] This sets the minimum number of cuts for
any restriction enzyme that will be
considered. Any enzymes that cut fewer times
than this will be ignored. (Integer from 1
to 1000)
-max integer [2000000000] This sets the maximum number of
cuts for any restriction enzyme that will
be considered. Any enzymes that cut more
times than this will be ignored. (Integer up
to 2000000000)
-solofragment boolean [N] This gives the fragment lengths of the
forward sense strand produced by complete
restriction by each restriction enzyme on
its own. Results are added to the tail
section of the report.
-single boolean [N] If this is set then this forces the
values of the mincuts and maxcuts qualifiers
to both be 1. Any other value you may have
set them to will be ignored.
-[no]blunt boolean [Y] This allows those enzymes which cut at
the same position on the forward and reverse
strands to be considered.
-[no]sticky boolean [Y] This allows those enzymes which cut at
different positions on the forward and
reverse strands, leaving an overhang, to be
considered.
-[no]ambiguity boolean [Y] This allows those enzymes which have one
or more 'N' ambiguity codes in their
pattern to be considered
-plasmid boolean [N] If this is set then this allows searches
for restriction enzyme recognition site and
cut postions that span the end of the
sequence to be considered.
-[no]commercial boolean [Y] If this is set, then only those enzymes
with a commercial supplier will be searched
for. This qualifier is ignored if you have
specified an explicit list of enzymes to
search for, rather than searching through
'all' the enzymes in the REBASE database. It
is assumed that, if you are asking for an
explicit enzyme, then you probably know
where to get it from and so all enzymes
names that you have asked to be searched
for, and which cut, will be reported whether
or not they have a commercial supplier.
-[no]limit boolean [Y] This limits the reporting of enzymes to
just one enzyme from each group of
isoschizomers. The enzyme chosen to
represent an isoschizomer group is the
prototype indicated in the data file
'embossre.equ', which is created by the
program 'rebaseextract'. If you prefer
different prototypes to be used, make a copy
of embossre.equ in your home directory and
edit it. If this value is set to be false
then all of the input enzymes will be
reported. You might like to set this to
false if you are supplying an explicit set
of enzymes rather than searching 'all' of
them.
-alphabetic boolean [N] Sort output alphabetically
-fragments boolean [N] This gives the fragment lengths of the
forward sense strand produced by complete
restriction using all of the input enzymes
together. Results are added to the tail
section of the report.
-name boolean [N] Show sequence name
Associated qualifiers:
"-sequence" associated qualifiers
-sbegin1 integer Start of each sequence to be used
-send1 integer End of each sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-sformat1 string Input sequence format
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-outfile" associated qualifiers
-rformat2 string Report format
-rname2 string Base file name
-rextension2 string File name extension
-rdirectory2 string Output directory
-raccshow2 boolean Show accession number in the report
-rdesshow2 boolean Show description in the report
-rscoreshow2 boolean Show the score in the report
-rusashow2 boolean Show the full USA in the report
-rmaxall2 integer Maximum total hits to report
-rmaxseq2 integer Maximum hits to report for one sequence
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write standard output
-filter boolean Read standard input, write standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
Input file format
restrict reads one or more DNA sequence USAs.
Input files for usage example
'tembl:x65923' is a sequence entry in the example nucleic acid
database 'tembl'
Database entry: tembl:x65923
ID X65923; SV 1; linear; mRNA; STD; HUM; 518 BP.
XX
AC X65923;
XX
DT 13-MAY-1992 (Rel. 31, Created)
DT 18-APR-2005 (Rel. 83, Last updated, Version 11)
XX
DE H.sapiens fau mRNA
XX
KW fau gene.
XX
OS Homo sapiens (human)
OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia
;
OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC Homo.
XX
RN [1]
RP 1-518
RA Michiels L.M.R.;
RT ;
RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,
RL Universiteisplein 1, 2610 Wilrijk, BELGIUM
XX
RN [2]
RP 1-518
RX PUBMED; 8395683.
RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;
RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as
RT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";
RL Oncogene 8(9):2537-2546(1993).
XX
DR H-InvDB; HIT000322806.
XX
FH Key Location/Qualifiers
FH
FT source 1..518
FT /organism="Homo sapiens"
FT /chromosome="11q"
FT /map="13"
FT /mol_type="mRNA"
FT /clone_lib="cDNA"
FT /clone="pUIA 631"
FT /tissue_type="placenta"
FT /db_xref="taxon:9606"
FT misc_feature 57..278
FT /note="ubiquitin like part"
FT CDS 57..458
FT /gene="fau"
FT /db_xref="GDB:135476"
FT /db_xref="GOA:P35544"
FT /db_xref="GOA:P62861"
FT /db_xref="HGNC:3597"
FT /db_xref="UniProtKB/Swiss-Prot:P35544"
FT /db_xref="UniProtKB/Swiss-Prot:P62861"
FT /protein_id="CAA46716.1"
FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLA
G
FT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKT
G
FT RAKRRMQYNRRFVNVVPTFGKKKGPNANS"
FT misc_feature 98..102
FT /note="nucleolar localization signal"
FT misc_feature 279..458
FT /note="S30 part"
FT polyA_signal 484..489
FT polyA_site 509
XX
SQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;
ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 6
0
agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 12
0
cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 18
0
tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 24
0
tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 30
0
gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 36
0
agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 42
0
cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 48
0
tctaataaaa aagccactta gttcagtcaa aaaaaaaa 51
8
//
Output file format
The output is a standard EMBOSS report file.
The results can be output in one of several styles by using the
command-line qualifier -rformat xxx, where 'xxx' is replaced by the
name of the required format. The available format names are: embl,
genbank, gff, pir, swiss, trace, listfile, dbmotif, diffseq, excel,
feattable, motif, regions, seqtable, simple, srs, table, tagseq
See: http://emboss.sf.net/docs/themes/ReportFormats.html for further
information on report formats.
By default restrict writes a 'table' report file.
Output files for usage example
File: x65923.restrict
########################################
# Program: restrict
# Rundate: Sun 15 Jul 2007 12:00:00
# Commandline: restrict
# -sequence tembl:x65923
# Report_format: table
# Report_file: x65923.restrict
########################################
#=======================================
#
# Sequence: X65923 from: 1 to: 518
# HitCount: 54
#
# Minimum cuts per enzyme: 1
# Maximum cuts per enzyme: 2000000000
# Minimum length of recognition site: 4
# Blunt ends allowed
# Sticky ends allowed
# DNA is linear
# Ambiguities allowed
#
#=======================================
Start End Enzyme_name Restriction_site 5prime 3prime 5primerev 3primerev
11 14 TaqI TCGA 11 13 . .
28 25 AciI CCGC 25 27 . .
36 31 BseYI CCCAGC 31 35 . .
38 41 AciI CCGC 38 40 . .
44 40 BceAI ACGGC 25 27 . .
71 81 BsiYI CCNNNNNNNGG 77 74 . .
71 74 AciI CCGC 71 73 . .
73 76 Hin6I GCGC 73 75 . .
73 76 HhaI GCGC 75 73 . .
77 81 EcoRII CCWGG 76 81 . .
77 81 BssKI CCNGG 76 81 . .
94 97 TaqI TCGA 94 96 . .
103 106 HpaII CCGG 103 105 . .
105 108 HaeIII GGCC 106 106 . .
107 111 EcoRII CCWGG 106 111 . .
107 111 BssKI CCNGG 106 111 . .
107 117 BsiYI CCNNNNNNNGG 113 110 . .
122 132 BsiYI CCNNNNNNNGG 128 125 . .
125 135 Hin4I GAYNNNNNVTC 116 111 148 143
146 150 BsrI ACTGG 151 149 . .
161 165 BssKI CCNGG 160 165 . .
162 165 HpaII CCGG 162 164 . .
182 186 EcoRII CCWGG 181 186 . .
182 186 BssKI CCNGG 181 186 . .
190 193 Hin6I GCGC 190 192 . .
190 193 HhaI GCGC 192 190 . .
192 195 Hin6I GCGC 192 194 . .
192 195 HhaI GCGC 194 192 . .
197 201 EcoRII CCWGG 196 201 . .
197 201 BssKI CCNGG 196 201 . .
209 212 HaeIII GGCC 210 210 . .
219 222 HaeIII GGCC 220 220 . .
221 231 BsiYI CCNNNNNNNGG 227 224 . .
225 221 BsrI ACTGG 221 219 . .
229 226 AciI CCGC 226 228 . .
236 239 HaeIII GGCC 237 237 . .
248 252 EcoRII CCWGG 247 252 . .
248 252 BssKI CCNGG 247 252 . .
261 264 HaeIII GGCC 262 262 . .
263 266 AciI CCGC 263 265 . .
293 297 EcoRII CCWGG 292 297 . .
293 297 BssKI CCNGG 292 297 . .
296 299 HaeIII GGCC 297 297 . .
335 338 HaeIII GGCC 336 336 . .
380 377 AciI CCGC 377 379 . .
383 380 AciI CCGC 380 382 . .
395 398 HpaII CCGG 395 397 . .
398 401 Hin6I GCGC 398 400 . .
398 401 HhaI GCGC 400 398 . .
405 410 HindII GTYRAC 407 407 . .
408 413 AclI AACGTT 409 411 . .
409 412 MaeII ACGT 409 411 . .
417 427 BsiYI CCNNNNNNNGG 423 420 . .
438 441 HaeIII GGCC 439 439 . .
#---------------------------------------
#---------------------------------------
#---------------------------------------
# Total_sequences: 1
# Total_hitcount: 54
#---------------------------------------
Output files for usage example 2
File: x65923.restrict
########################################
# Program: restrict
# Rundate: Sun 15 Jul 2007 12:00:00
# Commandline: restrict
# -fragments
# -sequence tembl:x65923
# Report_format: table
# Report_file: x65923.restrict
########################################
#=======================================
#
# Sequence: X65923 from: 1 to: 518
# HitCount: 54
#
# Minimum cuts per enzyme: 1
# Maximum cuts per enzyme: 2000000000
# Minimum length of recognition site: 4
# Blunt ends allowed
# Sticky ends allowed
# DNA is linear
# Ambiguities allowed
#
#=======================================
Start End Enzyme_name Restriction_site 5prime 3prime 5primerev 3primerev
11 14 TaqI TCGA 11 13 . .
28 25 AciI CCGC 25 27 . .
36 31 BseYI CCCAGC 31 35 . .
38 41 AciI CCGC 38 40 . .
44 40 BceAI ACGGC 25 27 . .
71 81 BsiYI CCNNNNNNNGG 77 74 . .
71 74 AciI CCGC 71 73 . .
73 76 Hin6I GCGC 73 75 . .
73 76 HhaI GCGC 75 73 . .
77 81 EcoRII CCWGG 76 81 . .
77 81 BssKI CCNGG 76 81 . .
94 97 TaqI TCGA 94 96 . .
103 106 HpaII CCGG 103 105 . .
105 108 HaeIII GGCC 106 106 . .
107 111 EcoRII CCWGG 106 111 . .
107 111 BssKI CCNGG 106 111 . .
107 117 BsiYI CCNNNNNNNGG 113 110 . .
122 132 BsiYI CCNNNNNNNGG 128 125 . .
125 135 Hin4I GAYNNNNNVTC 116 111 148 143
146 150 BsrI ACTGG 151 149 . .
161 165 BssKI CCNGG 160 165 . .
162 165 HpaII CCGG 162 164 . .
182 186 EcoRII CCWGG 181 186 . .
182 186 BssKI CCNGG 181 186 . .
[Part of this file has been deleted for brevity]
# 39
# 33
# 29
# 20
# 19
# 17
# 16
# 15
# 15
# 14
# 14
# 14
# 12
# 11
# 10
# 10
# 10
# 9
# 9
# 9
# 7
# 7
# 7
# 6
# 5
# 5
# 3
# 3
# 3
# 3
# 3
# 2
# 2
# 2
# 2
# 2
# 2
# 2
# 2
# 1
# 1
# 1
# 1
# 1
#
#---------------------------------------
#---------------------------------------
# Total_sequences: 1
# Total_hitcount: 54
#---------------------------------------
Output files for usage example 3
File: x65923.restrict
########################################
# Program: restrict
# Rundate: Sun 15 Jul 2007 12:00:00
# Commandline: restrict
# -solofragment
# -sequence tembl:x65923
# Report_format: table
# Report_file: x65923.restrict
########################################
#=======================================
#
# Sequence: X65923 from: 1 to: 518
# HitCount: 54
#
# Minimum cuts per enzyme: 1
# Maximum cuts per enzyme: 2000000000
# Minimum length of recognition site: 4
# Blunt ends allowed
# Sticky ends allowed
# DNA is linear
# Ambiguities allowed
#
#=======================================
Start End Enzyme_name Restriction_site 5prime 3prime 5primerev 3primerev
11 14 TaqI TCGA 11 13 . .
28 25 AciI CCGC 25 27 . .
36 31 BseYI CCCAGC 31 35 . .
38 41 AciI CCGC 38 40 . .
44 40 BceAI ACGGC 25 27 . .
71 81 BsiYI CCNNNNNNNGG 77 74 . .
71 74 AciI CCGC 71 73 . .
73 76 Hin6I GCGC 73 75 . .
73 76 HhaI GCGC 75 73 . .
77 81 EcoRII CCWGG 76 81 . .
77 81 BssKI CCNGG 76 81 . .
94 97 TaqI TCGA 94 96 . .
103 106 HpaII CCGG 103 105 . .
105 108 HaeIII GGCC 106 106 . .
107 111 EcoRII CCWGG 106 111 . .
107 111 BssKI CCNGG 106 111 . .
107 117 BsiYI CCNNNNNNNGG 113 110 . .
122 132 BsiYI CCNNNNNNNGG 128 125 . .
125 135 Hin4I GAYNNNNNVTC 116 111 148 143
146 150 BsrI ACTGG 151 149 . .
