File: tsx.fasta

package info (click to toggle)
garlic 1.6-3
  • links: PTS, VCS
  • area: main
  • in suites: bullseye, buster, sid
  • size: 4,516 kB
  • sloc: ansic: 52,465; makefile: 2,254
file content (6 lines) | stat: -rw-r--r-- 378 bytes parent folder | download | duplicates (5)
1
2
3
4
5
6
>sp|P22786|TSX_ECOLI Nucleoside-specific channel-forming protein tsx precursor
MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLE
YEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGP
FKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANEN
EWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSH
ILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF