1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740
|
<HTML>
<HEAD>
<TITLE>
EMBOSS: cai
</TITLE>
</HEAD>
<BODY BGCOLOR="#FFFFFF" text="#000000">
<table align=center border=0 cellspacing=0 cellpadding=0>
<tr><td valign=top>
<A HREF="/" ONMOUSEOVER="self.status='Go to the EMBOSS home page';return true"><img border=0 src="/images/emboss_icon.jpg" alt="" width=150 height=48></a>
</td>
<td align=left valign=middle>
<b><font size="+6">
cai
</font></b>
</td></tr>
</table>
<br>
<p>
<H2>
Wiki
</H2>
The master copies of EMBOSS documentation are available
at <a href="http://emboss.open-bio.org/wiki/Appdocs">
http://emboss.open-bio.org/wiki/Appdocs</a>
on the EMBOSS Wiki.
<p>
Please help by correcting and extending the Wiki pages.
<H2>
Function
</H2>
Calculate codon adaptation index
<H2>
Description
</H2>
<p><b>cai</b> calculates the Codon Adaptation Index for a given nucleotide sequence, given a reference codon usage table. The CAI index is a simple, effective measure of synonymous codon usage bias. It index assesses the extent to which selection has been effective in moulding the pattern of codon usage. In that respect it is useful for predicting the level of expression of a gene, for assessing the adaptation of viral genes to their hosts, and for making comparisons of codon usage in different organisms. The index may also give an approximate indication of the likely success of heterologous gene expression.
</p>
<H2>
Algorithm
</H2>
<p>The CAI index uses a reference set of highly expressed genes from a species to assess the relative merits of each codon. A score for a gene sequence is calculated from the frequency of use of all codons in that gene sequence.</p>
<H2>
Usage
</H2>
Here is a sample session with <b>cai</b>
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>cai TEMBL:AB009602 </b>
Calculate codon adaptation index
Codon usage file [Eyeast_cai.cut]: <b></b>
Output file [ab009602.cai]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#input.1">Go to the input files for this example</a><br><a href="#output.1">Go to the output files for this example</a><p><p>
<H2>
Command line arguments
</H2>
<table CELLSPACING=0 CELLPADDING=3 BGCOLOR="#f5f5ff" ><tr><td>
<pre>
Calculate codon adaptation index
Version: EMBOSS:6.6.0.0
Standard (Mandatory) qualifiers:
[-seqall] seqall Nucleotide sequence(s) filename and optional
format, or reference (input USA)
-cfile codon [Eyeast_cai.cut] Codon usage table name
[-outfile] outfile [*.cai] Output file name
Additional (Optional) qualifiers: (none)
Advanced (Unprompted) qualifiers: (none)
Associated qualifiers:
"-seqall" associated qualifiers
-sbegin1 integer Start of each sequence to be used
-send1 integer End of each sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-scircular1 boolean Sequence is circular
-squick1 boolean Read id and sequence only
-sformat1 string Input sequence format
-iquery1 string Input query fields or ID list
-ioffset1 integer Input start position offset
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-cfile" associated qualifiers
-format string Data format
"-outfile" associated qualifiers
-odirectory2 string Output directory
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write first file to standard output
-filter boolean Read first file from standard input, write
first file to standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options and exit. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
-version boolean Report version number and exit
</pre>
</td></tr></table>
<P>
<table border cellspacing=0 cellpadding=3 bgcolor="#ccccff">
<tr bgcolor="#FFFFCC">
<th align="left">Qualifier</th>
<th align="left">Type</th>
<th align="left">Description</th>
<th align="left">Allowed values</th>
<th align="left">Default</th>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>Standard (Mandatory) qualifiers</th>
</tr>
<tr bgcolor="#FFFFCC">
<td>[-seqall]<br>(Parameter 1)</td>
<td>seqall</td>
<td>Nucleotide sequence(s) filename and optional format, or reference (input USA)</td>
<td>Readable sequence(s)</td>
<td><b>Required</b></td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-cfile</td>
<td>codon</td>
<td>Codon usage table name</td>
<td>Codon usage file in EMBOSS data path</td>
<td>Eyeast_cai.cut</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>[-outfile]<br>(Parameter 2)</td>
<td>outfile</td>
<td>Output file name</td>
<td>Output file</td>
<td><i><*></i>.cai</td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>Additional (Optional) qualifiers</th>
</tr>
<tr>
<td colspan=5>(none)</td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>Advanced (Unprompted) qualifiers</th>
</tr>
<tr>
<td colspan=5>(none)</td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>Associated qualifiers</th>
</tr>
<tr bgcolor="#FFFFCC">
<td align="left" colspan=5>"-seqall" associated seqall qualifiers
</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sbegin1<br>-sbegin_seqall</td>
<td>integer</td>
<td>Start of each sequence to be used</td>
<td>Any integer value</td>
<td>0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -send1<br>-send_seqall</td>
<td>integer</td>
<td>End of each sequence to be used</td>
<td>Any integer value</td>
<td>0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sreverse1<br>-sreverse_seqall</td>
<td>boolean</td>
<td>Reverse (if DNA)</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sask1<br>-sask_seqall</td>
<td>boolean</td>
<td>Ask for begin/end/reverse</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -snucleotide1<br>-snucleotide_seqall</td>
<td>boolean</td>
<td>Sequence is nucleotide</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sprotein1<br>-sprotein_seqall</td>
<td>boolean</td>
<td>Sequence is protein</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -slower1<br>-slower_seqall</td>
<td>boolean</td>
<td>Make lower case</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -supper1<br>-supper_seqall</td>
<td>boolean</td>
<td>Make upper case</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -scircular1<br>-scircular_seqall</td>
<td>boolean</td>
<td>Sequence is circular</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -squick1<br>-squick_seqall</td>
<td>boolean</td>
<td>Read id and sequence only</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sformat1<br>-sformat_seqall</td>
<td>string</td>
<td>Input sequence format</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -iquery1<br>-iquery_seqall</td>
<td>string</td>
<td>Input query fields or ID list</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -ioffset1<br>-ioffset_seqall</td>
<td>integer</td>
<td>Input start position offset</td>
<td>Any integer value</td>
<td>0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sdbname1<br>-sdbname_seqall</td>
<td>string</td>
<td>Database name</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sid1<br>-sid_seqall</td>
<td>string</td>
<td>Entryname</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -ufo1<br>-ufo_seqall</td>
<td>string</td>
<td>UFO features</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -fformat1<br>-fformat_seqall</td>
<td>string</td>
<td>Features format</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -fopenfile1<br>-fopenfile_seqall</td>
<td>string</td>
<td>Features file name</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td align="left" colspan=5>"-cfile" associated codon qualifiers
</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -format</td>
<td>string</td>
<td>Data format</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td align="left" colspan=5>"-outfile" associated outfile qualifiers
</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -odirectory2<br>-odirectory_outfile</td>
<td>string</td>
<td>Output directory</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>General qualifiers</th>
</tr>
<tr bgcolor="#FFFFCC">
<td> -auto</td>
<td>boolean</td>
<td>Turn off prompts</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -stdout</td>
<td>boolean</td>
<td>Write first file to standard output</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -filter</td>
<td>boolean</td>
<td>Read first file from standard input, write first file to standard output</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -options</td>
<td>boolean</td>
<td>Prompt for standard and additional values</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -debug</td>
<td>boolean</td>
<td>Write debug output to program.dbg</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -verbose</td>
<td>boolean</td>
<td>Report some/full command line options</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -help</td>
<td>boolean</td>
<td>Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -warning</td>
<td>boolean</td>
<td>Report warnings</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -error</td>
<td>boolean</td>
<td>Report errors</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -fatal</td>
<td>boolean</td>
<td>Report fatal errors</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -die</td>
<td>boolean</td>
<td>Report dying program messages</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -version</td>
<td>boolean</td>
<td>Report version number and exit</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
</table>
<H2>
Input file format
</H2>
<b>cai</b> reads a nucleic acid sequence of a gene.
<p>
<a name="input.1"></a>
<h3>Input files for usage example </h3>
<p><h3>Database entry: TEMBL:AB009602</h3>
<table width="90%"><tr><td bgcolor="#FFCCFF">
<pre>
ID AB009602; SV 1; linear; mRNA; STD; FUN; 561 BP.
XX
AC AB009602;
XX
DT 15-DEC-1997 (Rel. 53, Created)
DT 14-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE Schizosaccharomyces pombe mRNA for MET1 homolog, partial cds.
XX
KW MET1 homolog.
