1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547
|
<HTML>
<HEAD>
<TITLE>
EMBOSS: infoalign
</TITLE>
</HEAD>
<BODY BGCOLOR="#FFFFFF" text="#000000">
<table align=center border=0 cellspacing=0 cellpadding=0>
<tr><td valign=top>
<A HREF="/" ONMOUSEOVER="self.status='Go to the EMBOSS home page';return true"><img border=0 src="/images/emboss_icon.jpg" alt="" width=150 height=48></a>
</td>
<td align=left valign=middle>
<b><font size="+6">
infoalign
</font></b>
</td></tr>
</table>
<br>
<p>
<H2>
Wiki
</H2>
The master copies of EMBOSS documentation are available
at <a href="http://emboss.open-bio.org/wiki/Appdocs">
http://emboss.open-bio.org/wiki/Appdocs</a>
on the EMBOSS Wiki.
<p>
Please help by correcting and extending the Wiki pages.
<H2>
Function
</H2>
Display basic information about a multiple sequence alignment
<H2>
Description
</H2>
<p><b>infoalign</b> displays on screen basic information about sequences in an input multiple sequence alignment. This includes the sequences' USA, name, two measures of length, counts of gaps, and numbers of identical, similar and different residues or bases in this sequence when compared to a reference sequence, together with a simple statistic of the % change between the reference sequence and this sequence. Any combination of these records is easily selected or unselected for display. The same information may be written to an output file which (optionally) may be formatted in an HTML table.</p>
<p>The reference sequence is the one against which all the other sequences are compared using a specified substitution matrix. It is either the calculated consensus sequence of the alignment (the default) or it can be one of the set of aligned sequences, specified by either the ordinal number of that sequence in the input file, or by name. There are various options to control how the consensus is calculated.</p>
<H2>
Algorithm
</H2>
The set of aligned sequences is read in.
<p>
If the reference sequence is the consensus sequence (this is the
default) then this is calculated. If the reference sequence is
specified as an ordinal number, then the sequences are counted (from 1)
until the reference sequence is identified. If the reference sequence
is specified by its name then the names of the sequences are compared to
the specified name until the reference sequence is identified.
<p>
<pre>
Foreach sequence:
<p>
Find the position of the first residue or base which is not a gap character.
<br>
Find the position of the last residue or base which is not a gap character.
<p>
Foreach position from the first non-gap character to the last non-gap
character:
<p>
if the position is a gap character, then
<br>
increment the 'GapLen' count
<br>
if this character is the start of a new gap, increment the 'Gaps' count
<br>
else
<br>
the character at this position of the sequence and in the
reference sequence are now compared.
<br>
if the sequence character and the reference character are identical
(apart from case) then
<br>
increment the 'Ident' count
<br>
else if the similarity matrix score for the two characters is > 0
(i.e. if they are similar) then
<br>
increment the 'Similar' count
<br>
else
<br>
increment the 'Different' count
<p>
The 'SeqLen' length of the sequence is the number of non-gap characters
in the sequence (i.e. 'Ident' + 'Similar' + 'Different')
<p>
The 'AlignLen' length of the sequence is the length from the first
non-gap character to the last non-gap character. (i.e. the number of
bases or residues of the sequence plus the number of gap characters
internal to the sequence.)
<p>
The '%Change' value for the sequence is calculated as:
<br>
('AlignLen' - 'Ident') * 100 / 'AlignLen'
</pre>
<H2>
Usage
</H2>
Here is a sample session with <b>infoalign</b>
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign globins.msf </b>
Display basic information about a multiple sequence alignment
Output file [globins.infoalign]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#input.1">Go to the input files for this example</a><br><a href="#output.1">Go to the output files for this example</a><p><p>
<p>
<b>Example 2</b>
<p>
This example doesn't display the USA of the sequence:
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign globins.msf -nousa </b>
Display basic information about a multiple sequence alignment
Output file [globins.infoalign]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#output.2">Go to the output files for this example</a><p><p>
<p>
<b>Example 3</b>
<p>
Display only the name and sequence length of a sequence:
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign globins.msf -only -name -seqlength </b>
Display basic information about a multiple sequence alignment
Output file [globins.infoalign]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#output.3">Go to the output files for this example</a><p><p>
<p>
<b>Example 4</b>
<p>
Display only the name, number of gap characters and differences to the consensus sequence:
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign globins.msf -only -name -gapcount -diffcount </b>
Display basic information about a multiple sequence alignment
Output file [globins.infoalign]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#output.4">Go to the output files for this example</a><p><p>
<p>
<b>Example 5</b>
<p>
Display the name and number of gaps within a sequence:
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign globins.msf -only -name -gaps </b>
Display basic information about a multiple sequence alignment
Output file [globins.infoalign]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#output.5">Go to the output files for this example</a><p><p>
<p>
<b>Example 6</b>
<p>
Display information formatted with HTML:
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign globins.msf -html </b>
Display basic information about a multiple sequence alignment
Output file [globins.infoalign]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#output.6">Go to the output files for this example</a><p><p>
<p>
<b>Example 7</b>
<p>
Use the first sequence as the reference sequence to compare to:
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign globins.msf -refseq 1 </b>
Display basic information about a multiple sequence alignment
Output file [globins.infoalign]: <b></b>
</pre></td></tr></table><p>
<p>
<a href="#output.7">Go to the output files for this example</a><p><p>
<p>
<b>Example 8</b>
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign -auto @eclac.list -out test.out </b>
</pre></td></tr></table><p>
<p>
<a href="#input.8">Go to the input files for this example</a><br><a href="#output.8">Go to the output files for this example</a><p><p>
<p>
<b>Example 9</b>
<p>
<p>
<table width="90%"><tr><td bgcolor="#CCFFFF"><pre>
% <b>infoalign -auto tembl:v00296 -out test.out </b>
</pre></td></tr></table><p>
<p>
<a href="#input.9">Go to the input files for this example</a><br><a href="#output.9">Go to the output files for this example</a><p><p>
<H2>
Command line arguments
</H2>
<table CELLSPACING=0 CELLPADDING=3 BGCOLOR="#f5f5ff" ><tr><td>
<pre>
Display basic information about a multiple sequence alignment
Version: EMBOSS:6.6.0.0
Standard (Mandatory) qualifiers:
[-sequence] seqset The sequence alignment to be displayed.
[-outfile] outfile [*.infoalign] If you enter the name of a
file here then this program will write the
sequence details into that file.
Additional (Optional) qualifiers:
-matrix matrix [EBLOSUM62 for protein, EDNAFULL for DNA]
This is the scoring matrix file used when
comparing sequences. By default it is the
file 'EBLOSUM62' (for proteins) or the file
'EDNAFULL' (for nucleic sequences). These
files are found in the 'data' directory of
the EMBOSS installation.
-refseq string [0] If you give the number in the alignment
or the name of a sequence, it will be taken
to be the reference sequence. The reference
sequence is the one against which all the
other sequences are compared. If this is set
to 0 then the consensus sequence will be
used as the reference sequence. By default
the consensus sequence is used as the
reference sequence. (Any string)
-html boolean [N] Format output as an HTML table
Advanced (Unprompted) qualifiers:
-plurality float [50.0] Set a cut-off for the % of positive
scoring matches below which there is no
consensus. The default plurality is taken as
50% of the total weight of all the
sequences in the alignment. (Number from
0.000 to 100.000)
-identity float [0.0] Provides the facility of setting the
required number of identities at a position
for it to give a consensus. Therefore, if
this is set to 100% only columns of
identities contribute to the consensus.
(Number from 0.000 to 100.000)
-only boolean [N] This is a way of shortening the command
line if you only want a few things to be
displayed. Instead of specifying:
'-nohead -nousa -noname -noalign -nogaps
-nogapcount -nosimcount -noidcount
-nodiffcount -noweight'
to get only the sequence length output, you
can specify
'-only -seqlength'
-heading boolean [@(!$(only))] Display column headings
-usa boolean [@(!$(only))] Display the USA of the
sequence
-name boolean [@(!$(only))] Display 'name' column
-seqlength boolean [@(!$(only))] Display 'seqlength' column
-alignlength boolean [@(!$(only))] Display 'alignlength' column
-gaps boolean [@(!$(only))] Display number of gaps
-gapcount boolean [@(!$(only))] Display number of gap
positions
-idcount boolean [@(!$(only))] Display number of identical
positions
-simcount boolean [@(!$(only))] Display number of similar
positions
-diffcount boolean [@(!$(only))] Display number of different
positions
-change boolean [@(!$(only))] Display % number of changed
positions
-weight boolean [@(!$(only))] Display 'weight' column
-description boolean [@(!$(only))] Display 'description' column
Associated qualifiers:
"-sequence" associated qualifiers
-sbegin1 integer Start of each sequence to be used
-send1 integer End of each sequence to be used
-sreverse1 boolean Reverse (if DNA)
-sask1 boolean Ask for begin/end/reverse
-snucleotide1 boolean Sequence is nucleotide
-sprotein1 boolean Sequence is protein
-slower1 boolean Make lower case
-supper1 boolean Make upper case
-scircular1 boolean Sequence is circular
-squick1 boolean Read id and sequence only
-sformat1 string Input sequence format
-iquery1 string Input query fields or ID list
-ioffset1 integer Input start position offset
-sdbname1 string Database name
-sid1 string Entryname
-ufo1 string UFO features
-fformat1 string Features format
-fopenfile1 string Features file name
"-outfile" associated qualifiers
-odirectory2 string Output directory
General qualifiers:
-auto boolean Turn off prompts
-stdout boolean Write first file to standard output
-filter boolean Read first file from standard input, write
first file to standard output
-options boolean Prompt for standard and additional values
-debug boolean Write debug output to program.dbg
-verbose boolean Report some/full command line options
-help boolean Report command line options and exit. More
information on associated and general
qualifiers can be found with -help -verbose
-warning boolean Report warnings
-error boolean Report errors
-fatal boolean Report fatal errors
-die boolean Report dying program messages
-version boolean Report version number and exit
</pre>
</td></tr></table>
<P>
<table border cellspacing=0 cellpadding=3 bgcolor="#ccccff">
<tr bgcolor="#FFFFCC">
<th align="left">Qualifier</th>
<th align="left">Type</th>
<th align="left">Description</th>
<th align="left">Allowed values</th>
<th align="left">Default</th>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>Standard (Mandatory) qualifiers</th>
</tr>
<tr bgcolor="#FFFFCC">
<td>[-sequence]<br>(Parameter 1)</td>
<td>seqset</td>
<td>The sequence alignment to be displayed.</td>
<td>Readable set of sequences</td>
<td><b>Required</b></td>
</tr>
<tr bgcolor="#FFFFCC">
<td>[-outfile]<br>(Parameter 2)</td>
<td>outfile</td>
<td>If you enter the name of a file here then this program will write the sequence details into that file.</td>
<td>Output file</td>
<td><i><*></i>.infoalign</td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>Additional (Optional) qualifiers</th>
</tr>
<tr bgcolor="#FFFFCC">
<td>-matrix</td>
<td>matrix</td>
<td>This is the scoring matrix file used when comparing sequences. By default it is the file 'EBLOSUM62' (for proteins) or the file 'EDNAFULL' (for nucleic sequences). These files are found in the 'data' directory of the EMBOSS installation.</td>
<td>Comparison matrix file in EMBOSS data path</td>
<td>EBLOSUM62 for protein<br>EDNAFULL for DNA</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-refseq</td>
<td>string</td>
<td>If you give the number in the alignment or the name of a sequence, it will be taken to be the reference sequence. The reference sequence is the one against which all the other sequences are compared. If this is set to 0 then the consensus sequence will be used as the reference sequence. By default the consensus sequence is used as the reference sequence.</td>
<td>Any string</td>
<td>0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-html</td>
<td>boolean</td>
<td>Format output as an HTML table</td>
<td>Boolean value Yes/No</td>
<td>No</td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>Advanced (Unprompted) qualifiers</th>
</tr>
<tr bgcolor="#FFFFCC">
<td>-plurality</td>
<td>float</td>
<td>Set a cut-off for the % of positive scoring matches below which there is no consensus. The default plurality is taken as 50% of the total weight of all the sequences in the alignment.</td>
<td>Number from 0.000 to 100.000</td>
<td>50.0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-identity</td>
<td>float</td>
<td>Provides the facility of setting the required number of identities at a position for it to give a consensus. Therefore, if this is set to 100% only columns of identities contribute to the consensus.</td>
<td>Number from 0.000 to 100.000</td>
<td>0.0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-only</td>
<td>boolean</td>
<td>This is a way of shortening the command line if you only want a few things to be displayed. Instead of specifying:
'-nohead -nousa -noname -noalign -nogaps -nogapcount -nosimcount -noidcount -nodiffcount -noweight'
to get only the sequence length output, you can specify
'-only -seqlength'</td>
<td>Boolean value Yes/No</td>
<td>No</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-heading</td>
<td>boolean</td>
<td>Display column headings</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-usa</td>
<td>boolean</td>
<td>Display the USA of the sequence</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-name</td>
<td>boolean</td>
<td>Display 'name' column</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-seqlength</td>
<td>boolean</td>
<td>Display 'seqlength' column</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-alignlength</td>
<td>boolean</td>
<td>Display 'alignlength' column</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-gaps</td>
<td>boolean</td>
<td>Display number of gaps</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-gapcount</td>
<td>boolean</td>
<td>Display number of gap positions</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-idcount</td>
<td>boolean</td>
<td>Display number of identical positions</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-simcount</td>
<td>boolean</td>
<td>Display number of similar positions</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-diffcount</td>
<td>boolean</td>
<td>Display number of different positions</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-change</td>
<td>boolean</td>
<td>Display % number of changed positions</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-weight</td>
<td>boolean</td>
<td>Display 'weight' column</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<td>-description</td>
<td>boolean</td>
<td>Display 'description' column</td>
<td>Boolean value Yes/No</td>
<td>@(!$(only))</td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>Associated qualifiers</th>
</tr>
<tr bgcolor="#FFFFCC">
<td align="left" colspan=5>"-sequence" associated seqset qualifiers
</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sbegin1<br>-sbegin_sequence</td>
<td>integer</td>
<td>Start of each sequence to be used</td>
<td>Any integer value</td>
<td>0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -send1<br>-send_sequence</td>
<td>integer</td>
<td>End of each sequence to be used</td>
<td>Any integer value</td>
<td>0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sreverse1<br>-sreverse_sequence</td>
<td>boolean</td>
<td>Reverse (if DNA)</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sask1<br>-sask_sequence</td>
<td>boolean</td>
<td>Ask for begin/end/reverse</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -snucleotide1<br>-snucleotide_sequence</td>
<td>boolean</td>
<td>Sequence is nucleotide</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sprotein1<br>-sprotein_sequence</td>
<td>boolean</td>
<td>Sequence is protein</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -slower1<br>-slower_sequence</td>
<td>boolean</td>
<td>Make lower case</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -supper1<br>-supper_sequence</td>
<td>boolean</td>
<td>Make upper case</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -scircular1<br>-scircular_sequence</td>
<td>boolean</td>
<td>Sequence is circular</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -squick1<br>-squick_sequence</td>
<td>boolean</td>
<td>Read id and sequence only</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sformat1<br>-sformat_sequence</td>
<td>string</td>
<td>Input sequence format</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -iquery1<br>-iquery_sequence</td>
<td>string</td>
<td>Input query fields or ID list</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -ioffset1<br>-ioffset_sequence</td>
<td>integer</td>
<td>Input start position offset</td>
<td>Any integer value</td>
<td>0</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sdbname1<br>-sdbname_sequence</td>
<td>string</td>
<td>Database name</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -sid1<br>-sid_sequence</td>
<td>string</td>
<td>Entryname</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -ufo1<br>-ufo_sequence</td>
<td>string</td>
<td>UFO features</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -fformat1<br>-fformat_sequence</td>
<td>string</td>
<td>Features format</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -fopenfile1<br>-fopenfile_sequence</td>
<td>string</td>
<td>Features file name</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<td align="left" colspan=5>"-outfile" associated outfile qualifiers
</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -odirectory2<br>-odirectory_outfile</td>
<td>string</td>
<td>Output directory</td>
<td>Any string</td>
<td> </td>
</tr>
<tr bgcolor="#FFFFCC">
<th align="left" colspan=5>General qualifiers</th>
</tr>
<tr bgcolor="#FFFFCC">
<td> -auto</td>
<td>boolean</td>
<td>Turn off prompts</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -stdout</td>
<td>boolean</td>
<td>Write first file to standard output</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -filter</td>
<td>boolean</td>
<td>Read first file from standard input, write first file to standard output</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -options</td>
<td>boolean</td>
<td>Prompt for standard and additional values</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -debug</td>
<td>boolean</td>
<td>Write debug output to program.dbg</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -verbose</td>
<td>boolean</td>
<td>Report some/full command line options</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -help</td>
<td>boolean</td>
<td>Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -warning</td>
<td>boolean</td>
<td>Report warnings</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -error</td>
<td>boolean</td>
<td>Report errors</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -fatal</td>
<td>boolean</td>
<td>Report fatal errors</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -die</td>
<td>boolean</td>
<td>Report dying program messages</td>
<td>Boolean value Yes/No</td>
<td>Y</td>
</tr>
<tr bgcolor="#FFFFCC">
<td> -version</td>
<td>boolean</td>
<td>Report version number and exit</td>
<td>Boolean value Yes/No</td>
<td>N</td>
</tr>
</table>
<H2>
Input file format
</H2>
<b>infoalign</b> reads a normal multiple sequence alignment file, as
produced by a alignment program.
<p>
<a name="input.1"></a>
<h3>Input files for usage example </h3>
<p><h3>File: globins.msf</h3>
<table width="90%"><tr><td bgcolor="#FFCCFF">
<pre>
!!AA_MULTIPLE_ALIGNMENT 1.0
../data/globins.msf MSF: 164 Type: P 25/06/01 CompCheck: 4278 ..
Name: HBB_HUMAN Len: 164 Check: 6914 Weight: 0.61
Name: HBB_HORSE Len: 164 Check: 6007 Weight: 0.65
Name: HBA_HUMAN Len: 164 Check: 3921 Weight: 0.65
Name: HBA_HORSE Len: 164 Check: 4770 Weight: 0.83
Name: MYG_PHYCA Len: 164 Check: 7930 Weight: 1.00
Name: GLB5_PETMA Len: 164 Check: 1857 Weight: 0.91
Name: LGB2_LUPLU Len: 164 Check: 2879 Weight: 0.43
//
1 50
HBB_HUMAN ~~~~~~~~VHLTPEEKSAVTALWGKVN.VDEVGGEALGR.LLVVYPWTQR
HBB_HORSE ~~~~~~~~VQLSGEEKAAVLALWDKVN.EEEVGGEALGR.LLVVYPWTQR
HBA_HUMAN ~~~~~~~~~~~~~~VLSPADKTNVKAA.WGKVGAHAGEYGAEALERMFLS
HBA_HORSE ~~~~~~~~~~~~~~VLSAADKTNVKAA.WSKVGGHAGEYGAEALERMFLG
MYG_PHYCA ~~~~~~~VLSEGEWQLVLHVWAKVEAD.VAGHGQDILIR.LFKSHPETLE
GLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQE
LGB2_LUPLU ~~~~~~~~GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD
51 100
HBB_HUMAN FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSE
HBB_HORSE FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSE
HBA_HUMAN FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD
HBA_HORSE FPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSD
MYG_PHYCA KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQ
GLB5_PETMA FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRD
LGB2_LUPLU LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN
101 150
HBB_HUMAN LHCDKLH..VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVA
HBB_HORSE LHCDKLH..VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVA
HBA_HUMAN LHAHKLR..VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVS
HBA_HORSE LHAHKLR..VDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVS
MYG_PHYCA SHATKHK..IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFR
GLB5_PETMA LSGKHAK..SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSA
LGB2_LUPLU LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA
151 164
HBB_HUMAN NALAHKYH~~~~~~
HBB_HORSE NALAHKYH~~~~~~
HBA_HUMAN TVLTSKYR~~~~~~
HBA_HORSE TVLTSKYR~~~~~~
MYG_PHYCA KDIAAKYKELGYQG
GLB5_PETMA Y~~~~~~~~~~~~~
LGB2_LUPLU IVIKKEMNDAA~~~
</pre>
</td></tr></table><p>
<a name="input.8"></a>
<h3>Input files for usage example 8</h3>
<p><h3>File: eclac.list</h3>
<table width="90%"><tr><td bgcolor="#FFCCFF">
<pre>
#Formerly ECLAC
tembl:J01636
#Formerly ECLACA
tembl:X51872
#Formerly ECLACI
tembl:V00294
#Formerly ECLACY
tembl:V00295
#Formerly ECLACZ
tembl:V00296
</pre>
</td></tr></table><p>
<a name="input.9"></a>
<h3>Input files for usage example 9</h3>
'tembl:v00296' is a sequence entry in the example nucleic acid database 'tembl'
<p>
<p><h3>Database entry: tembl:v00296</h3>
<table width="90%"><tr><td bgcolor="#FFCCFF">
<pre>
ID V00296; SV 1; linear; genomic DNA; STD; PRO; 3078 BP.
XX
AC V00296;
XX
DT 13-JUL-1983 (Rel. 03, Created)
DT 18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE E. coli gene lacZ coding for beta-galactosidase (EC 3.2.1.23).
XX
KW galactosidase.
XX
OS Escherichia coli
OC Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC Enterobacteriaceae; Escherichia.
XX
RN [1]
RP 1-3078
RX PUBMED; 6313347.
RA Kalnins A., Otto K., Ruether U., Mueller-Hill B.;
RT "Sequence of the lacZ gene of Escherichia coli";
RL EMBO J. 2(4):593-597(1983).
XX
RN [2]
RX PUBMED; 3038536.
RA Zell R., Fritz H.J.;
RT "DNA mismatch-repair in Escherichia coli counteracting the hydrolytic
RT deamination of 5-methyl-cytosine residues";
RL EMBO J. 6(6):1809-1815(1987).
XX
CC Data kindly reviewed (18-MAY-1983) by U. Ruether
XX
FH Key Location/Qualifiers
FH
FT source 1..3078
FT /organism="Escherichia coli"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:562"
FT CDS <1..3072
FT /transl_table=11
FT /note="galactosidase"
FT /db_xref="GOA:P00722"
FT /db_xref="InterPro:IPR004199"
FT /db_xref="InterPro:IPR006101"
FT /db_xref="InterPro:IPR006102"
FT /db_xref="InterPro:IPR006103"
FT /db_xref="InterPro:IPR006104"
FT /db_xref="InterPro:IPR008979"
FT /db_xref="InterPro:IPR011013"
FT /db_xref="InterPro:IPR013781"
FT /db_xref="InterPro:IPR013812"
<font color=red> [Part of this file has been deleted for brevity]</font>
gaggcccgca ccgatcgccc ttcccaacag ttgcgcagcc tgaatggcga atggcgcttt 180
gcctggtttc cggcaccaga agcggtgccg gaaagctggc tggagtgcga tcttcctgag 240
gccgatactg tcgtcgtccc ctcaaactgg cagatgcacg gttacgatgc gcccatctac 300
accaacgtaa cctatcccat tacggtcaat ccgccgtttg ttcccacgga gaatccgacg 360
ggttgttact cgctcacatt taatgttgat gaaagctggc tacaggaagg ccagacgcga 420
attatttttg atggcgttaa ctcggcgttt catctgtggt gcaacgggcg ctgggtcggt 480
tacggccagg acagtcgttt gccgtctgaa tttgacctga gcgcattttt acgcgccgga 540
gaaaaccgcc tcgcggtgat ggtgctgcgt tggagtgacg gcagttatct ggaagatcag 600
gatatgtggc ggatgagcgg cattttccgt gacgtctcgt tgctgcataa accgactaca 660
caaatcagcg atttccatgt tgccactcgc tttaatgatg atttcagccg cgctgtactg 720
gaggctgaag ttcagatgtg cggcgagttg cgtgactacc tacgggtaac agtttcttta 780
tggcagggtg aaacgcaggt cgccagcggc accgcgcctt tcggcggtga aattatcgat 840
gagcgtggtg gttatgccga tcgcgtcaca ctacgtctga acgtcgaaaa cccgaaactg 900
tggagcgccg aaatcccgaa tctctatcgt gcggtggttg aactgcacac cgccgacggc 960
acgctgattg aagcagaagc ctgcgatgtc ggtttccgcg aggtgcggat tgaaaatggt 1020
ctgctgctgc tgaacggcaa gccgttgctg attcgaggcg ttaaccgtca cgagcatcat 1080
cctctgcatg gtcaggtcat ggatgagcag acgatggtgc aggatatcct gctgatgaag 1140
cagaacaact ttaacgccgt gcgctgttcg cattatccga accatccgct gtggtacacg 1200
ctgtgcgacc gctacggcct gtatgtggtg gatgaagcca atattgaaac ccacggcatg 1260
gtgccaatga atcgtctgac cgatgatccg cgctggctac cggcgatgag cgaacgcgta 1320
acgcgaatgg tgcagcgcga tcgtaatcac ccgagtgtga tcatctggtc gctggggaat 1380
gaatcaggcc acggcgctaa tcacgacgcg ctgtatcgct ggatcaaatc tgtcgatcct 1440
tcccgcccgg tgcagtatga aggcggcgga gccgacacca cggccaccga tattatttgc 1500
ccgatgtacg cgcgcgtgga tgaagaccag cccttcccgg ctgtgccgaa atggtccatc 1560
aaaaaatggc tttcgctacc tggagagacg cgcccgctga tcctttgcga atacgcccac 1620
gcgatgggta acagtcttgg cggtttcgct aaatactggc aggcgtttcg tcagtatccc 1680
cgtttacagg gcggcttcgt ctgggactgg gtggatcagt cgctgattaa atatgatgaa 1740
aacggcaacc cgtggtcggc ttacggcggt gattttggcg atacgccgaa cgatcgccag 1800
ttctgtatga acggtctggt ctttgccgac cgcacgccgc atccagcgct gacggaagca 1860
aaacaccagc agcagttttt ccagttccgt ttatccgggc aaaccatcga agtgaccagc 1920
gaatacctgt tccgtcatag cgataacgag ctcctgcact ggatggtggc gctggatggt 1980
aagccgctgg caagcggtga agtgcctctg gatgtcgctc cacaaggtaa acagttgatt 2040
gaactgcctg aactaccgca gccggagagc gccgggcaac tctggctcac agtacgcgta 2100
gtgcaaccga acgcgaccgc atggtcagaa gccgggcaca tcagcgcctg gcagcagtgg 2160
cgtctggcgg aaaacctcag tgtgacgctc cccgccgcgt cccacgccat cccgcatctg 2220
accaccagcg aaatggattt ttgcatcgag ctgggtaata agcgttggca atttaaccgc 2280
cagtcaggct ttctttcaca gatgtggatt ggcgataaaa aacaactgct gacgccgctg 2340
cgcgatcagt tcacccgtgc accgctggat aacgacattg gcgtaagtga agcgacccgc 2400
attgacccta acgcctgggt cgaacgctgg aaggcggcgg gccattacca ggccgaagca 2460
gcgttgttgc agtgcacggc agatacactt gctgatgcgg tgctgattac gaccgctcac 2520
gcgtggcagc atcaggggaa aaccttattt atcagccgga aaacctaccg gattgatggt 2580
agtggtcaaa tggcgattac cgttgatgtt gaagtggcga gcgatacacc gcatccggcg 2640
cggattggcc tgaactgcca gctggcgcag gtagcagagc gggtaaactg gctcggatta 2700
gggccgcaag aaaactatcc cgaccgcctt actgccgcct gttttgaccg ctgggatctg 2760
ccattgtcag acatgtatac cccgtacgtc ttcccgagcg aaaacggtct gcgctgcggg 2820
acgcgcgaat tgaattatgg cccacaccag tggcgcggcg acttccagtt caacatcagc 2880
cgctacagtc aacagcaact gatggaaacc agccatcgcc atctgctgca cgcggaagaa 2940
ggcacatggc tgaatatcga cggtttccat atggggattg gtggcgacga ctcctggagc 3000
ccgtcagtat cggcggaatt ccagctgagc gccggtcgct accattacca gttggtctgg 3060
tgtcaaaaat aataataa 3078
//
</pre>
</td></tr></table><p>
<H2>
Output file format
</H2>
<a name="output.1"></a>
<h3>Output files for usage example </h3>
<p><h3>File: globins.infoalign</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
# USA Name SeqLen AlignLen Gaps GapLen Ident Similar Differ % Change Weight Description
msf::../../data/globins.msf:HBB_HUMAN HBB_HUMAN 146 150 3 4 68 17 61 54.666668 0.610000
msf::../../data/globins.msf:HBB_HORSE HBB_HORSE 146 150 3 4 68 17 61 54.666668 0.650000
msf::../../data/globins.msf:HBA_HUMAN HBA_HUMAN 141 144 2 3 60 9 72 58.333332 0.650000
msf::../../data/globins.msf:HBA_HORSE HBA_HORSE 141 144 2 3 63 6 72 56.250000 0.830000
msf::../../data/globins.msf:MYG_PHYCA MYG_PHYCA 153 157 3 4 30 15 108 80.891716 1.000000
msf::../../data/globins.msf:GLB5_PETMA GLB5_PETMA 149 151 1 2 32 16 101 78.807945 0.910000
msf::../../data/globins.msf:LGB2_LUPLU LGB2_LUPLU 153 153 0 0 19 24 110 87.581696 0.430000
</pre>
</td></tr></table><p>
<a name="output.2"></a>
<h3>Output files for usage example 2</h3>
<p><h3>File: globins.infoalign</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
# Name SeqLen AlignLen Gaps GapLen Ident Similar Differ % Change Weight Description
HBB_HUMAN 146 150 3 4 68 17 61 54.666668 0.610000
HBB_HORSE 146 150 3 4 68 17 61 54.666668 0.650000
HBA_HUMAN 141 144 2 3 60 9 72 58.333332 0.650000
HBA_HORSE 141 144 2 3 63 6 72 56.250000 0.830000
MYG_PHYCA 153 157 3 4 30 15 108 80.891716 1.000000
GLB5_PETMA 149 151 1 2 32 16 101 78.807945 0.910000
LGB2_LUPLU 153 153 0 0 19 24 110 87.581696 0.430000
</pre>
</td></tr></table><p>
<a name="output.3"></a>
<h3>Output files for usage example 3</h3>
<p><h3>File: globins.infoalign</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
HBB_HUMAN 146
HBB_HORSE 146
HBA_HUMAN 141
HBA_HORSE 141
MYG_PHYCA 153
GLB5_PETMA 149
LGB2_LUPLU 153
</pre>
</td></tr></table><p>
<a name="output.4"></a>
<h3>Output files for usage example 4</h3>
<p><h3>File: globins.infoalign</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
HBB_HUMAN 4 61
HBB_HORSE 4 61
HBA_HUMAN 3 72
HBA_HORSE 3 72
MYG_PHYCA 4 108
GLB5_PETMA 2 101
LGB2_LUPLU 0 110
</pre>
</td></tr></table><p>
<a name="output.5"></a>
<h3>Output files for usage example 5</h3>
<p><h3>File: globins.infoalign</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
HBB_HUMAN 3
HBB_HORSE 3
HBA_HUMAN 2
HBA_HORSE 2
MYG_PHYCA 3
GLB5_PETMA 1
LGB2_LUPLU 0
</pre>
</td></tr></table><p>
<a name="output.6"></a>
<h3>Output files for usage example 6</h3>
<p><h3>File: globins.infoalign</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
<table border cellpadding=4 bgcolor="#FFFFF0">
<tr><th>USA</th><th>Name</th><th>Sequence Length</th><th>Aligned Length</th><th>Gaps</th><th>Gap Length</th><th>Identity</th><th>Similarity</th><th>Difference</th><th>% Change</th><th>Weight</th><th>Description</th></tr>
<tr><td>msf::../../data/globins.msf:HBB_HUMAN</td>
<td>HBB_HUMAN</td>
<td>146</td>
<td>150</td>
<td>3</td>
<td>4</td>
<td>68</td>
<td>17</td>
<td>61</td>
<td>54.666668</td>
<td>0.610000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:HBB_HORSE</td>
<td>HBB_HORSE</td>
<td>146</td>
<td>150</td>
<td>3</td>
<td>4</td>
<td>68</td>
<td>17</td>
<td>61</td>
<td>54.666668</td>
<td>0.650000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:HBA_HUMAN</td>
<td>HBA_HUMAN</td>
<td>141</td>
<td>144</td>
<td>2</td>
<td>3</td>
<td>60</td>
<td>9</td>
<td>72</td>
<td>58.333332</td>
<td>0.650000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:HBA_HORSE</td>
<td>HBA_HORSE</td>
<td>141</td>
<td>144</td>
<td>2</td>
<td>3</td>
<td>63</td>
<td>6</td>
<td>72</td>
<td>56.250000</td>
<td>0.830000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:MYG_PHYCA</td>
<td>MYG_PHYCA</td>
<td>153</td>
<td>157</td>
<td>3</td>
<td>4</td>
<td>30</td>
<td>15</td>
<td>108</td>
<td>80.891716</td>
<td>1.000000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:GLB5_PETMA</td>
<td>GLB5_PETMA</td>
<td>149</td>
<td>151</td>
<td>1</td>
<td>2</td>
<td>32</td>
<td>16</td>
<td>101</td>
<td>78.807945</td>
<td>0.910000</td>
<td></td>
</tr>
<tr><td>msf::../../data/globins.msf:LGB2_LUPLU</td>
<td>LGB2_LUPLU</td>
<td>153</td>
<td>153</td>
<td>0</td>
<td>0</td>
<td>19</td>
<td>24</td>
<td>110</td>
<td>87.581696</td>
<td>0.430000</td>
<td></td>
</tr>
</table>
</pre>
</td></tr></table><p>
<a name="output.7"></a>
<h3>Output files for usage example 7</h3>
<p><h3>File: globins.infoalign</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
# USA Name SeqLen AlignLen Gaps GapLen Ident Similar Differ % Change Weight Description
msf::../../data/globins.msf:HBB_HUMAN HBB_HUMAN 146 150 3 4 146 0 0 2.666667 0.610000
msf::../../data/globins.msf:HBB_HORSE HBB_HORSE 146 150 3 4 122 10 14 18.666666 0.650000
msf::../../data/globins.msf:HBA_HUMAN HBA_HUMAN 141 144 2 3 48 19 74 66.666664 0.650000
msf::../../data/globins.msf:HBA_HORSE HBA_HORSE 141 144 2 3 51 18 72 64.583336 0.830000
msf::../../data/globins.msf:MYG_PHYCA MYG_PHYCA 153 157 3 4 30 22 101 80.891716 1.000000
msf::../../data/globins.msf:GLB5_PETMA GLB5_PETMA 149 151 1 2 24 27 98 84.105957 0.910000
msf::../../data/globins.msf:LGB2_LUPLU LGB2_LUPLU 153 153 0 0 21 28 104 86.274513 0.430000
</pre>
</td></tr></table><p>
<a name="output.8"></a>
<h3>Output files for usage example 8</h3>
<p><h3>File: test.out</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
# USA Name SeqLen AlignLen Gaps GapLen Ident Similar Differ % Change Weight Description
tembl-id:J01636 J01636 7477 7477 0 0 374 0 7103 94.997993 1.000000 E.coli lactose operon with lacI, lacZ, lacY and lacA genes.
tembl-id:X51872 X51872 1832 1832 0 0 374 0 1458 79.585152 1.000000 Escherichia coli lacA gene for thiogalactoside transacetylase
tembl-id:V00294 V00294 1113 1113 0 0 302 0 811 72.866127 1.000000 E. coli laci gene (codes for the lac repressor).
tembl-id:V00295 V00295 1500 1500 0 0 336 0 1164 77.599998 1.000000 E. coli lacY gene (codes for lactose permease).
tembl-id:V00296 V00296 3078 3078 0 0 373 0 2705 87.881744 1.000000 E. coli gene lacZ coding for beta-galactosidase (EC 3.2.1.23).
</pre>
</td></tr></table><p>
<a name="output.9"></a>
<h3>Output files for usage example 9</h3>
<p><h3>File: test.out</h3>
<table width="90%"><tr><td bgcolor="#CCFFCC">
<pre>
# USA Name SeqLen AlignLen Gaps GapLen Ident Similar Differ % Change Weight Description
tembl-id:V00296 V00296 3078 3078 0 0 3078 0 0 0.000000 1.000000 E. coli gene lacZ coding for beta-galactosidase (EC 3.2.1.23).
</pre>
</td></tr></table><p>
<p>
The first non-blank line is the heading. This is followed by one line
per sequence containing the following columns of data separated by one
of more space or TAB characters:
<p>
<UL>
<LI> The USA (Uniform Sequence Address) that EMBOSS can use to read in
the sequence.
<LI> Name - name of the sequence.
<LI> SeqLen - length of the sequence when all gap characters are removed.
<LI> AlignLen - length of the sequence including internal gap
characters i.e. gaps at the start or the end are not included.
<LI> Gaps - number of gaps e.g. 'AAA---AAA' is 1 gap (and 3 gap
characters long (see GapLen)).
<LI> GapLen - total number of internal gap characters, see the 3 gap
characters above. This is the sum total of all of the internal gap
characters in this sequence.
<LI> Ident - number of characters that are identical to the specified
reference sequence (uppercase 'A' is identical to lowercase 'a').
<LI> Similar - number of characters which are non-identical - which
score > 0 in the comparison matrix when compared to the reference
sequence, but which are not identical.
<LI> Different - number of characters which score <= 0 in the
comparison matrix when compared to the reference sequence.
<LI> %Change - a simple measure of the percentage change as compared
to the reference sequence: (AlignLen - Ident) * 100 / AlignLen
<LI> Description - the description annotation of the sequence (if
any).
</UL>
<p>
If qualifiers to inhibit various columns of information are used, then
the remaining columns of information are output in the same order as
shown above, so if '-noseqlength' is used, the order of output is: usa,
name, alignlength, gaps, gapcount, idcount, simcount, diffcount, change,
description.
<p>
When the -html qualifier is specified, then the output will be wrapped
in HTML tags, ready for inclusion in a Web page. Note that tags such as
<HTML> and <BODY> are not output by this program as the table of
databases is expected to form only part of the contents of a web page -
the rest of the web page must be supplier by the user.
<p>
The lines of output information are guaranteed not to have trailing
white-space at the end.
<H2>
Data files
</H2>
<b>infoalign</b> reads in scoring matrices to determine the consensus
sequence and to determine which matches are similar or not.
<p>
<p>
EMBOSS data files are distributed with the application and stored
in the standard EMBOSS data directory, which is defined
by the EMBOSS environment variable EMBOSS_DATA.
<p>
To see the available EMBOSS data files, run:
<p>
<pre>
% embossdata -showall
</pre>
<p>
To fetch one of the data files (for example 'Exxx.dat') into your
current directory for you to inspect or modify, run:
<pre>
% embossdata -fetch -file Exxx.dat
</pre>
<p>
Users can provide their own data files in their own directories.
Project specific files can be put in the current directory, or for
tidier directory listings in a subdirectory called
".embossdata". Files for all EMBOSS runs can be put in the user's home
directory, or again in a subdirectory called ".embossdata".
<p>
The directories are searched in the following order:
<ul>
<li> . (your current directory)
<li> .embossdata (under your current directory)
<li> ~/ (your home directory)
<li> ~/.embossdata
</ul>
<p>
<H2>
Notes
</H2>
<p>There are many qualifiers to control exactly what information on the sequence is output and how it is formatted. If you only want a few fields in the output file, the command line may be shortended by preceding the appropriate qualifier with <tt>-only</tt>. For example, instead of specifying <tt>-nohead -nousa -noname -noalign -nogaps -nogapcount -nosimcount -noidcount -nodiffcount -noweight</tt> to get only the sequence length output, you can specify <tt>-only -seqlength</tt>.</p>
<p>By default, the output file starts each line with the USA of the sequence being described, so the output file is a list file that can be manually edited and read in by any other EMBOSS program that can read in one or more sequence to be analysed.</p>
<H2>
References
</H2>
None.
<H2>
Warnings
</H2>
None.
<H2>
Diagnostic Error Messages
</H2>
None.
<H2>
Exit status
</H2>
It always exits with status 0.
<H2>
Known bugs
</H2>
None.
<h2><a name="See also">See also</a></h2>
<table border cellpadding=4 bgcolor="#FFFFF0">
<tr><th>Program name</th>
<th>Description</th></tr>
<tr>
<td><a href="abiview.html">abiview</a></td>
<td>Display the trace in an ABI sequencer file</td>
</tr>
<tr>
<td><a href="coderet.html">coderet</a></td>
<td>Extract CDS, mRNA and translations from feature tables</td>
</tr>
<tr>
<td><a href="edialign.html">edialign</a></td>
<td>Local multiple alignment of sequences</td>
</tr>
<tr>
<td><a href="emma.html">emma</a></td>
<td>Multiple sequence alignment (ClustalW wrapper)</td>
</tr>
<tr>
<td><a href="entret.html">entret</a></td>
<td>Retrieve sequence entries from flatfile databases and files</td>
</tr>
<tr>
<td><a href="extractalign.html">extractalign</a></td>
<td>Extract regions from a sequence alignment</td>
</tr>
<tr>
<td><a href="infoseq.html">infoseq</a></td>
<td>Display basic information about sequences</td>
</tr>
<tr>
<td><a href="plotcon.html">plotcon</a></td>
<td>Plot conservation of a sequence alignment</td>
</tr>
<tr>
<td><a href="prettyplot.html">prettyplot</a></td>
<td>Draw a sequence alignment with pretty formatting</td>
</tr>
<tr>
<td><a href="refseqget.html">refseqget</a></td>
<td>Get reference sequence</td>
</tr>
<tr>
<td><a href="seqxref.html">seqxref</a></td>
<td>Retrieve all database cross-references for a sequence entry</td>
</tr>
<tr>
<td><a href="seqxrefget.html">seqxrefget</a></td>
<td>Retrieve all cross-referenced data for a sequence entry</td>
</tr>
<tr>
<td><a href="showalign.html">showalign</a></td>
<td>Display a multiple sequence alignment in pretty format</td>
</tr>
<tr>
<td><a href="tranalign.html">tranalign</a></td>
<td>Generate an alignment of nucleic coding regions from aligned proteins</td>
</tr>
<tr>
<td><a href="variationget.html">variationget</a></td>
<td>Get sequence variations</td>
</tr>
<tr>
<td><a href="whichdb.html">whichdb</a></td>
<td>Search all sequence databases for an entry and retrieve it</td>
</tr>
</table>
<H2>
Author(s)
</H2>
Gary Williams formerly at:
<br>
MRC Rosalind Franklin Centre for Genomics Research
Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SB, UK
<p>
Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.
<H2>
History
</H2>
Written (June 2001) - Gary Williams
<H2>
Target users
</H2>
This program is intended to be used by everyone and everything, from naive users to embedded scripts.
<H2>
Comments
</H2>
None
</BODY>
</HTML>
|