1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497
|
//
// C++ Implementation: StateSpace
//
// Description:
//
//
// Author: BUI Quang Minh(C) 2018
//
// Copyright: See COPYING file that comes with this distribution
//
//
#include "statespace.h"
namespace PML {
const char* const ERR_NOT_A_LIST = "list '[...]' expected";
const char* const ERR_NOT_A_MAP = "'key: value' pairs expected";
const char* const ERR_UNDEFINED_STATE = "undefined state";
const char* const ERR_STRING_LIST = "string or list [...] expected";
const char* const ERR_TRANSLATE_LENGTH = "translate length different from #states";
const char* const KEY_DATATYPE = "datatype";
const char* const KEY_STATE = "state";
const char* const KEY_MISSING = "missing";
const char* const KEY_GAP = "gap";
const char* const KEY_EQUATE = "equate";
const char* const KEY_TRANSLATE = "translate";
const char* builtin_state_spaces = R"(
### DNA data definition ###
- datatype: DNA
state: &Nucleotide [ A, C, G, T ] # anchor to Nucleotide
missing: &NTmissing [ N, "?" ]
gap: &NTgap "-"
equate:
U: T # T and U are the same
R: [A, G] # R is interpreted as A or G
Y: [C, T]
W: [A, T]
S: [G, C]
M: [A, C]
K: [G, T]
B: [C, G, T]
H: [A, C, T]
D: [A, G, T]
V: [A, G, C]
### Amino-acid data definition ###
- datatype: AA
state: [ A, R, N, D, C, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y, V ]
missing: [ X, "?", "*" ]
gap: "-"
equate:
B: [ N, D ]
Z: [ Q, E ]
J: [ I, L ]
### Binary (0/1) data ###
- datatype: BIN
state: [ 0, 1 ]
missing: "?"
gap: "-"
### RY data definition ###
- datatype: RY
state: [ R, Y ] # R=AG, Y=CT
missing: [ N, "?", W, S, M, K, B, H, D, V ]
gap: "-"
equate:
A: R
C: Y
G: R
T: Y
U: Y
### Morphological data ###
- datatype: MORPH
state: [ 0..9, A..Z ]
missing: "?"
gap: "-"
### Codon data with standard genetic code ###
- datatype: CODON
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: [ K, N, K, N, T, T, T, T, R, S, R, S, I, I, M, I,
Q, H, Q, H, P, P, P, P, R, R, R, R, L, L, L, L,
E, D, E, D, A, A, A, A, G, G, G, G, V, V, V, V,
X, Y, X, Y, S, S, S, S, X, C, W, C, L, F, L, F ]
### Codon data with Vertebrate Mitochondrial code ###
- datatype: CODON2
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTT*S*SMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Vertebrate Mitochondrial code ###
- datatype: CODON2
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTT*S*SMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Yeast Mitochondrial code ###
- datatype: CODON3
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSMIMIQHQHPPPPRRRRTTTTEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Mold, Protozoan code ###
- datatype: CODON4
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Invertebrate Mitochondrial code ###
- datatype: CODON5
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Ciliate, Dasycladacean and Hexamita Nuclear code ###
- datatype: CODON6
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVVQYQYSSSS*CWCLFLF
### Codon data with Echinoderm and Flatworm Mitochondrial code ###
- datatype: CODON9
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: NNKNTTTTSSSSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Euplotid Nuclear code ###
- datatype: CODON10
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSCCWCLFLF
### Codon data with Bacterial, Archaeal and Plant Plastid code ###
- datatype: CODON11
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWCLFLF
### Codon data with Alternative Yeast Nuclear code ###
- datatype: CODON12
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLSLEDEDAAAAGGGGVVVV*Y*YSSSS*CWCLFLF
### Codon data with Ascidian Mitochondrial code ###
- datatype: CODON13
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTGSGSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Alternative Flatworm Mitochondrial code ###
- datatype: CODON14
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: NNKNTTTTSSSSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVVYY*YSSSSWCWCLFLF
### Codon data with Blepharisma Nuclear code ###
- datatype: CODON15
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YQYSSSS*CWCLFLF
### Codon data with Chlorophycean Mitochondrial code ###
- datatype: CODON16
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLYSSSS*CWCLFLF
### Codon data with Trematode Mitochondrial code ###
- datatype: CODON21
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: NNKNTTTTSSSSMIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Scenedesmus obliquus mitochondrial code ###
- datatype: CODON22
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*YLY*SSS*CWCLFLF
### Codon data with Thraustochytrium Mitochondrial code ###
- datatype: CODON23
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSS*CWC*FLF
### Codon data with Pterobranchia mitochondrial code ###
- datatype: CODON24
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTSSKSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSWCWCLFLF
### Codon data with Candidate Division SR1 and Gracilibacteria code ###
- datatype: CODON25
state: [ *Nucleotide, *Nucleotide, *Nucleotide ] # reference to Nucleotide
missing: [ *NTmissing, *NTmissing, *NTmissing ]
gap: [ *NTgap, *NTgap, *NTgap ]
translate: KNKNTTTTRSRSIIMIQHQHPPPPRRRRLLLLEDEDAAAAGGGGVVVV*Y*YSSSSGCWCLFLF
)";
StateSpace::StateSpace() {
num_states = 0;
num_all_states = 0;
}
StateSpace::~StateSpace() {
}
bool StateSpace::isUnknown(StateType state) {
return (state == num_states);
}
StateType StateSpace::toState(string str) {
StringStateMap::iterator it;
it = states.find(str);
if (it == states.end())
throw str + " is not a valid state symbol";
return it->second;
}
void StateSpace::toState(string &str, StateVector &str_states) {
size_t pos;
for (pos = 0; pos < str.length();) {
bool found = false;
for (int len = min_state_len; len <= max_state_len; len++) {
auto it = states.find(str.substr(pos, len));
if (it == states.end())
continue;
found = true;
str_states.push_back(it->second);
pos += len;
break;
}
if (!found)
throw str.substr(pos, max_state_len) + " is not a valid state symbol";
}
}
string StateSpace::toString(StateType state) {
auto it = raw_states.find(state);
ASSERT(it != raw_states.end());
return it->second;
}
/**
parse a string with range (e.g. 1..5) to a vector of string
*/
void parseRange(string str, StrVector &list) {
size_t pos;
if ((pos = str.find("..")) == string::npos) {
list.push_back(str);
return;
}
string first = str.substr(0, pos);
string last = str.substr(pos+2);
trimString(first);
trimString(last);
if (first.length() == 1 && last.length() == 1 && first[0] < last[0]) {
for (char ch = first[0]; ch <= last[0]; ch++)
list.push_back(string(1,ch));
} else {
list.push_back(str);
}
}
/**
parse a list into a vector of string
*/
void parseList(YAML::const_iterator first, YAML::const_iterator last, StrVector &list) {
StrVector this_list;
if (first->IsScalar())
parseRange(first->Scalar(), this_list);
else if (first->IsSequence()) {
for (auto it = first->begin(); it != first->end(); it++) {
parseRange(it->Scalar(), this_list);
}
} else {
throw YAML::Exception(first->Mark(), ERR_STRING_LIST);
}
StrVector last_list;
first++;
if (first != last)
parseList(first, last, last_list);
else
last_list = { "" };
for (auto sit = this_list.begin(); sit != this_list.end(); sit++)
for (auto sit2 = last_list.begin(); sit2 != last_list.end(); sit2++ )
list.push_back(*sit + *sit2);
}
/**
parse a YAML::Node into a list of strings
@param extend_length TRUE to make vector of characters if list has length 1
*/
void parseStringList(YAML::Node node, StrVector &list, bool extend_length = false) {
if (node.IsScalar()) {
// scalar assumed to be string
parseRange(node.Scalar(), list);
} else if (node.IsSequence()) {
YAML::const_iterator it;
// check if a sequence of scalars
bool all_scalars = true;
for (it = node.begin(); it != node.end(); it++)
if (!it->IsScalar()) {
all_scalars = false;
break;
}
if (all_scalars) {
for (it = node.begin(); it != node.end(); it++)
parseRange(it->Scalar(), list);
} else {
// now it can be a sequence of sequences, merge them together
parseList(node.begin(), node.end(), list);
}
} else {
throw YAML::Exception(node.Mark(), ERR_STRING_LIST);
}
if (list.size() == 1 && extend_length) {
// single list, convert to vector of characters
for (auto i = list[0].begin()+1; i != list[0].end(); i++)
list.push_back(string(1,*i));
list[0] = list[0].substr(0,1);
}
}
void StateSpace::resetStateSpace() {
space_name = "";
num_states = 0;
num_all_states = 0;
states.clear();
raw_states.clear();
equate.clear();
translate.clear();
min_state_len = max_state_len = 0;
}
void StateSpace::parseStateSpace(YAML::Node datatype) {
if (!datatype.IsMap())
throw YAML::Exception(datatype.Mark(), ERR_NOT_A_MAP);
if (!datatype[KEY_DATATYPE])
throw YAML::Exception(datatype.Mark(), "'datatype: XXX' declaration not found");
resetStateSpace();
space_name = datatype[KEY_DATATYPE].Scalar();
// definition found
// parse state: symbols
if (!datatype[KEY_STATE])
throw YAML::Exception(datatype.Mark(), "datatype does not have 'state: [...]'");
StrVector allstates;
parseStringList(datatype[KEY_STATE], allstates);
if (allstates.size() < 2)
throw YAML::Exception(datatype[KEY_STATE].Mark(), "state space must have at least 2 states");
StateType stateID = 0;
for (auto sit = allstates.begin(); sit != allstates.end(); sit++, stateID++) {
states[*sit] = stateID;
raw_states[stateID] = *sit;
}
num_states = stateID;
if (verbose_mode >= VB_MED)
cout << states.size() << " " << KEY_STATE << endl;
// parse missing: symbols
if (datatype[KEY_MISSING]) {
StrVector list;
parseStringList(datatype[KEY_MISSING], list);
for (auto i = list.begin(); i != list.end(); i++) {
states[*i] = stateID;
raw_states[stateID] = *i;
}
}
// parse gap: symbols
if (datatype[KEY_GAP]) {
StrVector list;
parseStringList(datatype[KEY_GAP], list);
for (auto i = list.begin(); i != list.end(); i++) {
states[*i] = stateID;
raw_states[stateID] = *i;
}
}
stateID++;
// parse equate: symbols
YAML::Node node_equate;
if ((node_equate = datatype[KEY_EQUATE])) {
if (!node_equate.IsMap())
throw YAML::Exception(node_equate.Mark(), ERR_NOT_A_MAP);
for (auto nit = node_equate.begin(); nit != node_equate.end(); nit++) {
string key = nit->first.Scalar();
states[key] = stateID;
auto value = nit->second;
StrVector values;
parseStringList(value, values);
for (auto i = values.begin(); i != values.end(); i++) {
if (states.find(*i) == states.end())
throw YAML::Exception(value.Mark(), ERR_UNDEFINED_STATE);
if (equate.find(stateID) == equate.end())
equate[stateID] = { states[*i] };
else
equate[stateID].push_back(states[*i]);
}
if (equate[stateID].size() == 1) {
// map to just one state, so it's not an ambiguous state
states[key] = equate[stateID][0];
equate.erase(stateID);
} else {
// increase number of states
raw_states[stateID] = key;
stateID++;
}
} // for Node
if (verbose_mode >= VB_MED)
cout << equate.size() << " ambiguous states" << endl;
} // equate
// parse translate
if (datatype[KEY_TRANSLATE]) {
parseStringList(datatype[KEY_TRANSLATE], translate, true);
if (translate.size() != num_states)
throw YAML::Exception(datatype[KEY_TRANSLATE].Mark(), ERR_TRANSLATE_LENGTH);
}
num_all_states = stateID;
min_state_len = max_state_len = states.begin()->first.length();
for (auto i = states.begin(); i != states.end(); i++) {
if (min_state_len > i->first.length())
min_state_len = i->first.length();
if (max_state_len < i->first.length())
max_state_len = i->first.length();
}
}
void StateSpace::initStateSpace(SeqType seqtype) {
string name;
switch (seqtype) {
case SEQ_DNA: name = "DNA"; break;
case SEQ_CODON: name = "CODON"; break;
case SEQ_MORPH: name = "MORPH"; break;
case SEQ_BINARY: name = "BIN"; break;
case SEQ_PROTEIN: name = "AA"; break;
case SEQ_MULTISTATE: name = "MULTI"; break;
case SEQ_POMO: outError("Unhandled POMO state space"); break;
case SEQ_UNKNOWN: ASSERT(0);
}
try {
YAML::Node spaceDef = YAML::Load(builtin_state_spaces);
if (!spaceDef.IsSequence())
throw YAML::Exception(spaceDef.Mark(), ERR_NOT_A_LIST);
for (auto it = spaceDef.begin(); it != spaceDef.end(); it++)
{
auto datatype = *it;
if (!(datatype[KEY_DATATYPE]))
continue;
if (datatype[KEY_DATATYPE].Scalar() == name) {
parseStateSpace(datatype);
break;
}
}
} catch (YAML::Exception &e) {
outError(e.what());
}
}
} // namespace PML
|