XX
OS Schizosaccharomyces pombe (fission yeast)
OC Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina;
OC Schizosaccharomycetes; Schizosaccharomycetales; Schizosaccharomycetaceae;
OC Schizosaccharomyces.
XX
RN [1]
RP 1-561
RA Kawamukai M.;
RT ;
RL Submitted (07-DEC-1997) to the INSDC.
RL Makoto Kawamukai, Shimane University, Life and Environmental Science; 1060
RL Nishikawatsu, Matsue, Shimane 690, Japan
RL (E-mail:kawamuka@life.shimane-u.ac.jp, Tel:0852-32-6587, Fax:0852-32-6499)
XX
RN [2]
RP 1-561
RA Kawamukai M.;
RT "S.pmbe MET1 homolog";
RL Unpublished.
XX
DR EnsemblGenomes; SPCC1739.06c; Schizosaccharomyces_pombe.
DR EnsemblGenomes; SPCC1739.06c.1; Schizosaccharomyces_pombe.
DR PomBase; SPCC1739.06c.
DR PomBase; SPCC1739.06c.1.
XX
FH Key Location/Qualifiers
FH
FT source 1..561
FT /organism="Schizosaccharomyces pombe"
FT /mol_type="mRNA"
FT /clone_lib="pGAD GH"
FT /db_xref="taxon:4896"
FT CDS <1..275
FT /codon_start=3
FT /transl_table=1
FT /product="MET1 homolog"
FT /db_xref="GOA:O74468"
FT /db_xref="InterPro:IPR000878"
FT /db_xref="InterPro:IPR003043"
FT /db_xref="InterPro:IPR006366"
FT /db_xref="InterPro:IPR012066"
FT /db_xref="InterPro:IPR014776"
FT /db_xref="InterPro:IPR014777"
FT /db_xref="InterPro:IPR016040"
FT /db_xref="UniProtKB/Swiss-Prot:O74468"
FT /protein_id="BAA23999.1"
FT /translation="SMPKIPSFVPTQTTVFLMALHRLEILVQALIESGWPRVLPVCIAE
FT RVSCPDQRFIFSTLEDVVEEYNKYESLPPGLLITGYSCNTLRNTA"
XX
SQ Sequence 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
gttcgatgcc taaaatacct tcttttgtcc ctacacagac cacagttttc ctaatggctt 60
tacaccgact agaaattctt gtgcaagcac taattgaaag cggttggcct agagtgttac 120
cggtttgtat agctgagcgc gtctcttgcc ctgatcaaag gttcattttc tctactttgg 180
aagacgttgt ggaagaatac aacaagtacg agtctctccc ccctggtttg ctgattactg 240
gatacagttg taataccctt cgcaacaccg cgtaactatc tatatgaatt attttccctt 300
tattatatgt agtaggttcg tctttaatct tcctttagca agtcttttac tgttttcgac 360
ctcaatgttc atgttcttag gttgttttgg ataatatgcg gtcagtttaa tcttcgttgt 420
ttcttcttaa aatatttatt catggtttaa tttttggttt gtacttgttc aggggccagt 480
tcattattta ctctgtttgt atacagcagt tcttttattt ttagtatgat tttaatttaa 540
aacaattcta atggtcaaaa a 561
//
</pre>
</td></tr></table><p>
<H2>
Output file format
</H2>
<b>cai</b> writes the Codon Adaptation Index to the output file.
<p>
<a name="output.1"></a>
<h3>Output files for usage example </h3>
<p><h3>File: ab009602.cai</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
Sequence: AB009602 CAI: 0.188
</pre>
</td></tr></table><p>
<H2>
Data files
</H2>
<p><b>cai</b> requires a reference codon usage table prepared from a set of genes which are known to be highly expressed. This is specified by the <tt>-cfile</tt> option and must exist in the EMBOSS data directory. The default codon usage table <tt>Eyeastcai.cut</tt> is the standard set of Saccharomyces cerevisiae highly expressed gene codon frequiencies. Another table (<tt>Eschpo_cai.cut</tt>) was prepared from a set of Schizosaccharomyces pombe genes by Peter Rice for the S. pombe sequencing team at the Sanger Centre, and is available in the EMBOSS data directory. You should prepare your own codon usage table for your organism of interest.</p>
<p>
<p>
EMBOSS data files are distributed with the application and stored
in the standard EMBOSS data directory, which is defined
by the EMBOSS environment variable EMBOSS_DATA.
<p>
To see the available EMBOSS data files, run:
<p>
<pre>
% embossdata -showall
</pre>
<p>
To fetch one of the data files (for example 'Exxx.dat') into your
current directory for you to inspect or modify, run:
<pre>
% embossdata -fetch -file Exxx.dat
</pre>
<p>
Users can provide their own data files in their own directories.
Project specific files can be put in the current directory, or for
tidier directory listings in a subdirectory called
".embossdata". Files for all EMBOSS runs can be put in the user's home
directory, or again in a subdirectory called ".embossdata".
<p>
The directories are searched in the following order:
<ul>
<li> . (your current directory)
<li> .embossdata (under your current directory)
<li> ~/ (your home directory)
<li> ~/.embossdata
</ul>
<p>
<H2>
Notes
</H2>
<p>Codons are nucleotide triplet that encode an amino acid residue in a polypeptide chain. There are four possible nucleotides in DNA; adenine (<tt>A</tt>), guanine (<tt>G</tt>), cytosine (<tt>C</tt>) and thymine (<tt>T</tt>), therefore 64 possible triplets to encode the 20 amino acids plus the translation termination signal. The encoding is therefore redundant, with all but two amino acids coded for by more than one triplet. Organisms often have a particular preference for one of the possible codons for a given amino acid.</p>
<p>Codon preferences reflect a balance between mutational bias and selection for efficiency of translation. In fast-growing microorganisms there are optimal codons that reflect the composition of the genomic tRNA pool and probably help achieve faster translation rates and high accuracy. Such selection is expected to be strong in highly expressed genes, as is the case for Escherichia coli or Saccharomyces cerevisiae. In contrast, codon usage optimization is normally absent in organisms with slower growing rates such as Homo sapiens (human), where codon preferences are determined by mutational biases characteristic to a particular genome.</p>
<p>Various factors are thought to influence codon usage bias in baceteria, including gene expression level already mentioned, %G+C composition (reflecting horizontal gene transfer or mutational bias), GC skew (reflecting strand-specific mutational bias), amino acid conservation, protein hydropathy, transcriptional selection, RNA stability, and optimal growth temperature.</p>
<p>Various methods have been used to analyze codon usage bias. CAI and methods such as the 'frequency of optimal codons' (Fop) are commonly used to predict gene expression levels. Others such as the 'effective number of codons' (Nc) and Shannon entropy are used to measure codon usage evenness, whereas multivariate statistical methods, iincluding correspondence analysis and principal component analysis, may be used to analyze variations in codon usage between genes.</p>
<H2>
References
</H2>
<ol>
<li>
Sharp PM., Li W-H. "The codon adaptation index - a measure of
directional synonymous codon usage bias, and its potential
applications." Nucleic Acids Research 1987 vol 15, pp 1281-1295.
<li>
Synonymous codon usage in bacteria.
Curr Issues Mol Biol. 2001 Oct;3(4):91-7.
</ol>
<H2>
Warnings
</H2>
None.
<H2>
Diagnostic Error Messages
</H2>
None.
<H2>
Exit status
</H2>
It always exits with status 0.
<H2>
Known bugs
</H2>
None.
<h2><a name="See also">See also</a></h2>
<table border cellpadding=4 bgcolor="#FFFFF0">
<tr><th>Program name</th>
<th>Description</th></tr>
<tr>
<td><a href="chips.html">chips</a></td>
<td>Calculate Nc codon usage statistic</td>
</tr>
<tr>
<td><a href="codcmp.html">codcmp</a></td>
<td>Codon usage table comparison</td>
</tr>
<tr>
<td><a href="codcopy.html">codcopy</a></td>
<td>Copy and reformat a codon usage table</td>
</tr>
<tr>
<td><a href="cusp.html">cusp</a></td>
<td>Create a codon usage table from nucleotide sequence(s)</td>
</tr>
<tr>
<td><a href="syco.html">syco</a></td>
<td>Draw synonymous codon usage statistic plot for a nucleotide sequence</td>
</tr>
</table>
<H2>
Author(s)
</H2>
Alan Bleasby
<br>
European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK
<p>
Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.
<H2>
History
</H2>
Written (March 2001) - Alan Bleasby.
<H2>
Target users
</H2>
This program is intended to be used by everyone and everything, from naive users to embedded scripts.
<H2>
Comments
</H2>
None
</BODY>
</HTML>
|