161 165 BssKI CCNGG 160 165 . .
162 165 HpaII CCGG 162 164 . .
182 186 EcoRII CCWGG 181 186 . .
182 186 BssKI CCNGG 181 186 . .
[Part of this file has been deleted for brevity]
# 70 151 297
#
# BssKI:
# [CCNGG]
# 15 21 30 45 51 54
# 76 226
#
# EcoRII:
# [CCWGG]
# 15 30 45 51 75 76
# 226
#
# HaeIII:
# [GGCC]
# 10 17 25 35 39 79
# 103 104 106
#
# HhaI:
# [GCGC]
# 2 75 117 118 206
#
# Hin4I:
# [GAYNNNNNVTC]
# 32 116 370
#
# Hin6I:
# [GCGC]
# 2 73 117 120 206
#
# HindII:
# [GTYRAC]
# 111 407
#
# HpaII:
# [CCGG]
# 59 103 123 233
#
# MaeII:
# [ACGT]
# 109 409
#
# TaqI:
# [TCGA]
# 11 83 424
#
#---------------------------------------
#---------------------------------------
# Total_sequences: 1
# Total_hitcount: 54
#---------------------------------------
The output from restrict is a simple text one. The base number,
restriction enzyme name, recognition site and cut positions are shown.
Note that cuts are always to the right of the residue shown and that
5' cuts are referred to by their associated 3' number sequence.
The program reports enzymes that cut at two or four sites. The program
also reports isoschizomers and enzymes having the same recognition
sequence but different cut sites.
When the "-fragments" or "-solofragments" qualifiers are given then
the sizes of the fragments produced by either all of the specified
enzymes cutting, or by each enzyme cutting individually, are given in
the 'tail' section at the end of the report file.
Data files
EMBOSS data files are distributed with the application and stored in
the standard EMBOSS data directory, which is defined by the EMBOSS
environment variable EMBOSS_DATA.
To see the available EMBOSS data files, run:
% embossdata -showall
To fetch one of the data files (for example 'Exxx.dat') into your
current directory for you to inspect or modify, run:
% embossdata -fetch -file Exxx.dat
Users can provide their own data files in their own directories.
Project specific files can be put in the current directory, or for
tidier directory listings in a subdirectory called ".embossdata".
Files for all EMBOSS runs can be put in the user's home directory, or
again in a subdirectory called ".embossdata".
The directories are searched in the following order:
* . (your current directory)
* .embossdata (under your current directory)
* ~/ (your home directory)
* ~/.embossdata
The EMBOSS REBASE restriction enzyme data files are stored iin
directory 'data/REBASE/*' under the EMBOSS installation directory.
These files must first be set up using the program 'rebaseextract'.
Running 'rebaseextract' may be the job of your system manager.
The data files are stored in the REBASE directory of the standard
EMBOSS data directory. The names are:
* embossre.enz Cleavage information
* embossre.ref Reference/methylation information
* embossre.sup Supplier information
The column information is described at the top of the data files
The reported enzyme from any one group of isoschizomers (the
prototype) is specified in the REBASE database and the information is
held in the data file 'embossre.equ'. You may edit this file to set
your own preferred prototype, if you wish.
The format of the file "embossre.equ" is
Enzyme-name Prototype-name
i.e. two columns of enzyme names separated by a space. The first name
of the pair of enzymes is the name that is not preferred and the
second is the preferred (prototype) name.
Notes
Output file size is related to the size of the recognition site and
the maximum number of allowed cutting positions. Setting the site
length to six and restricting the cuts to two is a common choice of
parameters. The size of the output can sometimes be reduced by
specifying the -noambiguity switch.
The data files must have been created before running this program.
This is done by running the rebaseextract program with the "withrefm"
and "prot" files from an REBASE release. You may have to ask your
system manager to do this.
References
1. Nucleic Acids Research 27: 312-313 (1999).
Warnings
The program will warn you if a protein sequence is given.
Diagnostic Error Messages
None.
Exit status
It exits with status 0 unless an error is reported.
Known bugs
None.
See also
Program name Description
recoder Remove restriction sites but maintain same translation
redata Search REBASE for enzyme name, references, suppliers etc
remap Display sequence with restriction sites, translation etc
restover Find restriction enzymes producing specific overhang
showseq Display a sequence with features, translation etc
silent Silent mutation restriction enzyme scan
Author(s)
Alan Bleasby (ajb ebi.ac.uk)
European Bioinformatics Institute, Wellcome Trust Genome Campus,
Hinxton, Cambridge CB10 1SD, UK
History
Completed 16th April 1999
Target users
This program is intended to be used by everyone and everything, from
naive users to embedded scripts.
Comments
None
|