File: sample.fasta

package info (click to toggle)
garlic 1.6-3
  • links: PTS, VCS
  • area: main
  • in suites: bullseye, buster, sid
  • size: 4,516 kB
  • sloc: ansic: 52,465; makefile: 2,254
file content (4 lines) | stat: -rw-r--r-- 247 bytes parent folder | download | duplicates (6)
1
2
3
4
>1l00_  mol:protein length:164     Lysozyme (E.C. 3.2.1.17) Mutant With Gln 105
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAV
RGILRNAKLKPVYDSLDAVRRCALINMVFAMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVI
TTFRTGTWDAYKNL