File: tsx.fasta

package info (click to toggle)
garlic 1.4-1
  • links: PTS
  • area: main
  • in suites: sarge
  • size: 4,192 kB
  • ctags: 1,368
  • sloc: ansic: 49,603; makefile: 1,079
file content (6 lines) | stat: -rw-r--r-- 378 bytes parent folder | download | duplicates (5)
1
2
3
4
5
6
>sp|P22786|TSX_ECOLI Nucleoside-specific channel-forming protein tsx precursor
MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLE
YEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGP
FKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANEN
EWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSH
ILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF