File: lazaruside.tr.po

package info (click to toggle)
lazarus 2.0.0%2Bdfsg-2
links: PTS, VCS
area: main
in suites: buster
size: 214,460 kB
sloc: pascal: 1,862,622; xml: 265,709; cpp: 56,595; sh: 3,008; java: 609; makefile: 535; perl: 297; sql: 222; ansic: 137
file content (21967 lines) | stat: -rw-r--r-- 691,573 bytes
msgid ""
msgstr ""
"Project-Id-Version: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: \n"
"Last-Translator: Hakan KIZILHAN <hakan486@yahoo.com>\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Language: tr\n"
"X-Generator: Poedit 2.1.1\n"

#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr "Grupları Seç"

#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr "Kesme noktasına gelindiğinde devre dışı bırakılacak grupları seç"

#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr "Kesme noktasına gelindiğinde etkinleştirilecek grupları seç"

#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr "Etkin/Devre dışı listesindeki bazı gruplar mevcut değil.%0:sOluşturulsun mu?%0:s%0:s%1:s"

#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
#, fuzzy
msgid "Address Breakpoint %s"
msgstr "Address Breakpoint %s"

#: lazarusidestrconsts.dbgeventbreakataddress
msgid "at $%s"
msgstr "$%s adresinde"

#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
msgid "at $%s: from origin %s line %d"
msgstr "$%s adresinde: %s kaynağından satır %d"

#: lazarusidestrconsts.dbgeventbreakataddresssourceline
msgid "at $%s: %s line %d"
msgstr "$%s adresinde: %s satır %d"

#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
msgid "Source Breakpoint %s"
msgstr "Kaynak Kesme Noktası %s"

#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
msgid "Unknown Breakpoint %s"
msgstr "Bilinmeyen Kesme Noktası %s"

#: lazarusidestrconsts.dbgeventbreakwatchpoint
msgid "Watchpoint %s"
msgstr "İzleme Noktası %s"

#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
msgid "Unknown Watchpoint out of scope %s"
msgstr "Bilinmeyen İzleme Noktası kapsam dışında %s"

#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Bilinmeyen İzleme Noktası tetiklendi %s. Eski değer \"%s\", Yeni Değer \"%s\""

#: lazarusidestrconsts.dbgeventwatchscopeended
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr "\"%s\" için İzleme Noktası kapsam dışında %s"

#: lazarusidestrconsts.dbgeventwatchtriggered
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "\"%s\" için İzleme Noktası tetiklendi %s. Eski değer \"%s\", Yeni Değer \"%s\""

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Öntanımlı düzeni kullan"

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Tüm ayarları sıfırla"

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Tüm cilt ayarlarını sıfırla"

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Tüm metin ayarlarını sıfırla"

#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Geçmiş noktası ekle"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "İçerik Menüsü"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "İçerik Menüsü (hata ayıklama)"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "İçerik Menüsü (sekme)"

#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
#, fuzzy
msgid "Jumps to implementation"
msgstr "Uygulamaya atlar"

#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
#, fuzzy
msgid "Jumps to implementation/other block end"
msgstr "Uygulamaya atlar / diğer blok sonuna"

#: lazarusidestrconsts.dlfmousesimplebuttonhistback
#, fuzzy
msgid "History back"
msgstr "Geçmiş geri"

#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Geçmiş İleri"

#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr "Ekstra kilidini aç / kapat"

#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Hiçbir şey / Varsayılan"

#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Yapıştır"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
#, fuzzy,badformat
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Devam et %0:s (% 1: s bağlantılı)"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr "Devam et %0:s"

#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Metni seçin"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Metni seçin (satırlar)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Metni seçin (jetonlar)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Metni seçin (kelimeler)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Metni seçin (Sütun modu)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Metni seçin (Hat modu)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Serbest yer imi ayarla"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Geçerli Satırı Seç (Tam)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Geçerli Satırı Seç (Metin)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Geçerli Paragraf Seç"

#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Geçerli Kelimeyi Seç"

#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Yakınlaştırmayı sıfırla"

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Bu sayfa geçerli ayarlarınızı temsil etmiyor. Gelişmiş sayfaya bakın"

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Genel"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Standart, Tüm eylemler (kesme noktası, katlama) fareyle aşağıya doğru"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Genişletilmiş, Eylemler (kesme noktası, katlama) fareyle yukarı doğru fare üzerinde aşağıya doğru seçim ve taşıma"

#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr "Genişletilmiş, Eylemler, sağ cilt payı f sadece yarım"

#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr "Satırları seçmek için satır sayısını kullanın"

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Cilt Payı"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
#, fuzzy
#| msgid "Right mouse includes caret move"
msgid "Right button click includes caret move"
msgstr "Sağ fare hareketi içerir"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Metin"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl Düğmesi"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl Tekerleği"

#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt Düğme"

#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt Tekerlek"

#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl Düğmesi"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Ctrl Tekerlek"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Seçimi sürükleyin (kopyala / yapıştır)"

#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Ekstra-1 Düğmesi"

#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Ekstra 2 Düğme"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt Çift"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl Çift"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Çift"

#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Shift Çift"

#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Dörtlü"

#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Üçlü"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Orta Düğme"

#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Orta"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Ekstra 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Ekstra 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Sol 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Sol 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Sağ"

#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Tekerlek"

#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Sağ Düğme"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Shift-Alt-Ctrl Düğmesi"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Shift-Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "ÜstKrkt-Alt Düğmesi"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "ÜstKrkt-Alt Tekerlek"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Shift-Ctrl Düğmesi"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Üst Karakter-Ctrl Tekerleği"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Üst Karakter Düğmesi"

#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Tekerlek"

#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Vites Tekerleği"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Kaydedilmemiş değişiklikleriniz var. Bu sayfayı kullanmak, gelişmiş sayfada yapılan değişiklikleri geri alacaktır"

#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Yatay kaydır\" (Sistem hızı)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Yatay kaydır\" (Tek satır)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Yatay kaydır (Sayfa)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Yatay kaydır (yarım sayfa)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Yatay kaydır (Sayfa, daha az bir satır)"

#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Hiçbir şey / Varsayılan"

#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Kaydırma (Sistem hızı)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Kaydır (Tek satır)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Kaydırma (Sayfa)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Kaydırma (Yarım sayfa)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Kaydırma (Sayfa, daha az bir satır)"

#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Yakınlaştırma"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "<Hiçbiri>"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Sadece oku"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Küçük harf, ilk harf yukarı"

#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr "aktif"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Atama işleci ekle: ="

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Parantezler vurgulamaktadır"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Kod katlama ağacı"

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Varsayılan Metin"

#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Devre dışı bırakılmış kesme noktası"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Etkin kesme noktası"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Hata satırı"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Uygulama noktası"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Katlanmış kod işaretleyici"

#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Küresel"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Cilt Payı"

#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "Ifdef"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Hat"

#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Senkron Düzenle"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Şablon Düzenle"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Metin"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Cilt Payı Ayırıcı"

#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Artımlı diğerleri"

#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Geçerli kelimeyi vurgula"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Artımlı arama"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Geçersiz kesme noktası"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Geçerli satır vurgulama"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Satır numarası"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Değiştirilmiş satır"

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Fare bağlantısı"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
msgid "Level 10"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
msgid "Level  1"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
msgid "Level  2"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
msgid "Level  3"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
msgid "Level  4"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
msgid "Level  5"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
msgid "Level  6"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
msgid "Level  7"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
msgid "Level  8"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
msgid "Level  9"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Seçilen Alan"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Aktif Hücre"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Diğer Hücreler"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Senkronize Hücreler"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Aktif Hücre"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Diğer Hücreler"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Senkronize Hücreler"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Metin bloğu"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Bilinmeyen kesme noktası"

#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Kelime-Parantezler"

#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Görselleştirilen Özel Kare"

#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr ""

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Noktalı virgül ekleyin"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Önündeki yorum nedeniyle üst çizgiyi ayarla"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabetik"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
#, fuzzy
#| msgid "Always visible cursor"
msgid "Always keep caret in visible area of editor"
msgstr "Her zaman görünür imleç"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Belirsiz dosya eylemi:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Derleme uyarısı"

#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr "Bir mesajın önünde hata / uyarı / ipucu için bir simge gösteriliyor, aynı simge kaynak düzenlemede cilt payında da gösteriliyor."

#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr "Ansi (* *)"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Uygulama ayarları"

#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "İddia kodu ekle"

#: lazarusidestrconsts.dlgassociateddebugdesktop
msgid "Associated debug desktop"
msgstr ""

#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr ""

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Formları otomatik oluştur:"

#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr "Ana .lpr birimi, her formu Application.CreateForm () ile oluşturur ve otomatik olarak serbest bırakılır."

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "Auto-create new forms"
msgstr "Otomatik oluştur yeni formlar"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Dosyayı otomatik sil"

#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Otomatik Görüntü İşlev Prototipleri"

#: lazarusidestrconsts.dlgautohidecursor
#, fuzzy
#| msgid "Hide mouse when typing"
msgid "Hide mouse pointer when typing"
msgstr "Yazarken fareyi gizle"

#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Otomatik girinti"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Akıllı girinti oluştur)"

#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Otomatik girinti"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Boş yöntemleri otomatik olarak kaldır"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Otomatik olarak küçük harfleri yeniden adlandır"

#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr "Aktif masaüstünü otomatik kaydet"

#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end\n"
msgstr ""

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Kullanılabilir formlar:"

#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr "Bu formlar program kodunda yaratılmalı ve serbest bırakılmalıdır."

#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr ""

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Arka fon"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(Alt dizin yok)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Aynı ad (alt dizinde)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Yöntemlerin arkasında"

#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Seçim"

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr "Girintiyi engelle (boşluklar)"

#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Girintiyi engelle"

#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(Düzenleme tuşları)"

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Alan / sekme prev satırı"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Yalnızca pozisyon"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Spaces"

#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "Sekmeler, kesildi"

#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Sekmeler, daha sonra boşluklar"

#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Girintiyi engelle (sekmeler)"

#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgstr "Çapa düzenleyicisinde kenarlık alanı ayarlanabilir. Aralıkta> 0 ise kırmızı bir çizgi gösterilir."

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Bracket highlight"

#: lazarusidestrconsts.dlgbracketmatchgroup
#, fuzzy
#| msgid "Matching bracket pairs"
msgid "Matching bracket and quote pairs"
msgstr "Eşleşen ayraç çiftleri"

#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr "Yerleştirilmiş masaüstünü kenetlenmemiş ortamda kullanamazsınız, tersi durumda."

#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Multi/2nd (NotXor)"
msgstr ""

#: lazarusidestrconsts.dlgcaretcolor
#, fuzzy
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret"
msgstr "Düzeltme işareti"

#: lazarusidestrconsts.dlgcaretforecolor
msgid "Color (NotXor)"
msgstr ""

#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr ""

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Harfe duyarlı"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Derleyici seçeneklerini kontrol etme"

#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr "artık dosya bulundu: %s"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Sonuçlar"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Ölçek"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test: Derleyici denetleniyor ..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test: derleyici yapılandırmasını denetleme ..."

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Sınama: Derleyici tarihini denetleme ..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Sınama: boş bir dosyayı derleme ..."

#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr ""

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test: fpc ppu arama yollarındaki kaynakları kontrol et ..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test: boş bir dosyayı derleme"

#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr "yapılandırma dosyası %s kullanılarak"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Sınıfsal düzen"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Son"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "küçük"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Önizleme (maks. Satır uzunluğu = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Okunan önek"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Saklanan sonek"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "BÜYÜK"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Değişken önek"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Yazma öneki"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Farklı Kaydet - otomatik olarak Pascal dosyalarını küçük harflerle yeniden adlandır"

#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Dosyaları Kontrol Et ve Otomatik Kaydet"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Formları paket üzerinde kontrol edin"

#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr "Formun çalışması için bir paket gerekebilir, böyle bir paketi otomatik olarak yükleyin."

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Kod şablon dosyası (* .dci) seç"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Not defterinde yakın düğmeleri göster"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Renk uyumu"

#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "C stili makrolar (global)"

#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Ansistrings kullanın"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Assembler stili"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Mesajlar"

#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Çekler ve iddia"

#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Derleyici Komutları"

#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "C stil operatörleri (* =, + =, / = ve - =)"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Makefile Yarat"

#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Hata Ayıklama"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Hata ayıklayıcı yolunun eklenmesi (yok):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Kod Yaratma"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Her ikisi de"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Kat"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Saklamak"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Açılır pencerede katlama sırasını tersine çevir"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "GDB için hata ayıklama bilgisi üret (yavaş / exe-boyutu artar)"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Heaptrc birimini kullanın (mem-leak'leri kontrol edin)"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Dosyaları ekle (-Fi):"

#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr "GDB için Bilgi"

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Kütüphaneler (-Fl):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Bağlama"

#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Derleyici seçenekleri bir XML dosyasına kaydedilebilir."

#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Renk"

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Renk Düzenle)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Değiştirilmedi"

#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Renkler"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Komut satırı parametreleri (uygulama adı olmadan)"

#: lazarusidestrconsts.dlgcommentalignmaxdefault
#, fuzzy
#| msgid "Make default indent for new line if comment opens at column:"
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr "Yorum, sütunda açılırsa yeni satıra varsayılan girinti yapın:"

#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Girintiyi sınırla"

#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Linebreak'de önek yorumları"

#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Geçerli satırı eşleştir"

#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "\" \\ \"* \" de dahil olmak üzere metin eşleme \\ \"(* \""

#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "Bütün satırla eşleş"

#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr "Metin token \" %s \\ \"den sonra\" ile eşleşme"

#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr "Simge \" %s \\ \"dahil olmak üzere metin eşleme"

#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Yeni satırı önekle"

#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Bir önceki satırın girintisine Hizala Önek"

#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "İlk yorum satırında yorum başlangıcının altındaki Öneki Hizala"

#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "Önek girinti yapmayın"

#: lazarusidestrconsts.dlgcommentindentgroupoptions
#, fuzzy
#| msgid "Comments"
msgid "Comments and Strings"
msgstr "Yorumlar"

#: lazarusidestrconsts.dlgcommentshlashextendalways
#, fuzzy
#| msgid "Extend, if matched or not matched"
msgid "Extend if matched or not matched"
msgstr "Eşleştirilirse veya eşleştirilmemişse uzat"

#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
#, fuzzy
#| msgid "Extend, if matched or not matched (not at EOL)"
msgid "Extend if matched or not matched (not at EOL)"
msgstr "Eşleştirilirse veya eşleştirilmemişse (EOL'de değil) genişlesin"

#: lazarusidestrconsts.dlgcommentshlashextendmatch
#, fuzzy
#| msgid "Extend, if matched"
msgid "Extend if matched"
msgstr "Eşleştirilirse uzat"

#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
#, fuzzy
#| msgid "Extend, if matched and caret in the middle of text (not at EOL)"
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr "Metnin ortasında eşleştirilirse ve metnin ortasına getirilirse (EOL'de değil) genişlesin"

#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Derleme ve Bağlama"

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Derleyici mesajları"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "Derleyici ileti dili dosyası (* .msg)"

#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Derleyici Seçenekleri"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Komple özellikleri"

#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr "Önce fare imleci altındaki bileşen seçildiğinde açılır menü komutları üzerinde çalışıyor."

#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Yapılandırma ve Hedef"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Config dosyaları"

#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Diğer hata ayıklama bilgileri"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Taşma"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Ayrıştırma"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Katlama bilgileriyle birlikte kopyala / yapıştır"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
#, fuzzy
#| msgid "Copy word on copy none"
msgid "Copy current word when no selection exists"
msgstr "Kopyalama yokken kopya yok"

#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Menzil"

#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Taşınabilir"

#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Derleyici seçeneklerini varsayılan olarak ayarla"

#: lazarusidestrconsts.dlgcoshowerr
msgid "Show errors"
msgstr "Hataları göster"

#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "& Show Seçenekleri"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Akıllı bağlanabilir"

#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Diğer kaynaklar (.pp / .pas dosyaları, yalnızca IDE tarafından derleyici değil)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Yığın"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Çalıştırılabilir simgeleri şeritten çıkarma"

#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Hata ayıklama bilgisi türü"

#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Otomatik"

#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr "Dwarf2"

#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr "Setlerle cüce"

#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr "Cüce3 (beta)"

#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Stabs"

#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Çöp kutusu değişkenleri"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Birim tarzı"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Valgrind için kod üret"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Ayrıntı"

#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "C ++ styled INLINE"

#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr ""

#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "Sekmedeki Ctrl-orta tıklama tüm diğerlerini kapatır"

#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Kıvırcık { }"

#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr "Msgstr \"Şu anda mesaj penceresinde saygın, atlama geçmişi ve arama sonuçları."

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "İmleç EOL'nin ötesinde"

#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr ""

#: lazarusidestrconsts.dlgcursorskipsselection
#, fuzzy
#| msgid "Cursor skips selection"
msgid "Caret skips selection"
msgstr "İmleç seçim atlar"

#: lazarusidestrconsts.dlgcursorskipstab
#, fuzzy
#| msgid "Cursor skips tabs"
msgid "Caret skips tabs"
msgstr "Imleç sekmeleri atlar"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Kullanıcı tanımlı uzantısı (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr "debug"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Yol Editörü"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Hata ayıklayıcı türü ve yolu"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Varsayılan düzenleyici fontu"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Varsayılan değer"

#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr ""

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Şablonu sil "

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Düğmeler - "

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "İpuçları"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menüler - "

#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr "Masaüstü adı"

#: lazarusidestrconsts.dlgdesktopsexported
#, fuzzy,badformat
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr "% D masaüstü (ler) \" %s \\ \"e başarıyla ihraç edildi"

#: lazarusidestrconsts.dlgdesktopsimported
#, fuzzy,badformat
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr "% D masaüstü (ler) \" %s \\ \"den başarıyla içe aktarıldı."

#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr ""

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Yön"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Kenar yumuşatmayı devre dışı bırak"

#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr "Izgara noktaları arasındaki mesafe, bir denetimi taşırken en küçük adımdır."

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Sağ kenar boşluğu rengini kullan"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Bölücü seviyesini çiz"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "İç içe çizgi rengi"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Çizgi rengi"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "/ End Başlat"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Prosedür / İşlev"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Sınıf / Struct"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Sınıf / Yapı (yerel)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Hariç / deneyin"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Birim bölümleri"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Kullanım maddesi"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var / Tür"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var / tür (yerel)"

#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr "Bileşenin adını altına çizin."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Geri"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Kalın"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Alt dizin"

#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Kod Şablonları"

#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Pascal blokları için açık bildiri ekleyin"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Kullanıcı tanımlı uzantı"

#: lazarusidestrconsts.dlgeddelayinsec
#, fuzzy,badformat
msgid "(%s sec delay)"
msgstr "(% S sn gecikme)"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Ekran"

#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Editör Dosyaları"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Tanımlayıcı tamamlama"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Ters çevir"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Kilitleri yoksay, kullanılmayan en uzun editörü kullan"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Editör güncelse, Kilitleri yoksay"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Geçerli pencerede düzenleyici varsa, Kilitleri yoksay"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Kilitli, eğer metin görünüyorsa"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Kilitli"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Kilitli, eğer merkezlenmiş görünümde metin"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Yeni sekme, varolan veya yeni pencere"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Yeni pencerede yeni sekme"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Mevcut pencerede yeni sekme"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Bu seçenek, kilitli ve / veya kaydırma gerektirse bile dosya için kullanılmayan en uzun düzenleyiciyi kullanır. Kullanılmayan en uzun editörün belirlenmesi, \"aynı kriter düzeni\" ayarı tarafından ayarlanmış olsa bile, pencerelerin odaklandığı sıraya bakmaz. Bu seçenek her zaman başarılı olacak, başka seçenekler test edilmeyecektir."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Bu seçenek, geçerli etkin düzenleyicinin hedef dosyaya sahip olup olmadığını ve eğer öyleyse, onu kullanacaklarını kontrol edecek."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Bu seçenek, geçerli pencerede hedef dosya için bir düzenleyici olup olmadığını kontrol eder ve eğer varsa, kilitli ve / veya kaydırma gerektirse bile bu düzenleyiciyi kullanacaktır."

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
#, fuzzy
#| msgid "This option will use a locked (and only a locked) Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "\" \"Bu seçenek, kaydırmak için (ve sadece kilitli) bir Editör kullanır, bu da Düzen içinde kaydırılması gerekme"

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Bu seçenek kilitli herhangi bir editörü kullanmaz."

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
#, fuzzy
#| msgid "This option will use a not locked Editor, which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "\" \"Bu seçenek, kilitli olmayan bir Editör kullanır; bu da, ekranı kaydırmak zorunda kalmaz"

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
#, fuzzy
#| msgid "This option will open a new Tab in an existing or new Window, if no unlocked tab is found. This option will always succeed, further options are never tested."
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "\" \"Bu seçenek varolan veya yeni bir Pencerede kilitli olmayan bir sekme bulunmaması durumunda yeni bir Sekme açar"

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Kilitli olmayan bir sekme bulunmazsa, bu seçenek yeni bir Pencerede yeni bir Sekme açacaktır (diğe"

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
#, fuzzy
#| msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if a window exists, that has not yet an editor for the target file."
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr "Kilitlenmemiş bir sekme bulunmazsa, bu seçenek mevcut bir (ve yalnızc"

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "İtalik"

#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Editör font boyutu"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Editör seçenekleri"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Şema globals"

#: lazarusidestrconsts.dlgedmisc
#, fuzzy
#| msgid "Misc"
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Çeşitli"

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Kapalı"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Açık"

#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Sekme ve Girinti"

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Altını çizmek"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Öğe Öznitelikleri"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Sonlandırma tuşu en yakın noktaya atlar"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Sor"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Notlar: Proje dosyaları, proje dizinindeki tüm dosyalardır"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Yedek"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Dosyalar"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Izgara"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Dil"

#: lazarusidestrconsts.dlgenvlanguagehint
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
msgstr "Tüm IDE dizelerinin dili, en iyi sonuç için değiştikten sonra IDE'yi yeniden başlatın."

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Kılavuz çizgiler"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Çeşitli"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Yok"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Diğer dosyalar"

#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Projenin sekmeleri"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tür"

#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr ""

#: lazarusidestrconsts.dlgextracharspacing
#, fuzzy
#| msgid "Extra char spacing"
msgid "Extra character spacing"
msgstr "Ekstra karakter aralığı"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Ekstra satır aralığı"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Harici gdb hata ayıklama simgeleri dosyası kullanın"

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Dosya uzantıları"

#: lazarusidestrconsts.dlgfiles
#, fuzzy,badformat
msgid "%s files"
msgstr "% S dosyası"

#: lazarusidestrconsts.dlgfilterall
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Tüm dosyalar"

#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr "CodeTools şablon dosyası"

#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr "DCI dosyası"

#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr "Delphi formu"

#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Delphi paketi"

#: lazarusidestrconsts.dlgfilterdelphiproject
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Delphi projesi"

#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Delphi birimi"

#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr "Çalıştırılabilir"

#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr "FPC mesaj dosyası"

#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr "HTML dosyaları"

#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr "Bitmap görüntüleri"

#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr "Pixmap görüntüleri"

#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr "PNG resimleri"

#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Lazarus Masaüstü Ayarları"

#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "Editör dosya türleri"

#: lazarusidestrconsts.dlgfilterlazarusfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Lazarus dosyası"

#: lazarusidestrconsts.dlgfilterlazarusform
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Lazarus formu"

#: lazarusidestrconsts.dlgfilterlazarusinclude
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Lazarus dosya ekle"

#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Lazarus diğer dosya"

#: lazarusidestrconsts.dlgfilterlazaruspackage
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Lazarus paketi"

#: lazarusidestrconsts.dlgfilterlazarusproject
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Lazarus projesi"

#: lazarusidestrconsts.dlgfilterlazarusprojectsource
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Lazarus proje kaynağı"

#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr "Lazarus oturumu"

#: lazarusidestrconsts.dlgfilterlazarusunit
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Lazarus birimi"

#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "Pascal dosyası"

#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Programlar"

#: lazarusidestrconsts.dlgfilterxml
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "XML dosyaları"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "İmleçte metin bulun"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Dobiş"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Süt bölümü"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Yorum Yap"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Düğüm"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Öğe"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Liste <>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Nesne (devralınan, satıriçi)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var / tür (yerel)"

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Yorum Yap (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin / End (iç içe geçmiş)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Yorum Yap { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Durum"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Sınıf / Nesne"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "genel / özel"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Hariç / Nihayet"

#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$ Ifdef}"

#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "Eğer / Sonra / Else"

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "İç içe Yorum"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Başlama / Bitirme (prosedür)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Prosedür"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Kayıt"

#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Tekrar et"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Yorum Yap //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Deneyin"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Birim"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Birim bölümü"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{% Bölge}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Kullanımları"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var / Type (global)"

#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr ""

#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr ""

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Yorum Yap"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Düğüm"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "İşleme Yönergesi"

#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr ""

#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr ""

#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr "Çalışan Lazarus örneği herhangi bir dosyayı kabul edemez."

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Ön plan"

#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr ""

#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr ""

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Prosedür ekleme politikası"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Usullerin düzenini sürdürün"

#: lazarusidestrconsts.dlgfpcexecutable
#, fuzzy,badformat
msgid "Compiler executable (e.g. %s)"
msgstr "Derleyici yürütülebilir (ör.% S)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "FPC kaynak dizini"

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Metin işareti"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Form Editörü"

#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "Başlangıçtan itibaren"

#: lazarusidestrconsts.dlgfromcursor
msgid "&From cursor"
msgstr "& İmleçten"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "& Küresel"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Gprof için kod üret"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Kepçe rengi"

#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr ""

#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr "Gri tonlamalı masaüstü bilgisayarları kurtarma ortamı içindir."

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Izgara rengi"

#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr "Izgara, kontrolleri hizalamaya yardımcı olan küçük noktalardan oluşur."

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Izgara ebadı X"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Yatay kılavuz adım boyutu"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Izgara ebadı Y"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Dikey grid adımı boyutu"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Kod Explorer"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Debugger"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editör"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Çevre"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Grup Geri Al"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Kılavuz Çizgileri Göster"

#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr "Bir denetim başka denetimlerle yatay veya dikey olarak hizalandığında, mavi bir kılavuz çizgisi görünür."

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Cilt Payı"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Çöktü"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Cilt Payı Boyası"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Gutter Edge Color"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Cilt  ayırıcı indeksi"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Yarım sayfa kaydırma"

#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Yığın ve yığın boyutları"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Öbek boyutu"

#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr "Şebekedeki bir mülkün yüksekliği."

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Yükseklik:"

#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Çalıştırıldığında IDE pencerelerini gizle"

#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr "Program çalışırken IDE 'yi hiç gösterme."

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Tek sayfa pencerelerindeki sekmeyi gizle"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Vurgulama Rengi"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Yazı tipi rengini vurgula"

#: lazarusidestrconsts.dlghighlightleftofcursor
#, fuzzy
#| msgid "Left Of Cursor"
msgid "Left Of Caret"
msgstr "İmlecin Solu"

#: lazarusidestrconsts.dlghighlightrightofcursor
#, fuzzy
#| msgid "Right Of Cursor"
msgid "Right Of Caret"
msgstr "İmleç Sağ"

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Parametre için ipuçlarını göster \" Gönderen \\ \"kullanılmıyor"

#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Kullanılmayan birimler için ana ipuçlarını göster"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Ev anahtarı en yakın başlangıç âânoktasına atlar"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Ana bilgisayar uygulaması"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Tanımlayıcı Tamamlama"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Tanımlayıcı politikası"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "IDE Seçenekleri"

#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "Aktif $ IFDEF kodu"

#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "Etkin değil $ IFDEF kodu"

#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "Karma durum $ IFDEF kodu dahil"

#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Aktif $ IFDEF düğümü"

#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Etkin değil $ IFDEF düğümü"

#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "Karma durum $ IFDEF düğümü dahil"

#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:\n"
msgstr ""

#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr ""

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Sistem değişkenlerini dahil et"

#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr ""

#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr ""

#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr ""

#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr ""

#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr "Girinti"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr "Sekmeler"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Yöntemlerin önünde"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Yapıcı adı 'init' olmalıdır (yıkıcı 'yapılmalıdır')"

#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Sınıf parçaları takın"

#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Uygulama"

#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Arayüz"

#: lazarusidestrconsts.dlginsertmethods
#, fuzzy
#| msgid "Insert methods"
msgid "Insert method implementations"
msgstr "Insert yöntemleri"

#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Kullanımlara Ekle bölümüne"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Sonra boşluk ekle"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Alanı önüne ekle"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Saniye Aralığı"

#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr ""

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Atlama (ör. Yöntem Atlama)"

#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr ""

#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr ""

#: lazarusidestrconsts.dlgkeepcursorx
#, fuzzy
#| msgid "Keep cursor X position"
msgid "Keep caret X position when navigating up/down"
msgstr "İmleci X konumunda tut"

#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Düzenle Anahtarı)"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Anahtar Eşlemeleri"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Anahtar eşleme hataları"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Anahtar kelime politikası"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "LABEL ve GOTO'ya izin ver"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Dil"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Son (yani kaynağın sonunda)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Lazarus dizini (tüm projeler için varsayılan)"

#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Kılavuz Çizgiler Sol, Üst"

#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly)"
msgstr "1 (hızlı, hata ayıklayıcı dostu)"

#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (-O1 + hızlı optimizasyonlar)"

#: lazarusidestrconsts.dlglevel3opt
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (-O2 + yavaş optimizasyonlar)"

#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr "4 (-O3 + agresif optimizasyonlar, dikkatli olun)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization)"
msgstr "0 (optimizasyon yok)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Hat Bölme"

#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Akıllı bağlantı"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Çalışma zamanı hatası izleri satır numaraları göster"

#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Ana menü"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Proje Formlarını Görüntüle"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Proje Çerçevelerini Görüntüle"

#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Proje Birimlerini Görüntüle"

#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "\" Yapılabilir \\ \"yürütülebilir"

#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr "Masaüstlerini yönet"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Kenar boşluğu ve cilt payı"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "İşaretçi rengi"

#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr ""

#: lazarusidestrconsts.dlgmarkupgroup
#, fuzzy
#| msgid "Highlight of Word under Caret"
msgid "Highlight all occurrences of Word under Caret"
msgstr "Caret'in Altındaki Sözcüklerin Vurgulanıyor"

#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr ""

#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr ""

#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Kullanıcı tanımlı biçimlendirme"

#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Sil"

#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr "Listeyi sil \" %s \\ \"?"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr "Kelime veya Dönem Ekle"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr "Kelimeyi veya Terimi Kaldır"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr "Sözcük veya Vesikalık Toggle"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Yinelenen Dönem"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "%s terimi zaten mevcut. Liste kaydedildiğinde kopyalar kaldırılacak."

#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Tüm editörlerde Ekle / Kaldır"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Listeyi sil"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Ad"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Liste ekle"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Harfe duyarlı"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Dönem sonunda bağlı ayarla"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Dönem başında bağla set"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Sınırları uzun süreler için yoksay"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "seçim"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "geçerli kelime"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Anahtar tarafından eklenen terimlerin ayarları"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "Akıllı eşleşme seçimi sınırlar"

#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Yeni liste"

#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "Liste yok"

#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Seç ..."

#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr "Anahtar Ayarları"

#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Ana ayarlar"

#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordfulllen
#, fuzzy
#| msgid "Match word boundaries for words up to this length:"
msgid "Match whole words, if length is less or equal to:"
msgstr "Bu uzunluğa kadar kelimelerin kelime sınırlarını eşleştirin:"

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Anahtar kelimeleri yoksay"

#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable timer for markup current word"
msgstr "Geçerli kelimeyi biçimlendirmek için zamanlayıcıyı devre dışı bırak"

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Trim boşlukları (geçerli seçimi vurgularken)"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maksimum sayaç"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Maks. Satır uzunluğu:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Son güncellenen dosyalar"

#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr ""

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maksimum yeni proje dosyaları"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Karışım yöntemleri ve özellikleri"

#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr ""

#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Fare Hareketi"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Tek"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Çift"

#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Üçlü"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Dörtlü"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Herhangi biri"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Ekstra 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Ekstra 2"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Ayrıldı"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Orta"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Make fallback"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Sağ"

#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Tekerlek indir"

#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Tekerlek yukarı"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Ele geçirmek"

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Taşı Caret (ekstra)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Fareyi yukarı kaldırma yasası"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Aksiyon"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Click"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Fare Düzenle"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Yinelenen Giriş"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Bu giriş mevcut bir girişle çakışıyor"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Düğme"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr "Düzeltme işareti"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Bağlam"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Click"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Aksiyon"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Yukarı aşağı"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Seçenek"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Sipariş"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Öncelikli"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Fare"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "İleri"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "IDE-Komut"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"

#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Herşey"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Cilt Payı"

#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr "Satır Değişiklikleri"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Kat Ağacı"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Daraltılmış [+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Genişletilmiş [-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr ""

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Çizgi Numaraları"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Metin"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Seçim"

#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Opt"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Aynı düğmeyi kullanan diğer eylemler"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Değiştirici Tuşlar, Sonbahar ayarları, Tek / Çift, Yukarı / Aşağılara bağlı olarak yürütülebilirler"

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtre Mod Anahtarları"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Öncelikli"

#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Mesajlar"

#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Hata ayıklama"

#: lazarusidestrconsts.dlgmsgwincolorurgenterror
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Hata"

#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr "Ölümcül"

#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "İpucu"

#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr "Önemli"

#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr "Normal"

#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr "Not"

#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr "Panik"

#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr "Zaman ve istatistikler"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr "Ayrıntılı"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr "Verbose 2"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr "Verbose 3"

#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Uyarı"

#: lazarusidestrconsts.dlgmulticaretcolumnmode
#, fuzzy
#| msgid "Multi-caret (column-select) move with cursor"
msgid "Navigation keys move all carets (column-select)"
msgstr "Çoklu liste (sütun seçimi) imleci hareket ettir"

#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr ""

#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr ""

#: lazarusidestrconsts.dlgmulticaretmode
#, fuzzy
#| msgid "Multi-caret move with cursor"
msgid "Navigation keys move all carets"
msgstr "İmleçle birlikte çok satırlı hareket"

#: lazarusidestrconsts.dlgmulticaretoncolumnselection
#, fuzzy
#| msgid "Enable multi caret for column selection"
msgid "Enable multi-caret for column selection"
msgstr "Sütun seçimi için çoklu dizge etkinleştir"

#: lazarusidestrconsts.dlgmultipleinstances
msgid "Multiple Lazarus instances"
msgstr "Birden çok Lazarus örneği"

#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr "Her zaman yeni bir örneği başlat"

#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr "Birden çok örneğe izin verme"

#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr "Çalışan bir dosyada dosyaları aç"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Çoklu seçim"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
#, fuzzy
#| msgid "Find Editor for Jump Targets"
msgid "Jump target priority between multiple editors"
msgstr "Atlama Hedefleri İçin Editör Bul"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Aynı kriterlere uyan editörler için kullanma emri"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Bu dosya için en son odaklanmış editör"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editör (dosya için) en son odaklanmış pencerede"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Bir düzenleyici seçmek için kriterlerin öncelik listesi:"

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Sayfalar ve Pencereler"

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Dizüstü Bilgisayar Sekmeleri"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Adlandırma"

#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr "Yeni masaüstü ..."

#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Otomatik yeniden adlandırma yok"

#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Eklenebilecek birim yok."

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Önemli Değil"

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Kaynak dizüstü bilgisayar sekmeleri konumu"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Sonra satır kırılmayın"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Satırın önüne bölme"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Nesne Müfettişi"

#: lazarusidestrconsts.dlgoiitemheight
#, fuzzy
#| msgid "Item height"
msgid "Item height (0 = auto)"
msgstr "Öğe yüksekliği"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Çeşitli"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Hız ayarları"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Varsayılan Delphi ayarlarını kullan"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Varsayılan Lazarus ayarlarını kullan"

#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Optimizasyon seviyeleri"

#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Diğer optimizasyonlar"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Diğer birim dosyaları (-Fu):"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Üstüne yaz blok"

#: lazarusidestrconsts.dlgoverwritedesktop
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?\n"
msgstr ""

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Bileşen paleti için İpuçları"

#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Varsayılan Pascal uzantısı"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Kontrol ifadelerini anahtar kelime olarak vurgulayın"

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr "Genişletilmiş Pascal Anahtar Kelime Seçenekleri"

#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr ""

#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Eşleşen Anahtar Kelimeler"

#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr ""

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Seçenekleri \" - k \\ \"ile bağlayıcıya aktar, sınırlayıcı alanı"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr "Vurgulama \" Diz \\ \"anahtar kelime (lar) \\"

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Varsayılan"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Yok"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Sadece \" Dizgi \\ \""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Kalıcı blok"

#: lazarusidestrconsts.dlgpersistentcursor
#, fuzzy
#| msgid "Persistent cursor"
msgid "Visible caret in unfocused editor"
msgstr "Kalıcı imleç"

#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr ""

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Uygulama"

#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "Invoker (asInvoker) olarak"

#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "& Simgeyi Sil"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Uygulama Paketini Oluşturun"

#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Yük ve Varsayılan"

#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr "DPI farkındalığı"

#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr "Kapalı"

#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr "Vista-8: kapalı, 8.1+: monitör başına"

#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr "Vista-8: açık, 8.1+: monitör başına"

#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr ""

#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr "Açık"

#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Yürütme Seviyesi"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formlar"

#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "Mevcut en yüksek (en yüksek kullanılabilir)"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "I18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Simge:"

#: lazarusidestrconsts.dlgpoicondesc
#, fuzzy,badformat
msgid "(size: %d:%d, bpp: %d)"
msgstr "(Boyut:% d:% d, bpp:% d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(Yok)"

#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "& Simge Yükle"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Çeşitli"

#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "Yönetici gerektirir (yönetici gerektir\""

#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Kaynaklar"

#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "& Simgeyi Kaydet"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Oturum, toplantı, celse"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Başlık:"

#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "Kullanıcı Arayüzü Erişimi (uiAccess)"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr "Çalıştırma ve hata ayıklama için Uygulama Paketini kullanın"

#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr ""

#: lazarusidestrconsts.dlgpousemanifest
#, fuzzy
#| msgid "Use manifest file to enable themes"
msgid "Use manifest resource (and enable themes)"
msgstr "Temaları etkinleştirmek için manifest dosyasını kullanın"

#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Tek tıklamayla çift tıklamayı tercih et"

#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Öncelikler"

#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Proje"

#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Proje Seçenekleri"

#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Proje Seçenekleri: %s"

#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Proje Dosyaları"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "& Yeniden sor"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Mülk tamamlanması"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Mülkiyet adı"

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project and packages at start"
msgstr "Başlangıçta son proje ve paketleri aç"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Kenar boşluğunu göster"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Izgara göster"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Izgaraya yapış"

#: lazarusidestrconsts.dlgreallydeletedesktop
msgid "Really delete desktop \"%s\"?"
msgstr "Masaüstünü gerçekten silmek \" %s \\ \"?"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referans"

#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "Düzenli ifadeler"

#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr "Masaüstünü yeniden adlandır"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Hepsini değiştir"

#: lazarusidestrconsts.dlgreplacewith
#, fuzzy
#| msgid "&Replace with"
msgid "Replace wit&h"
msgstr "&İle değiştirin"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Rapor"

#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Kılavuz çizgiler sağ, alt"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Sağ tıklama"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Sağ kenar"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Çalışma dizini"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Torunları seç"

#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Kauçuk Bant Yaratma"

#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Kauçuk bant seçimi"

#: lazarusidestrconsts.dlgrunninginstancemodalerror
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s\n"
msgstr ""

#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr "Lazarus örneği çalışıyor ancak yanıt vermiyor\""

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Görüntüleme (win32 için değil, ör. 198.112.45.11:0, x.org:1, hydra: 0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Çevre"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Yerel"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Sistem değişkenleri"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Görüntüyü kullan"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Kullanıcı geçersiz kılma"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Parametreleri Çalıştır"

#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr "Geçerli masaüstünü şu şekilde kaydet"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Kayıtlı satır"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Kapalı dosyalar için düzenleyici bilgilerini kaydet"

#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr "Dosyalar \" Geçmişi Aç \\ \"geçmiş listesinde mevcuttur."

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Editör bilgilerini yalnızca proje dosyaları için kaydet"

#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr "Sadece bu projeye ait dosyalar."

#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr ""

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Bir daha kaydırın"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Kaydırma"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Gezinme ipucu göster"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Dosyanın sonuna kaydır"

#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Caret past end of line"
msgid "Allow caret to move past end of line"
msgstr "Satır sonu pastası"

#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Ara dizin \" %s \\ \"bulunamadı."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Arama kullanıcı tarafından sonlandırıldı."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Arama ..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Yollar"

#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr "Arama kapsamı"

#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr "Tüm çocuk kontrollerini ebeveynleriyle birlikte seçin."

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "& Seçili metin"

#: lazarusidestrconsts.dlgsetactivedesktop
msgid "Set active"
msgstr "Etkin'i ayarla"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Tüm öğeleri varsayılana ayarla"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Öğe değerini varsayılana ayarla"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Set property Variable"

#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr "Varsayılan ayarlayıcı yordamın parametre adı."

#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr "Is öneki"

#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr "İşaretlenirse, \" Özellik Değişkenini Ayarla \\ \"önektir Aksi takdirde sabit bir ad olur."

#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr "Const kullan"

#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr "İşaretlenirse, ayarlayıcı parametresi \" sabit \\ \"ile işaretlenir."

#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Tüm birimleri göster"

#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
#, fuzzy
#| msgid "Show captions of non-visual components"
msgid "Show captions of nonvisual components"
msgstr "Görsel olmayan bileşenler başlıklar göster"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Derlenmiş işlemleri göster"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Satır numaralarını göster"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Şartları göster"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Hata ayıklama bilgilerini göster"

#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Tasarımcı ipuçlarını göster"

#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr "İpucu, taşınırken veya yeniden boyutlandırırken kontrolün konumunu veya boyutunu gösterir."

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Her şeyi göster"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Çalıştırılabilir bilgileri göster (yalnızca Win32)"

#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr ""

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Genel bilgiyi göster"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Kanal ipuçlarını göster"

#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Göster ipuçları"

#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr "Gösterilen Windows"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Satır numaralarını göster"

#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr "Mesajlar Simgelerini Göster"

#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Notları göster"

#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Özet göster"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Çalıştırılan dosyaları göster"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Kullanılmış dosyaları göster"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Uyarıları göster"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "TaskBar'da tek düğmeyi göster"

#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "İleri sınıf bildirimlerini atla"

#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Yırtmaç //"

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Akıllı sekmeler"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Arkasındaki simge (.pp ~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Sayaç (.pp; 1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Önündeki sembol (~ ~ pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Kılavuz Çizgilere Yapış"

#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr "Bir denetim başka bir denetimle hizalanmaya çok yakın olduğunda, hizalı konuma oturur."

#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr "Çok Satırlı Sekmeler"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Uzay"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Ana hızlı düğmeler için ipuçları (açık, kaydet ...)"

#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Kaynak Düzenleyici"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Köken"

#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Yığın boyutu"

#: lazarusidestrconsts.dlgstatickeyword
msgid "Static keyword in objects"
msgstr "Nesnelerdeki statik anahtar kelime"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Hatalar sayısından sonra durun:"

#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Kapat dizesine metin ekle"

#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Yeni satıra önek dize"

#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "Dize\" \""

#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Dizgileri satırbaşında uzat"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Alt özelliklerini"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Sözdizimi seçenekleri"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Sekme girintileri engeller"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Sekme numaralarını deftere göster"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Sekmeler arası"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Sekme genişlikleri"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Hedef CPU ailesi"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Hedeflenen İşletim Sistemi"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Hedef platform"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Hedef işlemci"

#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Hedefe özel seçenekler"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Test projeleri hazırlama rehberi"

#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr ""

#: lazarusidestrconsts.dlgtexttofind
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "Bulmak için & Metin"

#: lazarusidestrconsts.dlgtoggledebugdesktop
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
msgid "Toggle as debug desktop"
msgstr "Masaüstünde hata ayıklama ayarı olarak değiştir"

#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Geçerli Sınıf / Proc İpucu"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Trim spaces style"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Caret veya Düzenle"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Satır Düzenlendi"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Çizgiyi bırak"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Sadece Pozisyon"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Arka boşlukları süsleyin"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Kaydettikten sonra geri al"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Geri Al / Yinele"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Sınırı geri al"

#: lazarusidestrconsts.dlgunitdepcaption
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "Birim Bağımlılıkları"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Yenile"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Birim çıkış dizini (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Kaydedilmemiş satır"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Kod Katlama"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Ek derleyici yapılandırma dosyası kullanın"

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Bölücü Çizimi"

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Standart derleyici yapılandırma dosyasını (fpc.cfg) kullanın"

#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr ""

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Başlatma uygulaması kullan"

#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr "Sistem tarafından işlenen IME"

#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Kullanıcı düzeni dosyası %s yüklenemedi"

#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr "Genel şema ayarlarını kullan (ve düzenle)"

#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Yerel düzen ayarlarını kullan"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Sözdizimi vurgulamayı kullan"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Sekmeleri kapatırken sekme geçmişi kullanın"

#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Kullanım alanına birim ekle"

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Değer"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Derleme Sırasındaki Ayrıntılılık:"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Görünür "

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Görünür sağ kenar boşluğu"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "&Sadece butun kelimeler"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "En:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Win32 gui uygulaması"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Pencere"

#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "İstisnalar"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Kelimeler"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Önizleme"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "FPC logosu yaz"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Çok seçimli bileşenler tek bir formda olmalıdır."

#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Hizala ..."

#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Seçimi Sil"

#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Ayna Yatay"

#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Ayna Dikey"

#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "Geri Bir"

#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "Bir İleri"

#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Geri Taşı"

#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Öne Taşı"

#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Sıfırla ..."

#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Formu XML Olarak Kaydedin"

#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Ölçek ..."

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Ölçek"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Hepsini seç"

#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Boyut ..."

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Boyut"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opsiyon: Izgaraya yapış"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opsiyon: Kılavuz çizgilerine sabitler"

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-sırası"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "İki tarafta da"

#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr "Tüm görüntüleri temizle"

#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr "Görüntü anlık görüntüsünü veya güncelliğini değiştir"

#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr "Ekran alıntısı al"

#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr "Otomatik anlık görüntüleri açma / kapatma"

#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr "Seçilen girdiyi kaldır"

#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr "Geçmişi görüntüle"

#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr "Fotoğrafları Görüntüle"

#: lazarusidestrconsts.histdlgcolumnloc
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
msgid "Location"
msgstr "Yer"

#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr "Zaman"

#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr "Geçmiş"

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = hayır, 1 = yalnızca üst düzey için ayırıcı çizgiler çizin, 2 = ilk iki seviye için çizgiler çizin, ..."

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Dosya Ekle"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Belirsiz Ancestor Türü"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Belirsiz Sınıf Adı"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Belirsiz Birim Adı"

#: lazarusidestrconsts.lisa2pancestortype
#, fuzzy
#| msgid "Ancestor Type"
msgid "Ancestor type"
msgstr "Ancestor Type"

#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Bir Pascal biriminin uzantısı .pp veya .pas olmalıdır"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Kırık Bağımlılıklar"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Sınıf Adı Zaten Var"

#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Yeni Bileşen Oluştur"

#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create New File"
msgstr "Yeni Dosya Yarat"

#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr "Yeni Gereksinimi Yarat"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Bağımlılık"

#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr ""

#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: \"%s\""
msgstr "Varolan dosya: \" %s \\ \""

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Dosya zaten mevcut"

#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File \"%s\" already exists in the package."
msgstr "Pakette \" %s \\ \"dosyası zaten var."

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Dosya kullanılır"

#: lazarusidestrconsts.lisa2pfilename2
#, fuzzy
#| msgid "Filename"
msgid "Filename/URL"
msgstr "Dosya adı"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Dosya değil birim"

#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr ""

#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr ""

#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr ""

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Geçersiz Ata Türü"

#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Geçersiz Dairesel Bağımlılık"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Geçersiz Sınıf Adı"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Geçersiz dosya"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Geçersiz dosya adı"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Geçersiz Ünite Adı"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, fuzzy,badformat
msgid "\"%s\" is not a valid unit name."
msgstr "\"% S \\ \"geçerli bir birim adı değil."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Yeni sınıf adı:"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Yeni dosya"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, fuzzy,badformat
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Bağımlılık \" %s \\ \"için paket bulunamadı.% SLütfen mevcut bir paketi seçin."

#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr "Paket / Proje"

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Sayfa Adı çok uzun"

#: lazarusidestrconsts.lisa2ppalettepage
#, fuzzy
#| msgid "Palette Page:"
msgid "Palette page:"
msgstr "Palet Sayfası:"

#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Pascal birimlerinin uzantısı .pp veya .pas olmalıdır"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Dosya adını kısaltın veya genişletin"

#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Tümünü göster"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "\" \\ \" %s \" atası türü, %sthe unit \\ \" %s \" ile aynı adı taşıyor. "

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Ata türü \" %s \\ \"geçerli bir Pascal tanımlayıcı değil."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "Sınıf adı \" %s \\ \"ve ata türü \" %s \\ \"aynı."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "Sınıf adı \" %s \\ \"zaten %s içinde bulunuyor Paket %s %sFile: \" %s \\ \"\" "

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Sınıf adı \" %s \\ \", %sthe birim \" %s \\ \"ile aynı adı taşıyor."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "Sınıf adı \" %s \\ \"geçerli bir Pascal tanımlayıcı değil."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, fuzzy,badformat
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "\"% S \\ \"dosyası geçerli projenin bir parçası.% SProje arasında dosya paylaşmak kötü bir fikir"

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, fuzzy,badformat
#| msgid "The filename \"%s\" is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path."
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "\" \"\" %s \\ \"dosya adı belirsiz, çünkü paketin varsayılan dizini yok.% SPlease spec"

#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Maksimum Sürüm \" %s \\ \"geçersizdir.% SLütfen formunu kullanınız: major.minor.release.build %sSınav içi"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maksimum Sürüm, Minimim Sürümünden daha düşüktür."

#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Minimum Sürüm \" %s \\ \"geçersiz.% SÜzelik major.minor.release.build %sDeğişimi kullanı"

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Paket zaten \" %s \\ \"pakete bağımlı."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "Sayfa adı \" %s \\ \"çok uzun (en fazla 100 karakter)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, fuzzy,badformat
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "\"% S \\ \"birim adı zaten pakette mevcut: %s %s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname \"%s\" already exists in this package."
msgstr "\" \\ \" %s \" birim adı bu pakette zaten mevcut. "

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, fuzzy,badformat
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "Birim adı \" %s \\ \"% kum dosya adı \" %s \\ \"farklı."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, fuzzy,badformat
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "\" \"\" %s \\ \"birim adı kayıtlı bir bileşen ile aynıdır.% SBunu kullanmak garip hata m'ye neden olabili"

#: lazarusidestrconsts.lisa2punitname
#, fuzzy
#| msgid "Unit Name:"
msgid "Unit name:"
msgstr "Birim Adı:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Birim adı zaten var"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Değişikliklerin vazgeçilmesini mi?"

#: lazarusidestrconsts.lisabort
msgctxt "lazarusidestrconsts.lisabort"
msgid "Abort"
msgstr "İptal"

#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Hepsini reddet"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Tüm yüklemeyi iptal et"

#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Aborted"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Yükleme projesini iptal et"

#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Tüm yüklemeyi iptal et"

#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "Hakkında"

#: lazarusidestrconsts.lisabout2
#, fuzzy,badformat
msgid "About %s"
msgstr "Hakkında"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Belgeler:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "IDE Hakkında"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Lazarus Hakkında"

#: lazarusidestrconsts.lisaboutlazarusmsg
#, fuzzy,badformat
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Lisans: GPL / LGPL. Lisans detayları için Lazarus ve Free Pascal kaynaklarına bakın.% SLazarus"

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Katkıda bulunanların listesini bulamıyorum."

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Resmi:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, fuzzy
#| msgid "A %s cannot hold TControls.%sYou can only put non visual components on it."
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr " %s TControl'leri tutamıyor %sSadece görsel olmayan bileşenleri koyabilirsiniz."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Teşekkür"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Aksiyon:"

#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Eylemler:"

#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Etkinleştir"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Metin ve değiştirme için normal ifade sözdizimini etkinleştir (perl'e benzemektedir)"

#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Seçili Etkinle"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Aktif"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Aktif Filtre"

#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Eklemek"

#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr ""

#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr ""

#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Add Delphi7 simülasyonunu tanımlar"

#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Kod, desteklenen derleyici sürümlerini kontrol ettiğinde kullanışlıdır"

#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr "Pascal kaynağına eksik nesne \" %s \\ \"eklendi."

#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr "\" %s için \\ \" %s \" özelliği eklendi. "

#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr "Add -FcUTF8"

#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr "Kaynak dosyalarda ansistring olmayan harfler varsa, gerekli olabilir."

#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Filtre Ekle ..."

#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr "Toplama, geçerli iletiye uymuyor"

#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr "Toplama şu anki mesaja uyuyor"

#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr "Ekler"

#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "Anahtar kelime ekle \" do \\ \""

#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr ""

#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr ""

#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr ""

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Ayarları \" %s \\ \"den kopyalarken yeni yapı modu ekle"

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Yeni makro ekle"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Yeni küme ekle"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Paket gereksinimi ekle?"

#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "\" \"paket (ler) in kurulu paketlerin listesine eklenmesi (IDE'yi yeniden derlemek  için --build-ide ile birleşin)."

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Paketi projeye ekle"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Parametre parantezleri ekle"

#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr "Adres:"

#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr "& Adres kesme noktası ..."

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Ekle arama yoluna dahil mi?"

#: lazarusidestrconsts.lisaddtoproject
#, fuzzy,badformat
msgid "Add %s to project?"
msgstr "% S projeye ekle?"

#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr "Başlangıç ââbileşenlerine ekle?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Birim arama yoluna ekle?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Birim arabirimleri ekle"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Birim ekle (önerilmez)"

#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Makro %s için değer ekle"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Dosyayı Pakete Ekle"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Hedef paket"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Dosya tipi"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Geçersiz Paket"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: \"%s\""
msgstr "Geçersiz paket kimliği: \" %s \\ \""

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Paket salt okunur"

#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package \"%s\" not found."
msgstr "Paket \" %s \\ \"bulunamadı."

#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Tümünü göster"

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr " %s paketi salt okunur."

#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
#, fuzzy,badformat
msgid "A file \"%s\" already exists.%sReplace it?"
msgstr "\" \\ \" %s \" dosyası zaten var.% S Yeniden yerleştirilsin mi? "

#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
#, fuzzy,badformat
msgid "A filter with the name \"%s\" already exists."
msgstr "\"% S \\ \"adı olan bir filtre zaten var."

#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Temizledikten sonra (ortak dosyaların tümünü temizleyin veya temizleyin), otomatik olarak temizlemeye geçin"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Uyum"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Bütün bloklar iyi görünüyor."

#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Bütün yapı modları>"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Devralınan tüm seçenekler"

#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr "Tüm Seçenekler"

#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "İşlev Çağrılarına İzin Verme"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Birden fazla satırı aramaya izin ver"

#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Bu işlevin tüm parametreleri zaten bu çağrıda ayarlanmış"

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "\" %s \\ \" %swill dosyasındaki tüm değişiklikler kaybolacak ve dosya yeniden açıldı."

#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Alfa"

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Alternatif anahtar"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Alternatif anahtar (veya 2 anahtar sıralı)"

#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Her zaman"

#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Önerilen varsayılan dosya adını her zaman küçük harfe çevir"

#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "Seçili nesneleri daima odaklanmış olarak çiz"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Her zaman görmezden"

#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Bu ada sahip bir makro zaten var."

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Belirsiz dosya bulundu"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Belirsiz dosya bulundu: \" %s \\ \" %s Bu dosya \" %s \\ \"ile yanlış yapılabilir %s Belirsiz dosyayı silinsin mi?"

#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Belirsiz dosyalar bulundu"

#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous unit found"
msgstr "Belirsiz birim bulundu"

#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Alt tarafı, kardeşin alt tarafına tutturun ve mesafe ayarlamak için BorderSpacing kullanın"

#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Alt tarafı kardeşin üst tarafına tutturun. Tutulan mesafe hem BorderSpacing pr"

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Çapa Düzenleyici - hiçbir kontrol seçilmedi"

#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Enabled = Ankaralara %s dahil et"

#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Çapa, kardeşinin sol yanına sola doğru uzanır .BorderSpacing kullanarak mesafeyi ayarlayın"

#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Çapa kardeşin sağdan yanına sola baktı. Beklenen mesafe hem BorderSpacing pr"

#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Kardeşin sağ tarafını sola doğru çapa tutma mesafesi, hem BorderSpacing pr"

#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Kardeşin sağ tarafını çapraz bağlayın. Bir mesafe ayarlamak için BorderSpacing'i kullanın"

#: lazarusidestrconsts.lisanchorsof
msgid "Anchors of %s"
msgstr ""

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Seçilen kontrollerin çapaları"

#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Kardeşin üstten yanına çapraz tutun. Beklenen mesafe hem BorderSpacing pr"

#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Üst tarafı ile kardeşinin üst tarafına bağlayın.Bir mesafe ayarlamak için BorderSpacing kullanın"

#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
#, fuzzy,badformat
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "% S yüklenirken son başlatılışta bir hata oluştu!% SBu projeyi tekrar yükle?"

#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr ""

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "& Uygulama sınıfı adı"

#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Çapraz platform LCL kitaplığını GUI'si için kullanan grafiksel bir Free Pascal uygulaması."

#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Uygulamak"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "Yapı bayraklarını (-B) bağımlılıklara çok uygulayın"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Sözleşmeleri uygulayın"

#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr "Platform ve dosya türü için ad uzantısını ve karakter kılıfını ayarlayın."

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Bir proje birimi diğer paketler / projeler tarafından kullanılamaz"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Denetimin etrafındaki kenarlıklar. Diğer dört kenar boşlukları bu değere eklenir."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Bulunan her metni değiştirmeden önce isteyin"

#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Projenin oturumunu kaydetmeden önce isteyin"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr "Tasarımcı formuna koyduktan sonra bileşen adını isteyin."

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Yeni dosyada dosya adı sor"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Oluşturduğunuzda ad isteyin"

#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr "Windows sistemlerinde kullanışlı bir ayar: $ (LazarusDir) \\ mingw \\ bin \\ $ (Hedef CPU) - $ (TargetOS) \\ gdb"

#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr "IDE ana pencere yüksekliğini otomatik olarak ayarla"

#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr "Komple bileşen paletini göster"

#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr "Bileşen paleti daha fazla çizgiye yayılmışsa, hepsini göster, sadece bir tane değil."

#: lazarusidestrconsts.lisautocheckmodifiedfiles
msgid "Automatically check (select) modified files"
msgstr ""

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Otomatik tamamlama: kapalı"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Otomatik tamamlama: açık"

#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Sonradan otomatik devam et:"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "İşaretleme ve Maçlar"

#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Otomatik"

#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Otomatik olarak"

#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr ".lfm dosyalarını .lrs kaynak dosyalarına otomatik olarak dönüştür"

#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "Seçimi tamamlama"

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Sonradan otomatik olarak çağır"

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "satır sonu"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "Boşluk"

#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "Sekmesi"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "Kelime sonu"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "Karakter ekleme"

#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr "Otomatik olarak tek olası tanımlayıcı kullan"

#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Tamamlama ve İpuçları"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Otomatik göster"

#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Yükleme için kullanılabilir"

#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr "Kullanılabilir proje oluşturma modları:"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Değiştirilen dosyaların yedeklenmesi"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Yedek dosyası başarısız oldu"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Proje dizini altında bir yedek dizin oluşturur"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
#, fuzzy,badformat
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Paket adı ya da sürüm değiştirildiğinde bağımlılıklar kesilir.Bu bağımlılıklar"

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "Başlıyor"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "İlişkinin arkasında"

#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "be less verbose, can be given multiple times"
msgstr "Daha az ayrıntılı, birkaç kez verilebilir"

#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "be more verbose, can be given multiple times"
msgstr "Daha ayrıntılı olun, birden fazla kez verilebilir"

#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "En iyisi turbopoweriprodsgn gibi bir HTML denetimi yükleyerek görüldü"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Çalıştırmadan önce her zaman kurun"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Komut Kur"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Yapılandırma projesi yerine Build File komutu yerine"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Çalıştırma projesinde Çalıştır Dosya komut yerine"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Çalıştır Komutu"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Bu dosya kaynak düzenleyicide etkin olduğunda"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Çalışma dizini (dosya yolu için boş bırakın)"

#: lazarusidestrconsts.lisbinary
#, fuzzy
msgctxt "lazarusidestrconsts.lisbinary"
msgid "Binary"
msgstr "İkili"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Varsayılan olmayan kalın değerler"

#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Sınır alanı"

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Alt"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Alt kenar boşluk: Bu değer, taban sınırlarına eklenir ve devamın altındaki alan için kullanılır"

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Alttaki demirleme"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Bottoms"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent."
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Bu, alt tarafın sabitlendiği kardeş kontrolüdür, ebeveyn için boş bırakın."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Alt alan eşit"

#: lazarusidestrconsts.lisbpsdisabled
#, fuzzy
msgctxt "lazarusidestrconsts.lisbpsdisabled"
msgid "Disabled"
msgstr "Engelli"

#: lazarusidestrconsts.lisbpsenabled
#, fuzzy
msgctxt "lazarusidestrconsts.lisbpsenabled"
msgid "Enabled"
msgstr "Etkin"

#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Kırılma"

#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Kesme Noktası Özellikleri"

#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr ""

#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Eklemek"

#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Kapat"

#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "& Sil"

#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr "&Eklemek ..."

#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "& Değiştir ..."

#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "& Etkin"

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "& Find"

#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "& Çık"

#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Kaldır"

#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr ""

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "& Değiştir"

#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Derle"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "Proje / paket / IDE'nin tüm dosyalarını oluşturun"

#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Derle"

#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "IDE oluştur"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "Paketlerle IDE kur"

#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr "Yapı"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Lazarus'u derlemek başarısız oldu"

#: lazarusidestrconsts.lisbuildmode
msgid "Build Mode: %s"
msgstr "Yapı Modu: %s"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Yapı modları arasındaki farklar"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Diğer oluşturma modlarından farklar"

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Mod:"

#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr "Görev çubuğundaki başlık, örneğin şunu gösterir: project1.lpi - Release - Lazarus"

#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Yapı modları"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Yeni proje oluştur"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Yapı numarası"

#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Derle"

#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Meşgul"

#: lazarusidestrconsts.lisbyte
#, fuzzy,badformat
msgid "%s byte"
msgstr "% S baytı"

#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr " %s çağırarak Makefile %s oluşturulamadı."

#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr "Yığın değerlendirilmedi"

#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "İptal"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Bu bileşen yüklenmeyi iptal et"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Yükleme birimini iptal et"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Yeniden adlandırmayı iptal et"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Projeyi derleyemiyorum"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Üst düzey bileşeni kopyalayamıyorum."

#: lazarusidestrconsts.liscannotcreatefile
msgid "Cannot create file \"%s\""
msgstr "Dosya \" %s \\ \"oluşturulamıyor"

#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr ""

#: lazarusidestrconsts.liscannotexecute
#, fuzzy,badformat
msgid "cannot execute \"%s\""
msgstr "\"% S \\ \"\" \\ \\ n \"\" "

#: lazarusidestrconsts.liscannotfind
#, fuzzy,badformat
msgid "Cannot find %s"
msgstr "% S bulunamıyor"

#: lazarusidestrconsts.liscannotfindexecutable
msgid "cannot find executable \"%s\""
msgstr "Çalıştırılabilir \" %s \\ \"bulamıyor"

#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Lazarus başlatıcısı bulunamadı: %s %s"

#: lazarusidestrconsts.liscannotfindunit
msgid "Cannot find unit %s"
msgstr "Birim %s bulunamadı"

#: lazarusidestrconsts.liscannotopenform
msgid "Cannot open form \"%s\"."
msgstr ""

#: lazarusidestrconsts.liscannotsaveform
msgid "Cannot save form \"%s\"."
msgstr ""

#: lazarusidestrconsts.liscannotsubstitutemacros
msgid "Cannot substitute macro \"%s\"."
msgstr ""

#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "Hata ayıklama veya derleme yaparken derleyiciyi test edemiyorum."

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Sadece TComponent sınıfını değiştirebilirsin."

#: lazarusidestrconsts.liscantfindavalidppu
msgid "Can't find a valid %s.ppu"
msgstr "Geçerli bir %s.ppu bulunamadı"

#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "Dosyaları karşılaştırın (yamalar oluşturmak için değil)"

#: lazarusidestrconsts.liscbpfiles
#, fuzzy,badformat
msgid "%s (%s files)"
msgstr "% S ( %s dosyaları)"

#: lazarusidestrconsts.liscbpreallydeletesourcefiles
#, fuzzy,badformat
msgid "Really delete %s source files%s%s"
msgstr "% S kaynak dosyalarını gerçekten sildim %s %s"

#: lazarusidestrconsts.lisccdchangeclassof
#, fuzzy,badformat
msgid "Change Class of %s"
msgstr "% S sınıfını değiştir"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "ders yok"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Belirsiz derleyici"

#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Lütfen %sTools -> Seçenekler -> Dosyalar -> Yapı testi için Dizin altındaki Test dizini kontrol edi"

#: lazarusidestrconsts.lisccocompilernotanexe
#, fuzzy,badformat
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "\"% S \\ \"derleyici, yürütülebilir bir dosya değil %sDetails: %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "Içeriyor"

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Çıktıyı panoya kopyala"

#: lazarusidestrconsts.lisccodatesdiffer
#, fuzzy,badformat
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "FPC'nin .ppu dosyalarının tarihleri ââbir saatten fazla farklılık göstermektedir.% SBu, ik"

#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Hata"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "HATA: "

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "FPC birim yolu bir kaynak içeriyor:"

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "Yeni çizgi sembolleri"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "İpucu:"

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Geçersiz derleyici"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Geçersiz arama yolu"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Geçersiz Sınama Dizini"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Eksik birim"

#: lazarusidestrconsts.lisccomsgrtlunitnotfound
msgid "RTL unit not found: %s"
msgstr ""

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "Birden fazla derleyici yapılandırması bulundu:"

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "No fpc.cfg bulunamadı"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "Non ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "Ppu iki kere var: %s, %s"

#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Derleyici kendinden daha eski bir .ppu dosyası var: %s %s"

#: lazarusidestrconsts.lisccortlunitnotfounddetailed
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr ""

#: lazarusidestrconsts.lisccoseveralcompilers
#, fuzzy,badformat
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Yolunuzda birkaç Free Pascal Derleyicisi var.% S %s %s Eski bir comp'yi silmeyi unuttunuz"

#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Atla"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "özel karakterler"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Bütün testler başarıyla tamamlandı."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Test Dosyası Oluşturulamadı"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Test Pascal dosyası \" %s \\ \"oluşturulamadı."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "Olağandışı karakterler"

#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Uyarı"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "UYARI:"

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "Yanlış yol sınırlayıcı"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Kategoriler"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Karmaşıklık"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Sabitler"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Boş bloklar"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Boş sınıf bölümleri"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Boş yapılar"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Boş prosedürler"

#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(Filtre)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "İmleci takip et"

#: lazarusidestrconsts.liscein
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "% S, %s"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Kök kontrol"

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "\" \"Parametreler, \" çok \\ \""

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Uzun prosedürler"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "İşlemin satır sayısı\" \\ \"uzun \" \"olarak değerlendirild"

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Birçok yuvalanmış prosedür"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Birçok parametre"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Kategorileri Göster"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Kaynak düğümleri göster"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "İç içe geçmiş prosedürler \" çok \\ \""

#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Merkezi kayıp bir pencere"

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Verilen kardeşe göre yatay olarak merkez kontrolü .BorderSpacing göz ardı edilir."

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Verilen kardeşe göre dikey olarak merkez kontrolü .BorderSpacing göz ardı edilir."

#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Merkez Formu"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Pencerede merkezi"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Merkezi"

#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Tercih edilen sergi modu"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Kategori"

#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Kaynak"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Asla, yalnızca manuel"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Sadece kategori modunda kullanılır"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Boşta"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Otomatik olarak yenile"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Diğer"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Güncelleştirme"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Kaynak editörde dosya değiştirirken"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Prosedürler"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Özellikleri"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Varsayılan olmadan yayınlanmış özellikler"

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Gözlemleri göster"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Stil"

#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Çevresindeki"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Todos"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Türleri"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "İsimsiz sabitler"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Sıralanmamış üyeler"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Sıralanmamış görüntü"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Kullanımları"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Değişkenler"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Yanlış girinti"

#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
#, fuzzy,badformat
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "% S \" %s silinirken bir istisna oluştu: %s \\ \" %s %s"

#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr "Bu kaynağı yüklemeyi iptal et"

#: lazarusidestrconsts.liscfeclassnotfound
#, fuzzy,badformat
msgid "%s%sClass \"%s\" not found."
msgstr "% S %sClass \" %s \\ \"bulunamadı."

#: lazarusidestrconsts.liscfecomponent
#, fuzzy,badformat
msgid "%s%sComponent: %s:%s"
msgstr "% S %s Bileşeni: %s: %s"

#: lazarusidestrconsts.liscfecomponentclass
#, fuzzy,badformat
msgid "%s%sComponent Class: %s"
msgstr "% S %sComponent Sınıfı: %s"

#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr "Yüklemeye devam et"

#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Bu form düzenleme seçimini nasıl kopyalayacağımı bilmiyorum"

#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Bu form düzenleme seçimini kesme yöntemini bilmiyorum"

#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Bu form düzenleme seçimini nasıl sileceğinizi bilmiyorum"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Bileşen oluşturulurken hata oluştu"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr "Bileşen oluşturulurken hata oluştu: %s %s %s"

#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Bileşeni tahrip ederken hata oluştu"

#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
#, fuzzy,badformat
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "% S: %s %s biriminin %s türü bileşenini yok ederken hata oluştu"

#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Aracınızı tahrip ederken hata oluştu"

#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Birim %s için aracı %s yok edildi: %s %s"

#: lazarusidestrconsts.liscfeerrorreading
#, fuzzy,badformat
msgid "Error reading %s"
msgstr "% S okunurken hata oluştu"

#: lazarusidestrconsts.liscfeinfile
#, fuzzy,badformat
msgid "In file %s"
msgstr "% S dosyasında"

#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Geçersiz bileşen sahibi"

#: lazarusidestrconsts.liscferoot
#, fuzzy,badformat
msgid "%sRoot=%s:%s"
msgstr "% SRoot = %s: %s"

#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr "Tüm yüklemeyi durdur"

#: lazarusidestrconsts.liscfestream
#, fuzzy,badformat
msgid "%sStream=%s"
msgstr "% SStream = %s"

#: lazarusidestrconsts.liscfestreamposition
#, fuzzy,badformat
msgid "%s%sStream position: %s"
msgstr "% S %sStream konumu: %s"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm zaten var"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Bilinmeyen tür %s"

#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
#, fuzzy,badformat
msgid "TCustomFormEditor.DeleteComponent  Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent TCustomNonFormDesignerForm nerde?% S"

#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMeditor zaten kayıtlı: %s"

#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
#, fuzzy,badformat
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "\"% S \\ \"sınıfının bileşen editörü şu hatayı oluşturdu: %s \" %s \\ \""

#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr " %s türü bileşeni, sahibi %s: %s\" olarak ayarlanamadı"

#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, fuzzy,badformat
msgid "Unable to clear the form editing selection%s%s"
msgstr "% S %s form seçimi düzenleme temizlenemiyor"

#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Değişiklik"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Yapı modunu değiştir"

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Sınıfı Değiştir"

#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
#, fuzzy,badformat
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "% S, %s \"% d \\ \"den \"% d \\ \"ye %s içindeki koordinatını değiştirildi."

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Kodlamayı Değiştir"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Dosyayı değiştir"

#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Ebeveyn Değiştir"

#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Değişiklikler kaydedilmedi"

#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Unix / olarak değiştir"

#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Windows'a geç \\"

#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Karakter"

#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Karakter haritası"

#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Hepsini Kontrol Edin"

#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Disk dosyası değişikliklerini zaman damgası yerine içerik aracılığıyla kontrol edin"

#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ""

#: lazarusidestrconsts.lischeckifpackageisinthedependencies
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr " %s paketinin bağımlılıklarda olup olmadığını kontrol edin"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
#, fuzzy
#| msgid "check if the next token in source is an end and if not returns lineend + end; + lineend"
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "Kaynaktaki bir sonraki göstergenin bir son olup olmadığını kontrol edin, aksi halde satır sonu + end; + lineend"

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Seçenekleri kontrol et"

#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ""

#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr ""

#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "% S Hedefi kontrol edin (OS, CPU, LCL pencere öğesi türünü) Belki de bunun için paketi yeniden derlemeniz gereki"

#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr "Hepsini kontrol / iptal et"

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Farklı bir ad seçin"

#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "CodeTools şablonlarıyla bir dosya seçin"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Bir FPDoc bağlantısı seçin"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Bir anahtar seç ..."

#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr "Bileşen için bir ad seçin"

#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Örnek bir dosya seçin"

#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Bir FPC mesaj dosyası seçin"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Girinti örnekleri için bir Pascal dosyası seçin"

#: lazarusidestrconsts.lischoosecompilerexecutable
msgid "Choose compiler executable (%s)"
msgstr "Derleyici yürütülebilir dosyayı seçin ( %s)"

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Derleyici iletileri dosyasını seçin"

#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Yürütülebilir hata ayıklayıcıyı seçin"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Delphi paketini seçin (* .dpk)"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Delphi proje seç (* .dpr)"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Delphi birimini seçin (* .pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Dizini seçin"

#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr "Çalıştırılabilir bir dosya seçin"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "FPC kaynak dizinini seçin"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Lazarus Dizini Seç"

#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "\" make \\ \"yürütülebilir"

#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr ""

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Yeni bir Dosya oluşturmak için bu öğelerden birini seçin"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Yeni bir Paket oluşturmak için bu öğelerden birini seçin"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Yeni bir Proje oluşturmak için bu öğelerden birini seçin"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Mevcut öğelerden miras almak için bu öğelerden birini seçin"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Program kaynağını seçin (* .pp, *. Pas, *. Lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Seçimi içerecek yapı seç"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Sınama dizini seç"

#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Dairesel bağımlılık tespit edildi"

#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr ""

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Sınıf Tamamlama"

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Sınıflar ve özellikler var, değerler kontrol edilmedi."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "Class \" %s \\ \"kayıtlı bir bileşen sınıfı değil %s yapıştırılamıyor."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Sınıf bulunamadı"

#: lazarusidestrconsts.lisclassnotfoundat
msgid "Class %s not found at %s(%s,%s)"
msgstr "Sınıf %s %s ( %s, %s) bulunamadı"

#: lazarusidestrconsts.lisclassofmethodnotfound
#, fuzzy,badformat
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "\"% S \\ \"yöntemi \" %s \\ \"sınıfı bulunamadı."

#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Temiz"

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Temiz Dizin"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Temiz alt dizinler"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Tüm metin dosyalarını sakla"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Dosyaları eşleşen dosyaları filtreleyin"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Filtreye uyan dosyaları kaldır"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Basit Sözdizimi (ör. *. * Yerine)"

#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Hepsini temizle"

#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr "Ortak dosyaları temizle"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Temiz Lazarus Kaynağı"

#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Otomatik olarak derledikten sonra geçiş yapın"

#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Temizlemek"

#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Temizle ve derle  et"

#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Temizle ve proje oluştur"

#: lazarusidestrconsts.liscleanuppackage
msgid "Clean up package \"%s\"."
msgstr "Paketini temizle \" %s \\ \"."

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Birim yolunu mu temizle?"

#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Açık"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Dizini Temizle?"

#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Seçenekler için filtreyi temizle"

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Dosyaya gözatmak için burayı tıklayın"

#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr "Seçenekleri görmek için tıklayın"

#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr "Palet Sayfasını Seçmek İçin Tıklayın"

#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Klon"

#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Kapat"

#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Hepsini kapat"

#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Hepsini Kapat"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Dosyaları kapat"

#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Pencereyi gizle"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Kaynak Düzenleyici Penceresini Kapatma. Tüm dosyaları kapatmak mı yoksa pencereyi mi gizlemek istiyorsunuz?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Kaynak Düzenleyici Penceresini Kapat"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "LCL Arayüze özel seçenekler:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parametre"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Bileşenler"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Kalıtım"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Liste"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Palet"

#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Sayfalar"

#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr "Palet & görünür"

#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "& Varsayılanları geri yükle"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Belirsiz ek derleyici yapılandırma dosyası"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Ara:"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you definitely want to do that."
msgstr "\" \" %s %s Tamamen yapmak isterseniz Tamam'ı tıklayın."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Komut:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Kod"

#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Kod Tarayıcı"

#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr ""

#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr ""

#: lazarusidestrconsts.liscodecreationdialoglocation
#, fuzzy
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Yer"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Kod oluşturma seçenekleri"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Yol ekle"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Gözat"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Değiştirmeyi onayla"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Yardım öğesi oluştur"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Yol kaldır"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Açıklama"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Hatalar"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Örnek"

#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "FPDoc ayarları"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Kalın biçimlendirme etiketi ekleme"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Kod biçimlendirme etiketi ekleme"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Eğik biçimlendirme etiketi ekleme"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Açıklama biçimlendirme etiketi ekleme"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Alt çizgi biçimlendirme etiketi ekleme"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Var biçimlendirme etiketini ekle"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Miras"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Bir bağlantı ekle ..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Paragraf biçimlendirme etiketi ekleme"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "FPDoc Editör"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(Devralınan açıklama bulunamadı)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<YOK>"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Ayrıca bakınız"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Kısa açıklama"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Kısa"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Bir sonraki işleve ait sabitler yoksayılıyor"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "İsimlendirilmemiş karakter sabitlerinde arama"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Kod Gözlemci"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Sonraki adsız sabitleri yoksay"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Şablon ekle"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Kod şablonu ekle"

#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token \"%s\" already exists! "
msgstr "\" \\ \" %s \" simgesi zaten var! "

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Otomatik Tamamlama"

#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Değişiklik"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Yorum Yap:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Kod şablonunu düzenle"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Hata"

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Jeton:"

#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Eylem: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Otomatik oluşturulmuş düğümler düzenlenemez, %snor otomatik oluşturulmamış alt düğümlere sahip olabilirler."

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, fuzzy,badformat
msgid "%s, auto generated"
msgstr "% S, otomatik oluşturuldu"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "Otomatik oluşturulmuş düğümler düzenlenemez."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blok"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "CodeTools Editörü Tanımlar"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Derleyici yolu"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Düğümü dönüştür"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, fuzzy,badformat
msgid "Create Defines for %s Directory"
msgstr "% S Dizini için Tanımlar Oluştur"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Ücretsiz Pascal Derleyici için Tanımlar Yarat"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Ücretsiz Pascal SVN Kaynakları için Tanımlar Yarat"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, fuzzy,badformat
msgid "Create Defines for %s Project"
msgstr "% S Projesi için Tanımlar Oluştur"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Bir fpc proje dizini için FPC Makroları ve yolları oluşturma"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Tanımlamak"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Recurse Tanımla"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Düğümü sil"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, fuzzy,badformat
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr " %s ana dizini,% Borland tüm %s kaynaklarını yükledi.% SÖrneğin: C: / Program / B"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, fuzzy,badformat
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr " %s ana dizini,% Borland tüm %s kaynaklarını yükledi, %s bu %s pr tarafından kullanılıyo"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Açıklama:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
#, fuzzy,badformat
msgid "%s directory"
msgstr "% S dizini"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Başka"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Kaydetmeden Çık"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "FPC SVN kaynak dizini"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "Eğer"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "Ifdef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Dizin"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Delphi 5 Derleyici Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Delphi 5 Dizin Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Delphi 5 Proje Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Delphi 6 Derleyici Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Delphi 6 Dizin Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Delphi 6 Proje Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Delphi 7 Derleyici Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Delphi 7 Dizin Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Delphi 7 Proje Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Insert Free Pascal Compiler Template"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Ücretsiz Pascal Proje Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Ücretsiz Pascal SVN Kaynak Şablonu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Kylix 3 Derleyici Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Kylix 3 Dizin Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Kylix 3 Proje Şablonunu Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Düğümü çocuk olarak yerleştir"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Aşağıdaki düğümü ekleyin"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Şablon Ekle"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Geçersiz ebeveyn"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Geçersiz üst düğüm"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Geçersiz önceki düğüm"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, fuzzy,badformat
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr " %s ana dizini,% Borland, tüm %s kaynaklarını yükledi.% SÖrneğin: / home / kullanıcı / kyl"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, fuzzy,badformat
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr " %s ana dizini,% Borland tüm %s kaynaklarını yükledi, %s bu %s pr tarafından kullanılıyo"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Düğümü aşağıya taşı"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Düğümü bir adım aşağıya taşı"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Birinci seviyeyi yukarı taşı"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Düğümü yukarıya taşı"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Ad:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "NewNode"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Düğüm salt okunur"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "hiçbiri seçilmedi"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "Üst düğüm alt düğümleri içeremez."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Önceki düğüm alt düğümleri içeremez."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Proje dizini"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, fuzzy,badformat
msgid "%s project directory"
msgstr "% S proje dizini"

#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Okuma hatası"

#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Kaydet ve çık"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Seçili Düğüm:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "\" \"Free Pascal SVN kaynak dizini, gerekli değildir. Bulma beyanını ve hata ayıklamasını artıracaktır"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Free Pascal proje dizini."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Serbest Pascal SVN kaynak dizini."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, fuzzy,badformat
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Serbest Pascal derleyici yolu %s Örneğin %s / usr / bin / %s - n %s veya %s / usr / local / bin / fpc "

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Bu proje için Free Pascal derleyicisine giden yol: Sadece FPC SVN sour"

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "Bu kaynak için Free Pascal derleyicisinin yolu %s makroları otomatikleştirmek için kullanıldı."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr " %s proje dizini, %swhich .dpr, dpk dosyası içeriyor."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Tanımsız"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Hepsini tanımla"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Recurse'u tanımlayın"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Dosya Yolları Olarak Değer"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Metin Olarak Değer"

#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
#, fuzzy,badformat
msgid "%s:%svalue \"%s\" is invalid."
msgstr "% S: %svalue \" %s \\ \"geçersiz."

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Değişken:"

#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Yazma hatası"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "At"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Parantez"

#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr "Caret (^)"

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Kolon"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Virgül"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Tanıtıcı"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Anahtar kelime"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Yeni hat"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Yok"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Numara"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Puan"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Noktalı virgül"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Uzay"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Dize sabiti"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Sembol"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Sonra çalıştır"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Daha önce icra et"

#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr "Adres"

#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr "Sınıf"

#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr "Tüm daraltmak (/)"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Tüm sınıfları daralt"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Tüm paketleri daralt"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Tüm birimleri daralt"

#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr "İade"

#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr "Görünürlük"

#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Komut satırı parametreleri"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Programın komut satırı parametreleri"

#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Derleme"

#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr ""

#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Derleme Projesi"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Derleyici"

#: lazarusidestrconsts.liscompilercfgismissing
msgid "%s is missing."
msgstr ""

#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Derleyici \" %s \\ \"hedef %s- %s'yi desteklemez"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Hata: geçersiz derleyici: %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Derleyici dosya adı"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "İpucu: Araçlar -> Seçenekler -> Dosyalar -> Derleyici Yolu'nda derleyici yolunu ayarlayabilirsiniz"

#: lazarusidestrconsts.liscompilermessagesfilenotfound
msgid "Compiler messages file not found:%s%s"
msgstr "Derleyici iletileri dosyası bulunamadı: %s %s"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "NOT: codetools yapılandırma dosyası bulunamadı - varsayılanları kullanarak"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "NOT: eski codetools seçenek dosyaları yükleniyor:"

#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Derleme"

#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "Daha fazla ayrıntı için -vd ile derleyin.Yinelenenleri kontrol edin."

#: lazarusidestrconsts.liscompiling
#, fuzzy,badformat
msgid "%s (compiling ...)"
msgstr "% S (derleme ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Uzun satır ipuçlarını göster"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "En sola doğru uzatın"

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Biraz uzat"

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Asla"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Yalnızca genişlet"

#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a Pascal keyword."
msgstr "Bileşen adı \" %s \\ \"Pascal bir anahtar kelimedir."

#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name \"%s\" is keyword"
msgstr "Bileşen adı \" %s \\ \"anahtar kelime"

#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name \"%s\" is not a valid identifier"
msgstr "Bileşen adı \" %s \\ \"geçerli bir tanımlayıcı değil"

#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Hepsini gör"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Açık paket"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Açık birimi"

#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr ""

#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr ""

#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Ölçek"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Şart"

#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Şartlılar"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Lazarus yapılandırma dizini"

#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr "Eklemelerin yapılandırma dosyası:"

#: lazarusidestrconsts.lisconfigurebuild
#, fuzzy,badformat
msgid "Configure Build %s"
msgstr "% S Yapılandırmasını Yapılandır"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "\" Build Lazarus \\ \"\" \\ \"\" \\ \""

#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr "Araç Çubuğunu Yapılandır"

#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Configure Lazarus IDE"

#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Onaylamak"

#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Onayla"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus aşağıdaki profillerle tekrar oluşturulacaktır: %sDevam edilsin mi?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Değişiklikleri onayla"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Onayı sil"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Lazarus'u profil ile yeniden oluşturmak ister misiniz: %s?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "IDE için yeni paket setini onaylayın"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Aksiyon"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Yeni paket seti"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Eski paket seti"

#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Fikir ayrılığı"

#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Çatışma algılandı"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Konsol uygulaması"

#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Komut satırı seçeneklerini kolayca kontrol etmek için TCustomApplication kullanarak bir Free Pascal komut satırı programı"

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Yapıcı kodu"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "Içerir"

#: lazarusidestrconsts.liscontents
#, fuzzy
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "İçindekiler"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Bağlama duyarlı"

#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Devam et"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Devam edin ve tekrar sorma"

#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr "İnşaata devam et"

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Formu yüklemeden devam et"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Katkıda"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Kontrolün ebeveynlere ihtiyacı var"

#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Değiştirmeden sonra yorum ekle"

#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr ""

#: lazarusidestrconsts.lisconvaddingflagforregister
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr " %s biriminde \" Kayıt \\ \"işlemi için bayrak ekleniyor."

#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
msgid "\")\" is missing from replacement function: %s"
msgstr "\") \\ \"Değiştirme işlevi eksik: %s"

#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr "Parantez bulunamadı"

#: lazarusidestrconsts.lisconvconvertedfrom
#, fuzzy,badformat
msgid " { *Converted from %s* }"
msgstr "{*% S *}\" dan çevirildi "

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Görsel kaplardaki denetimlerin üst koordinatına bir ofset eklenir"

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Koordinat uzaklıklar"

#: lazarusidestrconsts.lisconvdeletedfile
#, fuzzy,badformat
msgid "Deleted file %s"
msgstr "% S dosyası silindi"

#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr "Eklenen %s, özel seçenekler"

#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr " %s bağımlılığı eklendi."

#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
msgid "Added unit \"%s\" to uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Tüm alt dizinler birim dosyalar için taranacak"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "BeginCodeTools başarısız oldu!"

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Kategori:"

#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
#, fuzzy,badformat
msgid "Changed encoding from %s to UTF-8"
msgstr "% S'den UTF-8'e kodlama değiştirildi"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Dönüşüm Durduruldu."

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Dönüşüm Hazır\""

#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr "Dönüşüm alındı: %s"

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Delphi paketini dönüştürme"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Convert Delphi project"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Convert Delphi unit"

#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Dönüşüm sırasında bulunan birim dosyalarını dönüştürme ***"

#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** Proje / pakete *** ait birim dosyaları dönüştürme ***"

#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Hata = \"  %s \\ \""

#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "Birim dönüştürme sırasında istisna oldu. Dönüştürülmüş haldeki birimlerin form dosyalarına devam edilmesi"

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Birimi dönüştürmede başarısız oldu"

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit \"%s\""
msgstr "Birimi dönüştürme başarısız \" %s \\ \""

#: lazarusidestrconsts.lisconvdelphifixedunitcase
#, fuzzy,badformat
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "\"% S \\ \"biriminin sabit karakter kasa \" %s \\ \"."

#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Tüm birim dosyaları bulundu"

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Delphi Fonksiyonu"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
#, fuzzy,badformat
msgid "%s(%s,%s) missing include file"
msgstr "% S ( %s, %s) eksik dosya içeriyor"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Delphi Adı"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Paket adı var"

#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "Paket %s gerekli ancak Lazarus'a kurulu değil! Daha sonra yükleyin."

#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr "Projeden %s birimi ihmal edildi"

#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
msgid "Removed unit \"%s\" from uses section."
msgstr ""

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Kullanılmış birimleri düzeltme ve form dosyalarını onarma ***"

#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "\" \\ \" %s \" birimini \\ \" %s \" bölümünde kullanıyor bölümünde değiştirildi. "

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
#, fuzzy,badformat
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "\"% S \\ \"adı olan bir paket zaten var %sİlk önce bu paketi kapatın."

#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "Unitname LCL'de var"

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
#, fuzzy,badformat
msgid "Units to replace in %s"
msgstr "% S yerini alan birimler"

#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "LCL zaten %s ismine sahip bir birime sahip. Yerel dosyayı %s silinsin mi?"

#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr ".dproj dosyası henüz desteklenmiyor.Dosya, Delphi 2007 ve sonrası tarafından kullanılıyor. Lütfen bir .dpr dosyasını seçi"

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Dönüşüm hatası"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Dönüştürmek"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Kodlamayı Dönüştür"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Projelerin / paketlerin kodlamasını dönüştürme"

#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr "Dönüşümü etkileyen diğer seçenekler"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Proje veya paketi dönüştürme"

#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Hedef"

#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Çapraz platform"

#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Çapraz platform ve Windows'a karşı"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Dönüştürücü, farklı hedefleri desteklemek için koşullu derleme ekler"

#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Aynı DFM form dosyasını kullanın"

#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "LFM'ye kopyalamak yerine Lazarus ve Delphi için aynı DFM dosyası"

#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Destek Delphi"

#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Delphi'yi desteklemek için koşullu derleme kullanın"

#: lazarusidestrconsts.lisconvfixedunitname
#, fuzzy,badformat
msgid "Fixed unit name from %s to %s."
msgstr "% S ile %s arasındaki sabit birim adı."

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "İşlev Değişiklikleri"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Bazı Delphi fonksiyonları LCL fonksiyonuyla değiştirilebilir"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Değiştirilecek işlevler / prosedürler"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Sol ofset"

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Yeni isim"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Ebeveyn Konteyner"

#: lazarusidestrconsts.lisconvproblemsfindingallunits
#, fuzzy,badformat
msgid "Problems when trying to find all units from project file %s"
msgstr "% S proje dosyasındaki tüm birimleri bulmaya çalışırken karşılaşılan sorunlar"

#: lazarusidestrconsts.lisconvproblemsfixingincludefile
#, fuzzy,badformat
msgid "Problems when fixing include files in file %s"
msgstr "% S dosyasındaki dosyaları saptarken karşılaşılan sorunlar"

#: lazarusidestrconsts.lisconvproblemsrepairingformfile
msgid "Problems when repairing form file %s"
msgstr "Form dosyası %s onarılırken sorunlar"

#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr "Dahil edilen dosyaları tamir et:"

#: lazarusidestrconsts.lisconvreplacedcall
#, fuzzy,badformat
msgid "Replaced call %s with %s"
msgstr "% S çağrısı %s ile değiştirildi"

#: lazarusidestrconsts.lisconvreplfuncparameternum
msgid "Replacement function parameter number should be >= 1: %s"
msgstr "Değiştirme fonksiyonu parametre numarası> = 1 olmalıdır: %s"

#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
msgid "\"$\" should be followed by a number: %s"
msgstr "\" $ \\ \"Bir sayı ile takip edilmelidir: %s"

#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr "Durduruldu, çünkü aynı ada sahip bir paket zaten var"

#: lazarusidestrconsts.lisconvthislogwassaved
msgid "This log was saved to %s"
msgstr "Bu günlük %s dosyasına kaydedildi"

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Üst ofset"

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Tip Değişiklikleri"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Form dosyasında bilinmeyen türler (DFM / LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Değiştirilecek türler"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Ünitelerin Değiştirilmesi"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Bir kaynak biriminin kullandığı bölümdeki birim adları"

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Değiştirilecek birimler"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Bilinmeyen özellikler"

#: lazarusidestrconsts.lisconvuserselectedtoendconversion
msgid "User selected to end conversion with file %s"
msgstr "Kullanıcı, %s dosyası ile dönüşüm işlemini sonlandırmak için seçildi"

#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr "Araç Çubuklarını Ekleme / Yapılandırma / Silme"

#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr "Bölücü Ekle"

#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr "Seçilen öğeyi araç çubuğuna ekle"

#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr "Kullanılabilir komutlar"

#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr "Araç çubukları kenarlık stili"

#: lazarusidestrconsts.liscoolbarborderstyleitem0
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Yok"

#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Tek"

#: lazarusidestrconsts.liscoolbarcodeexplorer
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Kod Explorer"

#: lazarusidestrconsts.liscoolbarcodetemplates
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Kod Şablonları"

#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr "& Yapılandırma"

#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr "Seçili araç çubuğunu silmek istediğinizden emin misiniz?"

#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr "En az bir araç çubuğu olmalıdır!"

#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr "Tasarımcı"

#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr "Genel Coolbar Ayarları"

#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr "Araç çubukları stili yakala"

#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr "Basit"

#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Çift"

#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr "HorLines"

#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr "VerLines"

#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr "Tutucu"

#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Düğme"

#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr "Kepçe genişliği"

#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr "IDE Ana Menüsü"

#: lazarusidestrconsts.liscoolbarmessages
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Mesajlar"

#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr "Seçilen araç çubuğu öğesini aşağı taşı"

#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr "Seçilen araç çubuğu öğesini yukarı taşı"

#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr "IDE CoolBar"

#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr "Paket Düzenleyici"

#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr "Paket Düzenleyici Dosyaları"

#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr "Seçilen öğeyi araç çubuğundan kaldır"

#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr "Varsayılanları geri yükle"

#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr "Lütfen öncelikle bir araç çubuğu seçin!"

#: lazarusidestrconsts.liscoolbarsourceeditor
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Kaynak Düzenleyici"

#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr "Kaynak Sekmesi"

#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr "Araç çubuğu komutları"

#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr "Coolbar & görünür"

#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr "Coolbar genişliği"

#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Kopyala"

#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Tümünü Kopyala"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Tüm Öğeleri Panoya Kopyala"

#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Tümünü Kopyala / Orijinal İletileri Panoya Kopyala"

#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Tüm çıktıları panoya kopyala"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Gösterilen tüm mesajları Pano'ya Kopyala"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Açıklamayı panoya kopyala"

#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Kopyala Hatası"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Kopyala hatası"

#: lazarusidestrconsts.liscopyfilename
msgid "Copy Filename %s"
msgstr "Dosya adı %s kopyala"

#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Dosya Adını Panoya Kopyala"

#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr ""

#: lazarusidestrconsts.liscopyidentifier
msgid "Copy \"%s\" to clipboard"
msgstr "Kopya \" %s \\ \"panoya"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Bütün bir formun kopyalanması uygulanmıyor."

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Öğe Pano'ya Kopyala"

#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Dosyayı Dizine Kopyala / Taşı"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Seçili Öğeleri Panoya Kopyala"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Seçili İletileri Panoya Kopyala"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "FPC mesajları tara"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "İletileri tara için tara"

#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr "İletileri tara:"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Çağıran derleyici atla"

#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add \"{$I %s}\" to main source!"
msgstr "Ana kaynağa \" {$ I %s} \\ \"eklenemedi!"

#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add \"{$R %s}\" to main source!"
msgstr "\" {$ R %s} \\ \"\" ana kaynağa eklenemedi! "

#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add \"%s\" to main source!"
msgstr "Ana kaynak \" %s \\ \"eklenemedi!"

#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove \"%s\" from main source!"
msgstr "Ana kaynaktan \" %s \\ \"kaldırılamadı!"

#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove \"{$I %s}\" from main source!"
msgstr "Ana kaynaktan \" {$ I %s} \\ \"kaldırılamadı!"

#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove \"{$R %s}\" from main source!"
msgstr "Ana kaynaktan \" {$ R %s} \\ \"kaldırılamadı!"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Uyarı: Ek derleyici yapılandırma dosyası, standart yapılandırma dosyalarından biri ile aynı adı taşıyo"

#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Açık Paket %s"

#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Açık Birim %s"

#: lazarusidestrconsts.liscpu
msgid ", CPU: %s"
msgstr ", CPU: %s"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Önce bir proje oluştur!"

#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Hata ayıklama ve çıkış modları oluşturma"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Dizin oluştur\""

#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Filtre Oluştur"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "İşlev yarat"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Yardım oluştur düğüm"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Oluştur"

#: lazarusidestrconsts.liscreatelocalvariable
msgid "Create local variable \"%s\""
msgstr "Yerel değişken \" %s \\ \"\" oluşturun "

#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr "Yeni ekle"

#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Yeni paket oluştur)"

#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Yeni paket bileşeni oluştur"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Proje oluştur"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Bir lfm dosyası kaydederken\" .po dosyası oluştur / güncelle "

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "FPC kaynaklarının dosya dizini oluşturuluyor %s ..."

#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "Alt"

#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "Üst"

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Dizin Seç"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "CodeTools Dizin Değerleri"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Şablonları tanımla"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Seçilen değişken yok\""

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Açık Önizleme"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Araçlar"

#: lazarusidestrconsts.lisctdefvariable
#, fuzzy,badformat
msgid "Variable: %s"
msgstr "Değişkenler"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Değişken Adı"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Şablonlar"

#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Tüm yöntem imzalarını güncelle"

#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Birden çok prosedür imzasını güncelle"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "Lütfen bir makro seçin"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Kod Makrosu Seç"

#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Geçerli"

#: lazarusidestrconsts.liscurrentlclwidgetset
msgid "Current LCL widgetset: \"%s\""
msgstr "Geçerli LCL widget'ları: \" %s \\ \""

#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Mevcut durum: "

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Geçerli düzenleyicideki imleç sütunu"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Geçerli düzenleyicideki imleç satırı"

#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Bu seçenekler makrolar değiştirildikten sonra derleyiciye aktarılır."

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "Özel seçenekler"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Özel seçenekler"

#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr "Özel Seçenekler"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Özel Program"

#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Özel Ücretsiz Pascal programı."

#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Kes"

#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr "Ekle"

#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr "Resim Adı"

#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr "PID"

#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr "İşlemleri Koşu"

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Veri modülü"

#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Tarih"

#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Hepsini sil"

#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Hepsini sil"

#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Tümünü devre dışı bırak"

#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Tümünü devre dışı bırak"

#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Hepsini etkinleştir"

#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Hepsini etkinleştir"

#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to Clipboard"
msgstr "Panoya kopyala"

#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr "Kesme Noktası Özellikleri ..."

#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr "& İfade:"

#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr "& Yeni değer:"

#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr "&Sonuç:"

#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Kesme noktası değerlendirmesi"

#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Kesme Noktası Vuruşu"

#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Kesme Mesaj"

#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Kesme Noktası Yığın Dökümü"

#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Varsayılan Renk"

#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "İstisna Yükseltildi"

#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Modül Yükü"

#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Modül Kaldırma"

#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Çıkış Hata Ayıklama Dizesi"

#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "İşlem Çık"

#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Süreç Başlat"

#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Konu Çık"

#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Konu Başlat"

#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Windows İleti Gönderildi"

#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Gönderilen Windows İletisi"

#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Sil"

#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Devre Dışı"

#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Devre Dışı"

#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Enable"

#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Enable"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Belirtilen hata ayıklayıcı yok"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Kesme noktasını yine de ayarla"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, fuzzy,badformat
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Belirtilen herhangi bir hata ayıklayıcısı yok.% SYanlıır noktaları ayarlamanız, bir hata ayıklayıcıyı ayarlayıncaya kadar geçerli değildir"

#: lazarusidestrconsts.lisdbgterminal
msgctxt "lazarusidestrconsts.lisdbgterminal"
msgid "Console In/Output"
msgstr ""

#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Açık kapalı"

#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Tüm pencerenin güncellemelerini devre dışı bırak / etkinleştir"

#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Hata ayıklama"

#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Debugger"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, fuzzy,badformat
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Hata ayıklayıcı hatası %sOoops, hata ayıklayıcı hata durumuna girdi.% SŞimdi çalışmalarınızı kaydedin!% SHit Stop, v"

#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr "Hata Ayıklayıcı Hatası"

#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr "Hata ayıklayıcı bilgileri"

#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr "Hata ayıklayıcı uyarı"

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Hata ayıklayıcı geçersiz"

#: lazarusidestrconsts.lisdebugging
#, fuzzy,badformat
msgid "%s (debugging ...)"
msgstr "% S (hata ayıklama ...)"

#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "Nesneler için otomatik tip analizi"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "İstisna Ekle"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Ek arama yolu"

#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Kırılma noktası"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "İşlem günlüğünü temizle"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Debugger"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Hata ayıklayıcı genel seçenekleri"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Hata ayıklayıcıya özgü seçenekler (hata ayıklayıcı türüne bağlıdır)"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "İstisna adı çoğalt"

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "İstisnanın adını gir"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Olay günlüğü"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Tarafından Handled"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Hata Ayıklayıcı Tarafından Ele Alınır"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Program Tarafından Ele Alınmıştır"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Bu istisnaları yoksay"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Dil İstisnaları"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Satır sayısını sınırla"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modül"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
#, fuzzy
#| msgid "Notify on Lazarus Exceptions"
msgid "Notify on Exceptions"
msgstr "Lazarus İstisnalarına Haber Verin"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "İşletim Sistemi İstisnaları"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Çıktı"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Süreç"

#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Her çalıştırmadan sonra hata ayıklayıcıyı sıfırla"

#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Devam et"

#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "İşlenen Özgeçmiş"

#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "İşlenmeyen Özgeçmiş"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Dur mesajı göster"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Sinyalleri"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Konu"

#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Olay günlüğü renklerini kullan"

#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Windows"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Dosya yüklenemiyor"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file \"%s\"."
msgstr "Dosya \" %s \\ \"yüklenemedi."

#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Ondalık"

#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Varsayılan"

#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr ""

#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr "Varsayılan ComboBox, \" Doğru \\ \"ve \" Yanlış \\ \"seçimlerle"

#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(varsayılan)"

#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr ""

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Uzun satır ipuçları tamamlama kutusunda gecikme"

#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "İpuçları ve tamamlanma kutusu için gecikme"

#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Sil"

#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "Sil?"

#: lazarusidestrconsts.lisdeleteaddition
msgid "Delete addition \"%s\"?"
msgstr "Ek kaldır \" %s \\ \"?"

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Hepsini sil"

#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Tüm kesmeleri silinsin mi?"

#: lazarusidestrconsts.lisdeleteallbreakpoints2
#, fuzzy,badformat
msgid "Delete all breakpoints in file \"%s\"?"
msgstr "\"% S \\ \"dosyasındaki tüm kesme noktalarını silinsin mi?"

#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Tümünü aynı kaynakta sil"

#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Seçili tüm kesme noktalarını silinsin mi?"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Tüm dosyaları silinsin mi?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Belirsiz dosya silinsin mi?"

#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Kesme Noktasını Sil"

#: lazarusidestrconsts.lisdeletebreakpointatline
#, fuzzy,badformat
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Kesme noktasını %s de sil\" \" %s \"% d satır? "

#: lazarusidestrconsts.lisdeletebreakpointforaddress
#, fuzzy,badformat
msgid "Delete breakpoint for address %s?"
msgstr "% S adresi için kesme noktası silinsin mi?"

#: lazarusidestrconsts.lisdeletebreakpointforwatch
#, fuzzy,badformat
msgid "Delete watchpoint for \"%s\"?"
msgstr "\"% S \\ \"için izleme noktası silinsin mi?"

#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Dosya silinemedi"

#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro \"%s\"?"
msgstr "Makro silinsin mi \" %s \\ \"?"

#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Modu sil \" %s \\ \""

#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file \"%s\"?"
msgstr "Eski dosyayı sil \" %s \\ \"?"

#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Eski dosyayı sil mi?"

#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Seçili makroyu silinsin mi?"

#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr "Bu eklemeyi sil"

#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value \"%s\"?"
msgstr "Değeri silinsin mi \" %s \\ \"?"

#: lazarusidestrconsts.lisdeletevalue2
#, fuzzy,badformat
msgid "Delete value %s"
msgstr "% S değerini sil"

#: lazarusidestrconsts.lisdeletingoffilefailed
#, fuzzy,badformat
msgid "Deleting of file \"%s\" failed."
msgstr "\"% S \\ \"dosyasının silinmesi başarısız oldu."

#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr "Sınırlayıcı noktalı virgül."

#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr "Delphi uyumlu kaynaklar. Önerilir."

#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
#, fuzzy
#| msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects, but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "\" Tasarım zamanı \\ \"paketleri bileşenleri ve menü öğelerini IDE'ye ekler.Projeler"

#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr "Masaüstü bilgisayarlar ..."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Hedef dizin"

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Yıkıcı kod"

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Case Insensitive"

#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "File1"

#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "File2"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Boş satırlar eklenip eklenmediğini yok sayın"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Satır sonlarındaki farkı yok sayın (ör. # 10 = # 13 # 10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Boşluk miktarını yoksay"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Boşlukları yoksay (satırsonu karakterleri dahil değil)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Satırın sonundaki boşlukları yoksay"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Satırın başındaki boşlukları yoksay"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Sadece seçim"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Editörde açık fark"

#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
msgid "different unit %s found at new position \"%s\""
msgstr " %s adlı farklı birim \" %s \\ \"\" yeni konumda bulundu "

#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Rakamlar:"

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Direktifleri"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Yeni birim için direktifler"

#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Dizinler"

#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Dizin:"

#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory \"%s\" not found."
msgstr "Dizin \" %s \\ \"bulunamadı."

#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr "Dizin %s bulunamadı"

#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Dizine yazılabilir değil"

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "IDE'nin .po dosyalarını koyduğu dizin"

#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Tümünü aynı kaynakta devre dışı bırak"

#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Kesme Noktasını Devre Dışı Bırak"

#: lazarusidestrconsts.lisdisabled
msgctxt "lazarusidestrconsts.lisdisabled"
msgid "Disabled"
msgstr "Engelli"

#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr "Grupları Devre Dışı Bırak"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "LFM için I18N'yi devre dışı bırak"

#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr "Disable Option -Xg?"

#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr "Disable option -Xg"

#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"

#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "Adrese Git"

#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "Adrese Git"

#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "Geçerli Adrese Git"

#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "Geçerli Adrese Git"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Değişiklikleri gözardı et"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Tüm değişiklikleri sil"

#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Değişiklikleri sil ve projeyi aç"

#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Değişiklikleri sil ve çık"

#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Değişiklikleri sil, yeni proje oluştur"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Farkı görmek için yukarıdaki öğelerden birini tıklayın"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Dosya okunurken hata oluştu: %s"

#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr ""

#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr ""

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Bazı dosyalar disk üzerinde değişti:"

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Büyük ve küçük harfleri ayırt et, örn. A ve"

#: lazarusidestrconsts.lisdlgadd
msgctxt "lazarusidestrconsts.lisdlgadd"
msgid "Add ..."
msgstr "Eklemek ..."

#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Tüm seçenekler ..."

#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Sınıf değiştir ..."

#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Tanımlar ..."

#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Düzenle ..."

#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "İhracat ..."

#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "İthalat ..."

#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr "Daha ..."

#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Aç ..."

#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Kaydet ..."

#: lazarusidestrconsts.lisdoesnotexists
#, fuzzy,badformat
msgid "%s does not exist: %s"
msgstr "% S yok: %s"

#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Değiştirme"

#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
#, fuzzy,badformat
msgid "%sDo not check if another IDE instance is already running"
msgstr "% SDiğer bir IDE örneğinin zaten çalışıp çalışmadığını kontrol etmeyin"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Projeyi kapatma"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "Bağımlılıkları derleme"

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Açılış ekranı gösterme"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Bu iletişim için bu iletişim kutusunu gösterme"

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Bu mesajı tekrar gösterme"

#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr ""

#: lazarusidestrconsts.lisdonwloadonlinepackages
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?\n"
msgstr ""

#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Aşağı"

#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Düşürme"

#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Düşen konfigürasyon"

#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr ""

#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "HÃ¢lÃ¢ yeni projeyi yaratmak istiyor musunuz?"

#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Yine de başka bir proje açmak istiyor musunuz?"

#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Hala ayrılmak istiyor musun?"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Izgara çizgileri çiz"

#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
#, fuzzy
#| msgid "Draw the selection focused, even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "Mesaj penceresinin odağı yoksa bile odaklanmış seçimi çizin. Temanızı"

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Seçilen bileşenleri panoya kopyala"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Seçilen bileşenleri panoya kopyala"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Bileşeni geriye taşıyın"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Bileşeni bir ileriye taşıyın"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Bileşeni arkaya taşı"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Bileşeni öne taşıyın"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Seçilen bileşenleri panodan yapıştırın"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Üst bileşen seç"

#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr ""

#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr ""

#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Çift"

#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Yinelenen giriş"

#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Yinelenen Dosya Adı"

#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value \"%s\"."
msgstr "Yinelenen değer \" %s \\ \"bulundu."

#: lazarusidestrconsts.lisduplicatemodename
msgid "Mode \"%s\" is already present in the list."
msgstr ""

#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Çift Adı"

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Yinelenen ad: \" %s \\ \"adlı bir bileşen, devralınan bileşen %s içinde zaten var"

#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Pupu dosyalarını çoğaltın, birini silin veya tüm arama yollarının doğru sırada olduğundan emin olun (İpucu: FPC kullanı"

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Arama yolunu çoğalt"

#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Çoğaltılmış kaynaklar Birini sil veya tüm arama yollarının doğru sıralamaya sahip olduklarından emin olun (İpucu: FPC, l"

#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Birim Çoğalt"

#: lazarusidestrconsts.lisduplicateunitin
#, fuzzy,badformat
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr "\"% S \\ \"\" \\ \" %s \" birimini çoğal"

#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Düzen"

#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr "İletiler için ek yardım düzenleme"

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Bağlam yardımını düzenle"

#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Yardım düzenle"

#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Anahtar Düzenle"

#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Editör Renkleri"

#: lazarusidestrconsts.liseditormacros
#, fuzzy
#| msgid "Editor macros"
msgid "Editor Macros"
msgstr "Editör makroları"

#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr "Editör Araç Çubuğu"

#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr "Editör Araç Çubuğu Ayarları"

#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr "Editör Araç Çubuğu ve görünür"

#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Bir şema yükle"

#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Tüm paketler"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Mevcut Proje"

#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Tüm projeler"

#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "FPC modunu DELPHI olarak ayarla"

#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "FPC modunu FPC'ye ayarla"

#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "FPC modunu GPC'ye ayarla"

#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "FPC modunu MacPas olarak ayarla"

#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "FPC modunu TP olarak ayarla"

#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "IOCHECKS açık"

#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "OVERFLOWCHECKS'yi açık"

#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "RANGECHECKS'i açık"

#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "HeapTrc birimini kullanın"

#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "LineInfo birimini kullanın"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Geçerli bir araç en az bir başlık ve bir dosya adı gerekiyor."

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Edit Tool"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Anahtar"

#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Makro"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parametreler:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Program Adı:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
#, fuzzy
#| msgid "Scan output for Free Pascal Compiler messages"
msgid "Scan output for FPC messages"
msgstr "Free Pascal Derleyici mesajları için tarama çıktısı"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
#, fuzzy
#| msgid "Scan output for make messages"
msgid "Scan output for \"make\" messages"
msgstr "Make mesajları için tarama çıktısı"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Başlık ve Dosya Adı Gerekli"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Çalışma dizini:"

#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr "Mesaj önceliğini her zaman gösterecek şekilde yükseltin (varsayılan olarak düşük öncelikli \" ayrıntılı \\ \")"

#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Herşey"

#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Boş Yöntemler"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Boş yöntemler bulundu:"

#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Ders yok"

#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr "Sınıf %s yok ( %s, %s)"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Sadece yayınlandı"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Halka açık"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Yayınlanan"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Yöntemleri kaldır"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Bu sınıf bölümlerinde ara:"

#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Geçerli sınıfın boş yöntemleri gösterilemiyor, çünkü %s %s"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Boş"

#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr ""

#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Hepsini etkinleştir"

#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Tümünü aynı kaynakta etkinleştir"

#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Kesme noktasını etkinleştir"

#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Etkin"

#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr "Sadece paketler için etkin."

#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr "Paket %s içindeki %s birimi \" Kullan Birimi \\ \"bayrakını etkinleştir"

#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr "Grupları Etkinleştir"

#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "LFM için I18N'yi etkinleştir"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Uluslararasılaştırma ve çeviri desteğini etkinleştir"

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Makroları Etkinleştir"

#: lazarusidestrconsts.lisenableoptiondwarf
msgid "Enable Dwarf 2 (-gw)?"
msgstr ""

#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr ""

#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr ""

#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr ""

#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr ""

#: lazarusidestrconsts.lisenableoptionxg2
msgid "Enable option -Xg"
msgstr ""

#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
#, fuzzy
#| msgid "Enable = replace whole identifier, Disable = replace prefix"
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr "Etkinleştir = tüm tanımlayıcıyı değiştir, Devre dışı bırak = öneki değiştir"

#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Içine alın"

#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "$ IFDEF'de bulun"

#: lazarusidestrconsts.lisencodingnumberoffilesfailed
#, fuzzy,badformat
msgid "Number of files failed to convert: %d"
msgstr "Dönüştürülemeyen dosya sayısı:% d"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "Dosyanın \" %s \\ \" %s sonuncu dizinin %s kodlanması yeni şifreleme %s."

#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr "Makrolarda sonsuz döngü"

#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr "Makro için \" %s \\ \"\" yeni adını gir "

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Ortam değişkeni, parametrenin adı"

#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Dizin bulunamadı"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Geçersiz hata ayıklayıcı dosya adı"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, fuzzy,badformat
msgid "The debugger file \"%s\" is not an executable."
msgstr "\"% S \\ \"hata ayıklayıcı dosyası yürütülebilir değil."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Sınama dizini \" %s \\ \"bulunamadı."

#: lazarusidestrconsts.liserrinvalidoption
#, fuzzy,badformat
msgid "Invalid option at position %d: \"%s\""
msgstr "% d konumundaki geçersiz seçenek: \" %s \\ \""

#: lazarusidestrconsts.liserrnooptionallowed
#, fuzzy,badformat
msgid "Option at position %d does not allow an argument: %s"
msgstr "% D konumundaki seçenek, bir bağımsız değişkene izin vermiyor: %s"

#: lazarusidestrconsts.liserroptionneeded
#, fuzzy,badformat
msgid "Option at position %d needs an argument : %s"
msgstr "% d konumundaki seçenek bir argümana ihtiyaç duyuyor: %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Hata: "

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Dosya oluşturulurken hata oluştu"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Dosya silinirken hata oluştu"

#: lazarusidestrconsts.liserrorin
#, fuzzy,badformat
msgid "Error in %s"
msgstr "% S hatası"

#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Derleyici dosya adında hata var:"

#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Özel derleyici seçenekleri (Diğer) hata:"

#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Özel bağlayıcı seçenekleri hatası (Derleyici ve bağlayıcı / geçiş seçenekleri linker):"

#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "\" Hata ayıklayıcı yolu ek \\ \"hatası \": "

#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "\" Dosya ekle \\ \"için arama yolunda hata var:"

#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "\" Kitaplıklar \\ \"için arama yolunda hata var"

#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "\" Nesne dosyaları \\ \"için arama yolunda hata var:"

#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "\" Diğer kaynaklar \\ \"için arama yolunda hata var\": "

#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "\" Diğer birimler dosyaları \\ \"için arama yolundaki hata:"

#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "\" Birim çıktı dizini \\ \"hatası:"

#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "Error: (lazarus) invalid build mode \"%s\""
msgstr "Hata: (lazarus) geçersiz yapı modu \" %s \\ \""

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Dosya yüklenirken hata oluştu"

#: lazarusidestrconsts.liserrorloadingfile2
#, fuzzy,badformat
msgid "Error loading file \"%s\":"
msgstr "\"% S \\ \"dosyasını yüklerken hata oluştu:\" "

#: lazarusidestrconsts.liserrorloadingfrom
#, fuzzy,badformat
msgid "Error loading %s from%s%s%s%s"
msgstr "% S %s %s %s adresinden %s yüklenirken hata oluştu"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Bileşeni hareket ettirirken hata oluştu"

#: lazarusidestrconsts.liserrormovingcomponent2
#, fuzzy,badformat
msgid "Error moving component %s:%s"
msgstr "% S bileşenini taşıma hatası: %s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Bileşen adlandırma hatası"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Bileşen açılırken hata oluştu"

#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr ""

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Lfm bileşen akışının ayrıştırılması sırasında hata oluştu."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, fuzzy,badformat
msgid "Error reading package list from file%s%s%s%s"
msgstr "% S %s %s %s dosyasından paket listesi okunurken hata oluştu"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "XML okunurken hata oluştu"

#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Xml dosyası okunurken hata oluştu \" %s \\ \" %s %s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Dosya yeniden adlandırılırken bir hata oluştu"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Hatalar"

#: lazarusidestrconsts.liserrors2
msgid ", Errors: %s"
msgstr ", Hatalar: %s"

#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr ""

#: lazarusidestrconsts.liserrorsavingto
#, fuzzy,badformat
msgid "Error saving %s to%s%s%s%s"
msgstr "% S, %s %s %s %s'ye kaydedilirken hata oluştu"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, fuzzy,badformat
msgid "Error setting the name of a component %s to %s"
msgstr "% S bileşeninin adını %s olarak ayarlama hatası"

#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr "Dosya \" %s \\ \"yazarken hata oluştu"

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, fuzzy,badformat
msgid "Error writing package list to file%s%s%s%s"
msgstr "% S %s %s %s dosyasına paket listesi yazarken hata oluştu"

#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "Eval ifadesi"

#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "Değerlendirmek"

#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr "& Değiştir / değerlendirin"

#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr "Etkinlikleri Temizle"

#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr "Olay Günlüğü Seçenekleri ..."

#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr "Etkinlikleri Dosyaya Kaydet"

#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr "Yorum ekle ..."

#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr "Yorum ekle"

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number"
msgstr "Her ninci satır numarası"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Örnek dosyası:"

#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr "Build all selected"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Örnekler: %sIdentifier %sTMyEnum.Enum %sUnitname.Identifier %s # PackageName.UnitName.Identifier"

#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr "Önce açık seçili"

#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Hata ayıklayıcı Özel Durum Bildirimi"

#: lazarusidestrconsts.lisexcludedatruntime
#, fuzzy,badformat
msgid "%s excluded at run time"
msgstr "% S çalışma zamanında hariç tutuldu"

#: lazarusidestrconsts.lisexecutableisadirectory
msgid "executable \"%s\" is a directory"
msgstr "Çalıştırılabilir \" %s \\ \"bir dizin"

#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
msgid "executable \"%s\" lacks the permission to run"
msgstr "Çalıştırılabilir \" %s \\ \"çalıştırılacak izin yok"

#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Sonra komut çalıştırılıyor"

#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Önce komut çalıştırılıyor"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Yürütme durduruldu"

#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Çıkış"

#: lazarusidestrconsts.lisexitcode
msgid "Exit code %s"
msgstr "Çıkış kodu %s"

#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr "Hepsini genişlet (*)"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Tüm sınıfları genişlet"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Tüm paketleri genişlet"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Tüm birimleri genişlet"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Geçerli düzenleyici dosyasının genişletilmiş dosya adı"

#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "İhracat"

#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr "Tümünü dışa aktar"

#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Tüm Öğeleri Dosyaya Ver"

#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr "Dışa aktarma ortamı seçenekleri"

#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "HTML olarak dışa aktarma"

#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr "İthalat ihracat"

#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "İhracat listesi"

#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr "Dışa aktarma paket listesi (* .xml)"

#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr "Seçilenleri dışa aktar"

#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr "İhracat >>"

#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "İfade:"

#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
#, fuzzy,badformat
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
msgstr "\"% S \\ \"paketinin dosya arama yolunu %s \" %s \\ \"ile genişletilsin mi?"

#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
msgid "Extend include files search path of project with%s\"%s\"?"
msgstr "Projenin include dosya arama yolunu %s ile genişlet \" %s \\ \"?"

#: lazarusidestrconsts.lisextendincludepath
msgid "Extend include path?"
msgstr "Rotayı genişlet\""

#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Birim yolunu genişletilsin mi?"

#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
msgstr "Paketin birim arama yolunu \" %s \\ \" %s \" %s \\ \"ile uzat?"

#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
msgid "Extend unit search path of project with%s\"%s\"?"
msgstr "Projenin birim arama yolunu %s ile genişlet\" %s \\ \"?"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Özü"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Çıkarma Prosedürü"

#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Son derece Verbose"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Harici Araçlar"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Maksimum Araçlar ulaştı"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "En fazla %s araç var."

#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
#, fuzzy,badformat
msgid "Failed to add %d not unique resource(s)"
msgstr "% D benzersiz kaynak (lar) eklenemedi"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
#, fuzzy,badformat
msgid "Failed to create Application Bundle for \"%s\""
msgstr "\"% S \\ \"için Uygulama Paketi oluşturulamadı."

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Katlama durumu yüklenemedi"

#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "Makroları çözemedim"

#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "Dosya kaydedilemedi."

#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr "Ölümcül"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Tasarımcı boyamayı azaltın"

#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Tasarımcı öğelerini sadece boşta boyayın (yavaş bilgisayarlar için yükü azaltın)"

#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Dosya"

#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Dosya: "

#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
msgstr " %s \" %s \\ \" %s bir metin dosyası gibi görünmüyor.% S Açılsın mı?"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Programların dosya uzantıları"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Dosya filtresi"

#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Dosya Filtreleri"

#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Satır ekle"

#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Satırı Sil"

#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Satır Ekle"

#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Dosya maskesi"

#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Varsayılanları ayarla"

#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Bunlar, tüm Dosya Aç iletişim kutularında görünecek dosya filtreleridir"

#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr ""

#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File \"%s\" has changed. Save?"
msgstr "Dosya \" %s \\ \"değişti Kaydet mi?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Dosyanın hiçbir proje yok"

#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Dosya dizinidir"

#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Dosya yürütülebilir değil"

#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Dosya yazılabilir değil"

#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Dosya sembolik bağ"

#: lazarusidestrconsts.lisfileisvirtual
msgid "File \"%s\" is virtual."
msgstr "Dosya \" %s \\ \"sanal."

#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Dosya bağlantısı hatası"

#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Dosya adı / Adresi"

#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr "Dosya Adı Stili"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Dosya bulunamadı"

#: lazarusidestrconsts.lisfilenotfound2
msgctxt "lazarusidestrconsts.lisfilenotfound2"
msgid "File \"%s\" not found."
msgstr "Dosya \" %s \\ \"bulunamadı."

#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr "Dosya %s bulunamadı"

#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "dosya bulunamadı"

#: lazarusidestrconsts.lisfilenotfound5
msgid "File not found:%s%s"
msgstr "Dosya bulunamadı: %s %s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "Dosya \" %s \\ \"bulunamadı %sDinlemek ister misin?"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Dosya küçük harf\" deği"

#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Dosya değil metin"

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Dosya Ayarları"

#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr "Dosya %s yanlış sözdizimi var."

#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Dosyalar: %s, Kayıt işlemi var: %s, içinde paket kullanıyor: %s"

#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Bulunan tüm dosyalarda zaten doğru kodlama var ***"

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "ASCII veya UTF-8 kodlamalı dosyalar"

#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr "Dosya %s metin formatına dönüştürülür."

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "ASCII'de değil UTF-8 kodlamalı dosyalar"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
#, fuzzy
#| msgid "file, where debug output is written to. If it is not specified, debug output is written to the console."
msgid "file where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "Dosyası, burada hata ayıklama çıktısının yazıldığı belirtilirse, hata ayıklama çıktısı co yazılır"

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtre"

#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Filtre: %s"

#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr "Belli türdeki tüm iletileri filtreleyin"

#: lazarusidestrconsts.lisfilterallmessagesoftype
#, fuzzy,badformat
msgid "Filter all messages of type %s"
msgstr "% S türündeki tüm iletileri filtreleyin"

#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "Filtre zaten var"

#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Filtre Hata Mesajları ve Aşağıda"

#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Filtre İpuçları ve aşağıda"

#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Kaynak Konum Olmadan İpuçları Filtreleme"

#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "Filtre Yok, acil olarak filtreleme"

#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Acil olmayan mesajları süz"

#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "Filtre Notları ve altındaki"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Filtre Setleri"

#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Mevcut seçenekleri listele"

#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Ayrıntılı Mesajları Filtreleyin ve Altında"

#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Filtreleme Uyarıları ve aşağıda"

#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Bul ..."

#: lazarusidestrconsts.lisfinddeclarationof
#, fuzzy,badformat
msgid "Find Declaration of %s"
msgstr "% S Bildirisini Bul"

#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "D irectories"

#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "Fi ve le maskesi"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Include & alt dizinleri"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "& Çok satırlı desen"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "Içindeki & projedeki tüm dosyaları ara"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "Tümünü arayın ve dosyaları açın"

#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr "Içinde arama ve etkin dosya"

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "Dizinlerde arama"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Nerede"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Anahtar kombinasyonunu bul"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Eksik birimi bulun"

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "İlk"

#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr "İlk sınama"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "LFM dosyasını düzelt"

#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Kayan nokta"

#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Odaklanma ipucu"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Force renaming"

#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr "Örneğin en üstte yerel değişkenleri, daha sonra mevcut sınıfın üyelerini, sonra aneslerin üyelerini göste"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Form"

#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr ""

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Format hatası"

#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr "Windows için"

#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr "Sürüm %s bulundu, bekleniyor %s"

#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr "Bir sayı olarak FPC sürümü (ör. 20701)"

#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "Fpcmake başarısız oldu"

#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr "FPC ileti dosyası:"

#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr "FPC mesajları: Ek"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr "FPC kaynakları (.res)"

#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "FPC kaynakları"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC çok eski"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "FPC Sürümü:"

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "FPC Sürümü (ör. 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "FPDoc Editör"

#: lazarusidestrconsts.lisfpdocerrorwriting
#, fuzzy,badformat
msgid "Error writing \"%s\"%s%s"
msgstr "\"% S \\ \" %s %s yazılırken hata oluştu"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "FPDoc sözdizimi hatası"

#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "FPDoc paket adı:"

#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "FPDoc paket adı, varsayılan proje dosyası adıdır."

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Fpdoc öğesinde \" %s \\ \"bir sözdizimi hatası var: %s %s"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Çerçeve"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "Ve Geriye doğru arama"

#: lazarusidestrconsts.lisfreeingbufferlines
msgid "freeing buffer lines: %s"
msgstr "Arabellek satırlarını boşaltma: %s"

#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Ücretsiz Pascal Derleyici mesajları"

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Free Pascal kaynak dizini"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Savaşmak ve Ara"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Aranacak diğer dosyalar (ör. /path/*.pas ;/path2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Tanımlayıcı Bul veya Yeniden Adlandır"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Referansları Bul"

#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Tanımlayıcı: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "Açık paket ve projelerde"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "Geçerli birimde"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "Ana projede"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "Projede / pakette mevcut birimde"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Geçersiz Tanımlayıcı"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Tüm başvuruları yeniden adlandır"

#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr "Yeniden adlandırma"

#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr "Arama"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Yorumları da ara"

#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Tam"

#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "İşlev"

#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Genel"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "Geçerli imleç konumunda kelime olsun"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr ""

#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr "Genel Ayarlar"

#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Goto Line"

#: lazarusidestrconsts.lisgotoselected
msgid "Goto selected"
msgstr "Git seçildi"

#: lazarusidestrconsts.lisgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Grup"

#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr "Var olan \" %s \\ \"grubuna ata?"

#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr "\" \"\" %s \\ \"grubuna daha fazla kesme noktası atanmadı, silinsin mi?"

#: lazarusidestrconsts.lisgroupemptydeletemore
#, fuzzy,badformat
msgid "%sThere are %d more empty groups, delete all?"
msgstr "% SDaha fazla boş grup var, hepsini silinsin mi?"

#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr "Grup otomatik olarak tanımlanan yerel değişkenleri"

#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr "Grup adı boş olamaz Clear breakpoints grub (lar)?"

#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr "Grup ismi:"

#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr "Kesme noktası grubu adı, geçerli Pascal tanımlayıcı adı olmalıdır."

#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr "Set new group ..."

#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr "Temiz grup (lar)"

#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr "Hata giderme çıktı gruplarını etkinleştir veya devre dışı bırak.\" Geçerli Seçenekler şunlardır: "

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "En büyümek"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Yardım var"

#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr "Başlık renkleri"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Sınıf için üstbilgi açıklaması"

#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Yardım"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Yardım girdileri"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Seçici yardım"

#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Onaltılık"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Free Pascal Derleyici mesajı için yardım"

#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "IDE yönergeleri {% H-}\" ekleyerek tüm ipuçlarını ve uyarılarını gizle "

#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
#, fuzzy,badformat
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "% S adresindeki mesajı IDE yönergesi {% H-}\" ekleyerek gizle "

#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "IDE direktifi {% H-}\" ekleyerek iletiyi gizle "

#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr ""

#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Aramayı Gizle"

#: lazarusidestrconsts.lishidewindow
#, fuzzy
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Pencereyi gizle"

#: lazarusidestrconsts.lishidewithpackageoptionvm
msgid "Hide with package option (-vm%s)"
msgstr "Paketle gizle seçeneği (-vm %s)"

#: lazarusidestrconsts.lishidewithprojectoptionvm
msgid "Hide with project option (-vm%s)"
msgstr "Projeyle gizle seçeneği (-vm %s)"

#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "İpucu"

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "İpucu: Koşullarda varsayılan bir değer tanımlanabilir."

#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr "Mülkiyet adına verilen bir ipucu onun açıklamasını göstermektedir."

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "İpucu: İki paketin aynı ada sahip bir birimi olup olmadığını kontrol edin."

#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr ""

#: lazarusidestrconsts.lishints
msgid ", Hints: %s"
msgstr ", İpuçları: %s"

#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Hepsini kaydet"

#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "İçine adım"

#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "İşlev geri dönene kadar çalıştır"

#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Adım atmak"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, fuzzy,badformat
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "İpucu: \" Yer İmlerinizi Oluştur \\ \"işlevi bir dize sabiti beklemektedir.% SÜzgileri seçi"

#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Form / Birim Değiştir"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Formları Görüntüle"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Birimleri Görüntüle"

#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Hitcount"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Veritabanları"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Yardım Seçenekleri"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Özellikleri:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "İzleyiciler"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "FPC Doc HTML Yolu"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Yatay"

#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr "Özellikler arasında yatay çizgiler var."

#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "İD"

#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr "İlave"

#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr "Açılış"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "IDE kurulum seçenekleri"

#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "IDE paketleri kurulurken / kaldırılırken yeniden derlenecek ve yeniden başlatılacak."

#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
#, fuzzy,badformat
#| msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts, and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration, but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Lazarus'a hoş geldiniz.% 0: s Bulunan IDE yapılandırması daha önce başka bir kurulum tarafından kullanılmış"

#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
#, fuzzy,badformat
msgid "Creating Makefile for package %s"
msgstr "% S paketi için Makefile oluşturuluyor"

#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Hata: '' %s paketi başarısız 'derlemesinden sonra çalışıyor"

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "IDE hakkında bilgi"

#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "UYARI: birim adı geçersiz %s, paket = %s"

#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "IDE Makroları"

#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr ""

#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "IDE ana ünitede başlık tutar."

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "Tanımlayıcı"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Tanımlayıcı başlıyor ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Tanımlayıcı içeriyor ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "IDE Seçenekleri:"

#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr "IDE başlık seçili yapı modunu gösterir"

#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr "IDE title proje dizinini gösterir"

#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "IDE başlığı proje adı ile başlar"

#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Tüm yapı modları"

#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Derleyici seçenekleri"

#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Geçerli kurulum modu"

#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "XML açılırken hata oluştu"

#: lazarusidestrconsts.lisiecoerroropeningxmlfile
msgid "Error opening XML file \"%s\":%s%s"
msgstr "XML dosyası \" %s \\ \"açılırken hata oluştu: %s %s"

#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Derleyici Seçeneklerini Dışa Aktar"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Dışa aktarma dosyası var"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "İhracat dosyası \" %s \\ \"var %sOpen dosyası ve sadece derleyici seçeneklerini değiştir\" %s (Diğer ayarla"

#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Alma Derleyici Seçenekleri"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Dosyadan yükle"

#: lazarusidestrconsts.lisieconocompileroptionsinfile
msgid "File \"%s\" does not contain compiler options."
msgstr "Dosya \" %s \\ \"derleyici seçenekleri içermiyor."

#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Son Dosyalar"

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Dosyaya kaydet"

#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "Kontrol edilmediyse:"

#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr "Yalnızca oturum bilgileri değiştiyse, kaydetme hakkında bilgi isteyin."

#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, fuzzy,badformat
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "İki farklı Lazarus versiyonunu kullanmak istiyorsanız, ikinci Lazarus'u comm ile başlatmalısınız"

#: lazarusidestrconsts.lisignore
msgctxt "lazarusidestrconsts.lisignore"
msgid "Ignore"
msgstr "Aldırmamak"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Hepsini Yoksay"

#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Yoksay ve devam et"

#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Bu istisna türü yoksay"

#: lazarusidestrconsts.lisignoreuseasancestor
msgid "Ignore, use %s as ancestor"
msgstr "Yoksay, %s atası olarak kullan"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Mevcut birimin, projenin veya paketin taklitini taklit edin"

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Sınıf için uygulama yorumu"

#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "İthalat"

#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr "Önemli"

#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr "İçe aktarma ortamı seçenekleri"

#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Dosya İçe Aktarma"

#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr "Yapı Modellerini İçe Aktarma, paketler için desteklenmiyor."

#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "İçe aktarma listesi"

#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr "Alma paketi listesi (* .xml)"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "İmkansız"

#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr "Paketin kaynak dizininde \" %s \\ \"."

#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "Projenin bir kaynak dizininde çoğaltıcı olup olmadığını kontrol edin."

#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr "Tüm alt dizinleri dahil et"

#: lazarusidestrconsts.lisincludefilter
msgid "Include filter"
msgstr "Filtre ekle"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "Yolu ekle"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Yolları ekle"

#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr "Alt dizinleri dahil et"

#: lazarusidestrconsts.lisincompatibleppu
msgid ", incompatible ppu=%s"
msgstr ", Uyumsuz ppu = %s"

#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Yanlış yapılandırma dizini bulundu"

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Pascal kaynakları için girinti"

#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Dizin"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Bilgi"

#: lazarusidestrconsts.lisinformationaboutunit
#, fuzzy,badformat
msgid "Information about %s"
msgstr "% S hakkında bilgi"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Kullanılmış FPC hakkında bilgi"

#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "FPC birimi arama yolunda Muhtemelen FPC paketi ile kurulmuştur Derleyici ve pp"

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "İlişkili olarak"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Devralınan Öğe"

#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Devralınan parametreler"

#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Devralınan proje bileşeni"

#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr "Yerel Değişken Başlat"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, fuzzy,badformat
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Proje / paketin temiz bir kopyasını oluşturmak için, aşağıdaki dizindeki tüm dosyala"

#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Ekle"

#: lazarusidestrconsts.lisinsertassignment
msgid "Insert Assignment %s := ..."
msgstr "Atama Ekle %s: = ..."

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Tarih ekle"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Tarih ve saat ekle"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
#, fuzzy
#| msgid "Insert date and time. Optional: format string"
msgid "Insert date and time. Optional: format string."
msgstr "Ekle tarih ve saati İsteğe bağlı: biçim dizesi"

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
#, fuzzy
#| msgid "Insert date. Optional: format string"
msgid "Insert date. Optional: format string."
msgstr "Ekle tarihi. İsteğe bağlı: biçim dizesi"

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "Gerektiğinde sonunu yerleştir"

#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart,          // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName,       // extract/add ClassName.\n"
"WithoutClassName,   // skip classname\n"
"WithoutName,        // skip function name\n"
"WithoutParamList,   // skip param list\n"
"WithVarModifiers,   // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes,  // skip colon, param types and default values\n"
"WithDefaultValues,  // extract default values\n"
"WithResultType,     // extract colon + result type\n"
"WithOfObject,       // extract 'of object'\n"
"WithCallingSpecs,   // extract cdecl; inline;\n"
"WithProcModifiers,  // extract forward; alias; external;\n"
"WithComments,       // extract comments and spaces\n"
"InUpperCase,        // turn to uppercase\n"
"CommentsToSpace,    // replace comments with a single space\n"
"                      //  (default is to skip unnecessary space,\n"
"                      //    e.g 'Do   ;' normally becomes 'Do;'\n"
"                      //    with this option you get 'Do ;')\n"
"WithoutBrackets,    // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon,   // skip semicolon at end\n"
msgstr ""

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Ekle Makro"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
#, fuzzy
#| msgid "Insert name of current procedure"
msgid "Insert name of current procedure."
msgstr "Geçerli yordamın adını ekle"

#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Yazdırma kısayolu ekle"

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Yazdırma kısayolu ekle"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "Insert procedure head"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "Insert procedure name"

#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr ""

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "Takma zamanı"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
#, fuzzy
#| msgid "Insert time. Optional: format string"
msgid "Insert time. Optional: format string."
msgstr "Ekle zamanı, isteğe bağlı: biçim dizesi"

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "URL etiketi ekle"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "Seansta, oturumda, toplantıda"

#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "& Inceleyin"

#: lazarusidestrconsts.lisinspectclassinherit
#, fuzzy,badformat
#| msgid "%s : Class %s inherits from %s"
msgid "%s: class %s inherits from %s"
msgstr "% S: %s sınıfı %s kaynağından devralındı."

#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Veri"

#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Hata Ayıklama Denetçisi"

#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Yöntemler"

#: lazarusidestrconsts.lisinspectpointerto
#, fuzzy,badformat
msgid "Pointer to %s"
msgstr "% S işaretçisi"

#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Özellikleri"

#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr "Sınıf sütununu göster"

#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr "Tip sütununu göster"

#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr "Görünürlük sütununu göster"

#: lazarusidestrconsts.lisinspectunavailableerror
msgid "%s: unavailable (error: %s)"
msgstr ""

#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr "Örnek"

#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr "Örnek sınıfını kullanın"

#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Yükleme başarısız"

#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "Yüklü"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Yükle, yağ seviyorum"

#: lazarusidestrconsts.lisinstallpackagesmsg
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?\n"
msgstr ""

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Seçimi yükle"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Paketleri Yükle / Kaldır"

#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr "Derleme paketi yerine basit bir Makefile oluşturun."

#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr "Yetersiz kodlama"

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Etkileşimli"

#: lazarusidestrconsts.lisinternalerror
msgid "internal error: %s"
msgstr "Dahili hata: %s"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Geçersiz silme"

#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr "Geçersiz Yürütülebilir"

#: lazarusidestrconsts.lisinvalidexecutablemessagetext
#, fuzzy,badformat
msgid "The file \"%s\" is not executable."
msgstr "\"% S \\ \"dosyası yürütülebilir değil."

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, fuzzy,badformat
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Geçersiz ifade.% SHint: \" Resourcestring \\ \"işlevi si'de bir dizge sabiti bekle"

#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr ""

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Geçersiz filtre"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Geçersiz satır, ileti %s %s sütundaki sütun"

#: lazarusidestrconsts.lisinvalidmacrosin
#, fuzzy,badformat
msgid "Invalid macros in \"%s\""
msgstr "\"% S \\ \"\" daki geçersiz makrolar "

#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Harici araç \" %s \\ \"daki \" %s \\ \"geçersiz makrolar \\"

#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "\" \\ \" %s \" geçersiz makro. Makro adı Pascal tanımlayıcı olmalı. "

#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Geçersiz makro adı \" %s \\ \". Ad bir anahtar kelime."

#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Geçersiz Maske"

#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Geçersiz mod %s"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Geçersiz çoklu seçim"

#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Geçersiz (Kapalı)"

#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Geçersiz (Açık)"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Geçersiz Pascal Tanımlayıcı"

#: lazarusidestrconsts.lisinvalidpascalidentifiername
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr ""

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Geçersiz proc adı"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Geçersiz proje dosyası"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Geçersiz yayınlama Dizini"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Geçersiz seçim"

#: lazarusidestrconsts.lisinvalidversionin
#, fuzzy,badformat
msgid "invalid version in %s"
msgstr "% S sürümü geçersiz"

#: lazarusidestrconsts.lisisalreadypartoftheproject
#, fuzzy,badformat
msgid "%s is already part of the Project."
msgstr "% S zaten Projenin bir parçası."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, fuzzy,badformat
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"% S \\ \"geçersiz bir proje adıdır %sLütfen başka birini seçin (ör. Project1.lpi)"

#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
#, fuzzy,badformat
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "% S bir %s.% SBu döngüsel bağımlılığa izin verilmedi."

#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "Dizin bulunamadı"

#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Sorunlar"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr "Bunu nasıl yaptığını merak ediyorum, %s hatası:"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Bunu nasıl yaptığını merak ediyorum: Temel dizindeki hata:"

#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Geçiş Geçmişi"

#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr "Hataya atla"

#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr "Kaynaktaki bir hata tanımlayıcı tamamlandıktan sonra bulunursa atla."

#: lazarusidestrconsts.lisjumptoprocedure
#, fuzzy,badformat
msgid "Jump to procedure %s"
msgstr "% S yordamına atla"

#: lazarusidestrconsts.liskb
#, fuzzy,badformat
msgid "%s KB"
msgstr "% S KB"

#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Tut"

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Dönüştürülen dosyaları düzenleyicide açık tut"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Tüm proje dosyaları dönüştürmeden sonra editörde açılacaktır"

#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Kurulum listesinde sakla"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Adını koru"

#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr ""

#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "Çok satırlı şablonun göreli girintisini korumak"

#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "Girintiyi tut"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Onları sakla ve devam et"

#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Anahtar"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Özel komutlar"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Tasarımcı komutları"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Nesne Denetleyici komutları"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Anahtar (veya iki anahtar dizisi)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "İnşaattan vazgeç"

#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Adres Kesme Noktası Ekle"

#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Kaynak kesme noktası ekle"

#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Veri / İzleme Noktası Ekle"

#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Saat ekle"

#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Pek çok mod oluşturun"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Proje / program oluştur"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Keymaping scheme'ı seçin"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klasik"

#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Temizle ve derle"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Projeyi kapat"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "CodeTools editörü tanımlıyor"

#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Proje / program derleyin"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "Config \" Yapı Dosyası \\ \""

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Özel Bileşenleri Yapılandırma"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Bağlama duyarlı yardım"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Delphi paketini Lazarus paketine dönüştürme"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Delphi Projesini Lazarus Projesine Dönüştürme"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Delphi Birimini Lazarus Birimine Dönüştür"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "DFM Dosyasını LFM'ye Dönüştür"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
#, fuzzy
#| msgid "Copy selected Components to clipboard"
msgid "Copy selected components"
msgstr "Seçili Bileşenleri panoya kopyala"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
#, fuzzy
#| msgid "Cut selected Components to clipboard"
msgid "Cut selected components"
msgstr "Seçili Bileşenleri panoya kopyala"

#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr ""

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Son harfi sil"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "Diff Editör Dosyaları"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Kod Şablonlarını Düzenle"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Bağlama duyarlı yardımını düzenle"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Seçimi örtün"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Değiştir / değerlendirin"

#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr "Örnek Projeler"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Harici Araçlar ayarları"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Artımlı Bul"

#: lazarusidestrconsts.liskmgotomarker0
#, fuzzy
#| msgid "Go to marker 0"
msgid "Go to bookmark 0"
msgstr "0 işaretine git"

#: lazarusidestrconsts.liskmgotomarker1
#, fuzzy
#| msgid "Go to marker 1"
msgid "Go to bookmark 1"
msgstr "İşaretleyiciye git 1"

#: lazarusidestrconsts.liskmgotomarker2
#, fuzzy
#| msgid "Go to marker 2"
msgid "Go to bookmark 2"
msgstr "2. işaretçiye git"

#: lazarusidestrconsts.liskmgotomarker3
#, fuzzy
#| msgid "Go to marker 3"
msgid "Go to bookmark 3"
msgstr "3. işaretçiye git"

#: lazarusidestrconsts.liskmgotomarker4
#, fuzzy
#| msgid "Go to marker 4"
msgid "Go to bookmark 4"
msgstr "4 numaralı işaretçiye git"

#: lazarusidestrconsts.liskmgotomarker5
#, fuzzy
#| msgid "Go to marker 5"
msgid "Go to bookmark 5"
msgstr "İşaretleyiciye git 5"

#: lazarusidestrconsts.liskmgotomarker6
#, fuzzy
#| msgid "Go to marker 6"
msgid "Go to bookmark 6"
msgstr "İşaretleyiciye git 6"

#: lazarusidestrconsts.liskmgotomarker7
#, fuzzy
#| msgid "Go to marker 7"
msgid "Go to bookmark 7"
msgstr "İşaretçiye git 7"

#: lazarusidestrconsts.liskmgotomarker8
#, fuzzy
#| msgid "Go to marker 8"
msgid "Go to bookmark 8"
msgstr "İşaretleyiciye git 8"

#: lazarusidestrconsts.liskmgotomarker9
#, fuzzy
#| msgid "Go to marker 9"
msgid "Go to bookmark 9"
msgstr "İşaretleyiciye git 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Kaynak editöre git 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Kaynak editöre git 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Kaynak editörüne git 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Kaynak editöre git 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Kaynak editörüne git 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Kaynak editöre git 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Kaynak editöre git 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Kaynak editöre git 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Kaynak editöre git 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Kaynak editöre git 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Tarih ve saat ekle"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Kullanıcı adını ekle"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Kontrol"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Keymaping Scheme"

#: lazarusidestrconsts.liskmlazarusdefault
#, fuzzy
#| msgid "Lazarus (default)"
msgid "Lazarus default"
msgstr "Lazarus (varsayılan)"

#: lazarusidestrconsts.liskmmacosxapple
#, fuzzy
#| msgid "Mac OS X (Apple style)"
msgid "macOS, Apple style"
msgstr "Mac OS X (Apple stili)"

#: lazarusidestrconsts.liskmmacosxlaz
#, fuzzy
#| msgid "Mac OS X (Lazarus style)"
msgid "macOS, Lazarus style"
msgstr "Mac OS X (Lazarus tarzı)"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Yeni paket"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Yeni proje"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Dosyadan yeni proje"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Yeni Birim"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Not: Tüm tuşlar, seçilen şema değerlerine ayarlanacaktır."

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Paket dosyası aç"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
#, fuzzy
#| msgid "Paste Components from clipboard"
msgid "Paste Components"
msgstr "Bileşenleri panodan yapıştırın"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Programı duraklatın"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Yayınla projesi"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Hızlı derleme, bağlama yok"

#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Aktif Dosyayı Projeden Kaldır"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Programı çalıştır"

#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "Hepsini kaydet"

#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "Farklı kaydet"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Projeyi kaydet"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Projeyi farklı kaydet"

#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Satır Sonunu Seçin"

#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Satır Başlamasını Seç"

#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Sayfa Altını Seç"

#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Sayfa Üstünü Seç"

#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Word Sol Seç"

#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Doğru Word'yi seçin"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Ücretsiz yer imi ayarla"

#: lazarusidestrconsts.liskmsetmarker0
#, fuzzy
#| msgid "Set marker 0"
msgid "Set bookmark 0"
msgstr "Set marker 0"

#: lazarusidestrconsts.liskmsetmarker1
#, fuzzy
#| msgid "Set marker 1"
msgid "Set bookmark 1"
msgstr "Set marker 1"

#: lazarusidestrconsts.liskmsetmarker2
#, fuzzy
#| msgid "Set marker 2"
msgid "Set bookmark 2"
msgstr "Set marker 2"

#: lazarusidestrconsts.liskmsetmarker3
#, fuzzy
#| msgid "Set marker 3"
msgid "Set bookmark 3"
msgstr "Set marker 3"

#: lazarusidestrconsts.liskmsetmarker4
#, fuzzy
#| msgid "Set marker 4"
msgid "Set bookmark 4"
msgstr "Set marker 4"

#: lazarusidestrconsts.liskmsetmarker5
#, fuzzy
#| msgid "Set marker 5"
msgid "Set bookmark 5"
msgstr "Set marker 5"

#: lazarusidestrconsts.liskmsetmarker6
#, fuzzy
#| msgid "Set marker 6"
msgid "Set bookmark 6"
msgstr "Set marker 6"

#: lazarusidestrconsts.liskmsetmarker7
#, fuzzy
#| msgid "Set marker 7"
msgid "Set bookmark 7"
msgstr "Set marker 7"

#: lazarusidestrconsts.liskmsetmarker8
#, fuzzy
#| msgid "Set marker 8"
msgid "Set bookmark 8"
msgstr "Set marker 8"

#: lazarusidestrconsts.liskmsetmarker9
#, fuzzy
#| msgid "Set marker 9"
msgid "Set bookmark 9"
msgstr "Set marker 9"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Programı Kes"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Birim ve Form arasında geçiş yapma"

#: lazarusidestrconsts.liskmtogglemarker0
#, fuzzy
#| msgid "Toggle marker 0"
msgid "Toggle bookmark 0"
msgstr "İşaretçi 0 değiştir"

#: lazarusidestrconsts.liskmtogglemarker1
#, fuzzy
#| msgid "Toggle marker 1"
msgid "Toggle bookmark 1"
msgstr "Toggle marker 1"

#: lazarusidestrconsts.liskmtogglemarker2
#, fuzzy
#| msgid "Toggle marker 2"
msgid "Toggle bookmark 2"
msgstr "İşaretçi 2'yi değiştir"

#: lazarusidestrconsts.liskmtogglemarker3
#, fuzzy
#| msgid "Toggle marker 3"
msgid "Toggle bookmark 3"
msgstr "Toggle marker 3"

#: lazarusidestrconsts.liskmtogglemarker4
#, fuzzy
#| msgid "Toggle marker 4"
msgid "Toggle bookmark 4"
msgstr "Toggle marker 4"

#: lazarusidestrconsts.liskmtogglemarker5
#, fuzzy
#| msgid "Toggle marker 5"
msgid "Toggle bookmark 5"
msgstr "Toggle marker 5"

#: lazarusidestrconsts.liskmtogglemarker6
#, fuzzy
#| msgid "Toggle marker 6"
msgid "Toggle bookmark 6"
msgstr "Toggle marker 6"

#: lazarusidestrconsts.liskmtogglemarker7
#, fuzzy
#| msgid "Toggle marker 7"
msgid "Toggle bookmark 7"
msgstr "Toggle marker 7"

#: lazarusidestrconsts.liskmtogglemarker8
#, fuzzy
#| msgid "Toggle marker 8"
msgid "Toggle bookmark 8"
msgstr "Toggle marker 8"

#: lazarusidestrconsts.liskmtogglemarker9
#, fuzzy
#| msgid "Toggle marker 9"
msgid "Toggle bookmark 9"
msgstr "Toggle marker 9"

#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Birleştirici Görüntüle"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Kesme noktalarını görüntüle"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Çağrı Yığını Göster"

#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Görünüm Kod Tarayıcısını Aç / Kapat"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Görünüm Kod Gezgini'ni aç / kapat"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Görünüm Bileşen Paletini Aç / Kapat"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Debuger Olay Günlüğünü Görüntüle"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Görüntüleyici Hata Ayıklayıcı Çıktısı"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Toggle view Documentation Editor"

#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Geçmişi Görüntüle"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Görünüm IDE hız düğmelerini aç / kapat"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Yerel Değişkenleri Görüntüle"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Görünüm İletilerini Aç / Kapat"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Görüntü Nesnesi Müfettişini Aç / Kapat"

#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
#, fuzzy
#| msgid "View Terminal Output"
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr "Terminal Çıkışını Görüntüle"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Kayıtları Görüntüle"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Görüntüleme Arama Sonuçlarını Aç / Kapat"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Görünüm Kaynak Düzenleyicisini Aç / Kapat"

#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Konuları Görüntüle"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Saatleri Görüntüle"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Atlama geçmişini görüntüle"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Proje seçeneklerini görüntüleme"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Proje Kaynağını Görüntüle"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Birim Bilgisini Görüntüle"

#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr "Son açıldı"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Başlatma uygulaması geçersiz"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Hedef komut satırı başlatılıyor"

#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"

#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Lazarus Varsayılan"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Lazarus dizini"

#: lazarusidestrconsts.lislazarusdiroverride
#, fuzzy
#| msgid "directory, to be used as a basedirectory"
msgid "directory to be used as a basedirectory"
msgstr "Dizin, bir alt dizin olarak kullanılacak"

#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v %s"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Lazarus dil kimliği (ör. En, de, br, fi)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Lazarus dil adı (ör. Ingilizce, deutsch)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "Lazarus [seçenekler] <proje-dosya adı>"

#: lazarusidestrconsts.lislazarussvnrev
msgid "r%s"
msgstr ""

#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Aksiyon"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Çalıştırılabilir IDE çıktı dizinini seçin"

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Bu yapı profilini silmek istediğinizden emin misiniz?"

#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Build Many"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Ortak Ayarlar"

#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "İnşaat öncesi onaylayın"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Silmeyi onayla"

#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "Debug IDE"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Tanımlar"

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "-d olmadan tanımlar"

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Düzenle Tanımlar"

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Herhangi bir profil tarafından kullanılabilen tanımların listesi düzenle"

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Dosya yazarken hata oluştu"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr " %s %s %s %slazbuild etkileşimli değil, şimdi iptal ediliyor."

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Build Profillerini Yönet"

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Profilleri yönet"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Etkin profilin adı"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Yeni Profil Ekle"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Mevcut yapı seçenekleri ile ilişkili:"

#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "Normal IDE"

#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "Optimize edilmiş IDE"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Seçenekler:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Seçenekler derleyiciye iletildi"

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Derlemek  için profil"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Profili Yeniden Adlandır"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Profilin yeni adı:"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "IDE kurduktan sonra yeniden başlatın"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "IDE'yi oluşturduktan sonra Lazarus'u otomatik olarak yeniden başlatın (diğer parçaları oluştururken hiçbir etkisi yoktur)"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Oluşturulacak profilleri seçin"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Araçlar menüsünden doğrudan oluştururken onay iletisini göster"

#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Seçenekleri göster ve komut satırı için tanımlar"

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Hedef CPU:"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Hedef dizin:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Hedeflenen İşletim Sistemi:"

#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Dosya \" %s \\ \"yazamadı: %s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Güncelleme revizyon.inc"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "\" Lazarus Hakkında \\ \"iletişim kutusundaki düzeltme bilgisini güncelle"

#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Temizle + Hepsini kur"

#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Lazarus Sürümü (ör. 1.2.4)"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "LCL widget türü"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Devralınan bağlantı ekle"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Devralınan kopyalar"

#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
#, fuzzy,badformat
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "% S geçerli bir FPDoc yolu yok.% S %s için fpdoc dosyası oluşturmaktan vazgeç"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Taşınır girişleri devralınan"

#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Geçerli FPDoc yolu yok"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, fuzzy,badformat
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr " %s birimi herhangi bir paket veya proje değil.% SLütfen birimi bir pakete veya projeye ekleyin"

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Ayrıldı"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Sol kenarlık: Bu değer taban sınırlarına eklenir ve devam için sola boşluk kullanılır"

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Sol çapa"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the left side is anchored. Leave empty for parent."
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Bu, sol tarafın demirlediği kardeş kontrolüdür, ebeveyn için boş bırakın."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Sol taraf"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Boşluk eşit derecede"

#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Az"

#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Düzeyleri"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM dosyası"

#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "LFM dosyası LCL'de bulunmayan bilinmeyen özellikler / sınıflar içeriyor, repla olabilirler"

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "LFM dosyası bozuk"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM tamam"

#: lazarusidestrconsts.lislgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "Kütüphane yolu"

#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr "Ücretsiz bir Pascal paylaşılan kütüphanesi (Windows altında .dll, Linux'ta .so, MacOS X altında .dylib)."

#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Hat:"

#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Hat / Uzunluk"

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Bağlantı:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "Linker seçenekleri"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Bağlantı hedefi"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "Tüm vaka değerlerinin listesi"

#: lazarusidestrconsts.lisloadingfailed
#, fuzzy,badformat
msgid "Loading %s failed."
msgstr "% S yüklenemedi."

#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Makroyu yükle"

#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr ""

#: lazarusidestrconsts.lislocals
#, fuzzy
#| msgid "Locals"
msgctxt "lazarusidestrconsts.lislocals"
msgid "Local Variables"
msgstr "Yerliler"

#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr "& Kopyala Adı"

#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
msgid "Copy &RAW Value"
msgstr ""

#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr "Değerin üzerinde c & opy"

#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr "Yerliler değerlendirilmedi"

#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr "Günlük Çağrı Yığını"

#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr "(Sınırlar sınırı 0 - sınır yok)"

#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "Eval ifadesi"

#: lazarusidestrconsts.lislogmessage
msgid "Log Message"
msgstr "Günlük Mesajı"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "Küçük harfli dize"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
#, fuzzy
#| msgid "Lowercase string given as parameter"
msgid "Lowercase string given as parameter."
msgstr "Parametre olarak verilen küçük harfli dize"

#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "Lpk disk üzerinde kayboldu, alternatif olarak kullanma %s"

#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "Lpk eksik"

#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr "Lazarus kaynakları (.lrs)"

#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Makro %s"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Verileri girin"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Çalıştırma parametrelerini girin"

#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main unit has Application.CreateForm statements"
msgstr "Ana birimde Application.CreateForm ifadeleri var"

#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
msgid "Main unit has Application.Scaled statement"
msgstr ""

#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
msgid "Main unit has Application.Title statement"
msgstr ""

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "Ana birim, tüm proje birimlerini içeren Kullanım Bölümüne sahiptir"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "Ana ünite Pascal kaynağı"

#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr "Pascal'ı .pas / .pp son ekiyle bitmese bile varsayın."

#: lazarusidestrconsts.lismakecurrent
#, fuzzy
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "Geçerli"

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Yürütülebilir Dosyayı Yap"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Bulunamadı"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Make ResourceString"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Bölümüne ekle"

#: lazarusidestrconsts.lismakeresstrchooseanothername
#, fuzzy,badformat
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "\" \" %s \" mevcut kaynak zaten mevcut.% SLütfen başka bir ad seçin.% SUygunsuz eklemek için Yoksay kulla"

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Dönüşüm Seçenekleri"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Özel tanımlayıcı"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Tanıtıcı"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Tanımlayıcı uzunluğu:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Tanımlayıcı öneki:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Alfabetik olarak ekle"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "İçeriğe duyarlı ekle"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Geçersiz Yer İyileştirme bölümü"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Lütfen listeden bir kaynak seçme bölümü seçin."

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Yurdumuzun varlığı zaten var"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Yurdumuzda kalma bölümü:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Kaynak önizleme"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Kaynaktaki sabit sabit"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Aynı değere sahip dizeler:"

#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr "Bir paketin tüm ppu dosyalarının çıkış dizininde olduğundan emin olun."

#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Kaynak Düzenleyicileri Yönet ..."

#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
#, fuzzy
#| msgid "Maximum number of threads for compiling in parallel. Default is 0, which guesses the number of cores in the system."
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr "Paralel olarak derleme için maksimum iş parçacığı sayısı"

#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr "Maksimum paralel işlemler, 0 varsayılan ( %s) anlamına gelir"

#: lazarusidestrconsts.lismaxs
#, fuzzy,badformat
msgid "Max %d"
msgstr "Maks.% D"

#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr " %s Belki de paketi yeniden derlemelisiniz."

#: lazarusidestrconsts.lismb
#, fuzzy,badformat
msgid "%s MB"
msgstr "% S MB"

#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "Aksiyon"

#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Bellek Dökümü"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Yapımı iptal et"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "FPC Hakkında"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Ekle ve Kesme Noktası"

#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Aktif Dosya Paketine Ekle ..."

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Geçmişe Atlama Noktası Ekle"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Editör Dosyasını Projeye Ekle"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Ekle & İzle ..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Seçimde Kesme Hatları"

#: lazarusidestrconsts.lismenubreak
msgid "&Break"
msgstr ""

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Dosya Oluşturma"

#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Mevcut Profille Lazar Oluşturma"

#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with Profile: %s"
msgstr "Lazarus'u Profille oluştur: %s"

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "Düzenleyicide LFM Dosyasını Denetle"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Temiz Dizin ..."

#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Temizle ve kur ..."

#: lazarusidestrconsts.lismenucloseall
msgid "Close A&ll"
msgstr "Hepsini kapat"

#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "& Kapat Editör Dosyası"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Projeyi Kapat"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "CodeTools Düzenleyiciyi Tanımlar ..."

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Yorum Seçimi"

#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Dosyaları karşılaştır ..."

#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr ""

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Komple Kod"

#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr ""

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Yapı Yapı + Dosyayı Çalıştır ..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Özel Bileşenleri Yapılandır ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Dış Araçları Yapılandır ..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configure \" Build Lazarus \\ \"..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Bağlama duyarlı Yardım"

#: lazarusidestrconsts.lismenucontinue
msgid "&Continue"
msgstr ""

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Delphi Paketini Lazarus Paketine Dönüştür ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Delphi Projesini Lazarus Projesine Dönüştür ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Delphi Birimini Lazarus Birimine Dönüştür ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "İkili DFM'yi Metin LFM'ye Dönüştür + Sözdizimini Kontrol Edin ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Projelerin / Paketlerin Kodlamasını Dönüştür ..."

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Windows'u Hata Ayıkla"

#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Delphi Dönüşümü"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "& Edit"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Kod Şablonları ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Bağlama duyarlı Yardımını düzenle"

#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Paketleri Yükle / Kaldır ..."

#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr ""

#: lazarusidestrconsts.lismenueditoraddiconfroms
msgid "Add icon from %s"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr ""

#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr ""

#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr ""

#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr ""

#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr ""

#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr ""

#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr ""

#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr ""

#: lazarusidestrconsts.lismenueditorcaptioneditemss
msgid "Captioned items: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr ""

#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
msgid "Change conflicting accelerator \"%s\""
msgstr ""

#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr ""

#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
msgid "Change %s for %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
msgid "Change shortcut conflict \"%s\""
msgstr ""

#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
msgid "Change the shortCut for %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
msgid "Change the shortCutKey2 for %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr ""

#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr ""

#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr ""

#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr ""

#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr ""

#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr ""

#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
msgid "Conflicts found initially: %d"
msgstr ""

#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
msgid "Deepest nested menu level: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditordeleteitem
#, fuzzy
#| msgid "Delete Item"
msgid "&Delete item"
msgstr "Öğeyi silmek"

#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr ""

#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr ""

#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr ""

#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr ""

#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr ""

#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr ""

#: lazarusidestrconsts.lismenueditoreditingcaptionofs
msgid "Editing Caption of %s"
msgstr ""

#: lazarusidestrconsts.lismenueditoreditingsdots
msgid "To resolve conflict edit %s.%s"
msgstr ""

#: lazarusidestrconsts.lismenueditoreditingsfors
msgid "Editing %s for %s"
msgstr ""

#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
msgid "Editing %s.%s - no menuitem selected"
msgstr ""

#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr ""

#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
msgid "Enter a new ShortCut for %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
msgid "Enter a new ShortCutKey2 for %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr ""

#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr ""

#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr ""

#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr ""

#: lazarusidestrconsts.lismenueditorgroupindexd
msgid "GroupIndex: %d"
msgstr ""

#: lazarusidestrconsts.lismenueditorgroupindexvaluess
msgid "Values in use: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr ""

#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
msgid "Insert menu template into root of %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr ""

#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr ""

#: lazarusidestrconsts.lismenueditoritemswithicons
msgid "Items with icon: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
msgid "List shortcuts and &accelerators for %s ..."
msgstr ""

#: lazarusidestrconsts.lismenueditorlistshortcutsfors
msgid "List shortcuts for %s ..."
msgstr ""

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Menü Düzenleyici"

#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr ""

#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
msgid "Menuitem shortcut conflicts in %s"
msgstr ""

#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Aşağı Taşı (veya sağa)"

#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr ""

#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr ""

#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr ""

#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr ""

#: lazarusidestrconsts.lismenueditormoveselecteditemdown
#, fuzzy
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Seçili öğeyi aşağı taşı"

#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr ""

#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr ""

#: lazarusidestrconsts.lismenueditormoveselecteditemup
#, fuzzy
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Seçili öğeyi yukarı taşı"

#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Yukarı Taşı (veya Sola)"

#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr ""

#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr ""

#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr ""

#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr ""

#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr ""

#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr ""

#: lazarusidestrconsts.lismenueditorpickaniconfroms
msgid "Pick an icon from %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorpopupassignmentss
msgid "Popup assignments: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr ""

#: lazarusidestrconsts.lismenueditorremainingconflictss
msgid "Remaining conflicts: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr ""

#: lazarusidestrconsts.lismenueditorresolvedconflictss
msgid "Resolved conflicts: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr ""

#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr ""

#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr ""

#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr ""

#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr ""

#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr ""

#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr ""

#: lazarusidestrconsts.lismenueditorsconflictswiths
msgid "%s conflicts with %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcutitemss
msgid "Shortcut items: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcutsd
msgid "Shortcuts (%d)"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcutsusedins
msgid "Shortcuts used in %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
msgid "Shortcuts used in %s (%d)"
msgstr ""

#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
msgid "ShowMenuEditor: TMenu parameter is nil"
msgstr ""

#: lazarusidestrconsts.lismenueditorsins
msgid "\"%s\" in %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorsisalreadyinuse
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut.\n"
msgstr ""

#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr ""

#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
msgid "Some widgetsets do not allow separators in the main menubar"
msgstr ""

#: lazarusidestrconsts.lismenueditorsshortcuts
msgid "%s: Shortcuts"
msgstr ""

#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
msgid "%s: Shortcuts and accelerator keys"
msgstr ""

#: lazarusidestrconsts.lismenueditorsssonclicks
msgid "%s.%s.%s - OnClick: %s"
msgstr ""

#: lazarusidestrconsts.lismenueditorssubmenu
msgid "%s submenu"
msgstr ""

#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr ""

#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr ""

#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr ""

#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr ""

#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available.\n"
msgstr ""

#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr ""

#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict\n"
msgstr ""

#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr ""

#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "$ IFDEF'de bulun ..."

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Seçimi Örtmek ..."

#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "E & değerlendire / değiştir ..."

#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr "Örnek Projeler ..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "İşlemi Ayıkla ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Dosya"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Bul"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "Bul ..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Kod Bloğunun Diğer Sonu Bul"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Kod Bloğunun Başlangıcını Bul"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "İmleçte Bildirimi Bul"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Tanımlayıcı Referanslarını Bul ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Dosyaları Bul ve ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Bul ve Sonra"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Bul ve Önceki"

#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Kullanılmış Birimin Referanslarını Bul"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Seçenekler ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Goto Include Directive"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Goto Line ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Sanırım yanlış yerleştirilmiş IFDEF / ENDIF"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Sanırım engellenmiş blok"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Yardım "

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "IDE Dahili"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Artımlı Bul"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Girintiyi Girin"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Değişiklik Girişi"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Karakter Haritası Ekle ..."

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "CVS Anahtar Kelimesini Ekle"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Geçerli Tarih ve Saat"

#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Tam Dosya Adını Ekle ..."

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Genel Ekle"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "GPL Bildirimi"

#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "GPL Bildirimi (tercüme edildi)"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "LGPL Bildirimi"

#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "LGPL Bildirimi (tercüme edildi)"

#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "MIT Bildirimi"

#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "MIT Bildirimi (tercüme edildi)"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Değiştirilmiş LGPL Bildirimi"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Değiştirilmiş LGPL Bildirimi (tercüme edildi)"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Geçerli Kullanıcı Adı"

#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Deneyin ..."

#: lazarusidestrconsts.lismenujumpback
msgid "Jump Back"
msgstr "Geri Atla"

#: lazarusidestrconsts.lismenujumpforward
msgid "Jump Forward"
msgstr "İleriye Git"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Atlamak"

#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Uygulamaya Git"

#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr "Uygulamaya atla kullanır"

#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr "Başlatma Git"

#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr "Arayüze Git"

#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr "Arayüz kullanımına geçer"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Sonraki Favorilere Git"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Sonraki Hataya Git"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Önceki Yer İşaretine Git"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Önceki Hataya Git"

#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr "Prosedürü atla başla"

#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr "Prosedür başlığına atla"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Küçük harf seçimi"

#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr "Editör Makroları ..."

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Kaynak Dizesi Oluştur ..."

#: lazarusidestrconsts.lismenumultipaste
msgid "MultiPaste ..."
msgstr ""

#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Yeni Bileşen"

#: lazarusidestrconsts.lismenunewcustom
#, fuzzy,badformat
msgid "New %s"
msgstr "Haber"

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Yeni Form"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Yeni ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Yeni Paket ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Yeni proje ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Dosyadan Yeni Proje ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Yeni Birim"

#: lazarusidestrconsts.lismenuok
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&TAMAM"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Çevrimiçi yardım"

#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "& Aç ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "İmleçte Dosya Adını Aç"

#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr ""

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Açık Yüklü Paket ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Açık Paket Dosyası (.lpk) ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Mevcut Ünitenin Açık Paketi"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Projeyi Aç ..."

#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Aç & Son"

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Yeni Paketi Aç"

#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Yeni Projeyi Aç"

#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr ""

#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "Pa&ket"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Paket Grafiği"

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Paket Bağlantıları ..."

#: lazarusidestrconsts.lismenupastefromclipboard
#, fuzzy
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Panodan yapıştır"

#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Yeni paket bileşeni"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "İşlem Listesi ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Proje"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Proje Müfettişi"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Proje Seçenekleri ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "&Çalıştır"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Projeyi Yayınla ..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Hızlı Derleme"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Hızlı Sözdizim Kontrolü"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Hızlı sözdizimi denetimi tamam"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Projeden Kaldır ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Tanımlayıcıyı Yeniden Adlandır ..."

#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Hata Bildirme"

#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr ""

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "FPC Kaynak Dizini Rescan"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Debugger'ı Sıfırla"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Geri Dön"

#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Çalıştır"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Dosyayı Çalıştır"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "Çalıştır & Parametreler ..."

#: lazarusidestrconsts.lismenuruntocursor
msgid "Step over to &Cursor"
msgstr "Kademeli ve İmleç"

#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr ""

#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Kaydet"

#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Farklı kaydet ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Projeyi Kaydet"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Farklı Kaydet Projesi ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Arama"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Seç"

#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Hepsini seç"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Kod Bloğu Seç"

#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Satır Seç"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Paragrafı Seç"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Kalıp seç"

#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Kelimeyi Seç"

#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Ücretsiz Yer İşareti Oluşturun"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "S & how Execution Point"

#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr "İçerik duyarlı akıllı ipucu"

#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Seçimi Sırala ..."

#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "Kaynak"

#: lazarusidestrconsts.lismenustepinto
msgid "Step In&to"
msgstr "İçine adım"

#: lazarusidestrconsts.lismenustepintocontext
msgid "Step Into (Context)"
msgstr "İçeri Gir (Bağlam)"

#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "Talimata Adım"

#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "Talimata Adım"

#: lazarusidestrconsts.lismenustepout
msgid "Step O&ut"
msgstr "Dışarı çıkmak"

#: lazarusidestrconsts.lismenustepover
msgid "&Step Over"
msgstr "&Adım atmak"

#: lazarusidestrconsts.lismenustepovercontext
msgid "Step Over (Context)"
msgstr "Step Over (Bağlam)"

#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "Talimat Üzerine Basamak"

#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "Talimat Üzerine Basamak"

#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Seçimde Takas Yap"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Seçimlerde Boşluklar"

#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "Hakkında"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Seçimde Yorumu Değiştir"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Araçlar"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Seçimi Kaldır"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Devam Eden Seçim"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Büyük Harf Seçimi"

#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Birimi Birime Ekle Bölümüne ..."

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Görünüm"

#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Çapa Editör"

#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"

#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Kırılma noktaları"

#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Çağrı yığını"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Kod Tarayıcı"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Kod Explorer"

#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Parça Paleti"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "Ve Bileşenleri"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Olay günlüğü"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Çıktıyı Hata Ayıkla"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Pencereler"

#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Geçmiş"

#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Geçiş Geçmişi"

#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Yerel Değişkenler"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Mesajlar"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Nesne Müfettişi"

#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "& Proje Kaynaklarını Görüntüle"

#: lazarusidestrconsts.lismenuviewpseudoterminal
#, fuzzy
#| msgid "Terminal Output"
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr "Terminal çıkışı"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Sicilleri"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Kısıtlama Tarayıcısı"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Arama sonuçları"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Kaynak Düzenleyici"

#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Sekme Sırası"

#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Konular"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Form / Birim Görünümünü Değiştir"

#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Birim Bağımlılıkları"

#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Birim Bilgisi ..."

#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Birimler ..."

#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Saatler"

#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Nelere İhtiyacı Var"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "& Penceresi"

#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Diğer sekmeler"

#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr "Projeler"

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Mesajlar Editörü"

#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Mesajlar Penceresi"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Yöntem sınıfı bulunamadı"

#: lazarusidestrconsts.lismissingdirectory
msgid "missing directory \"%s\""
msgstr "Eksik dizin \" %s \\ \""

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Eksik Etkinlikler"

#: lazarusidestrconsts.lismissingexecutable
msgid "missing executable \"%s\""
msgstr "Eksik çalıştırılabilir \" %s \\ \""

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Kayıp tanımlayıcılar"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Eksik Paketler"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Seçimleriniz şunlar:"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Yorum Yap"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Sadece Delphi için"

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Seçilen birimleri yorumlayın."

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Birimleri yalnızca Delphi için kullanın."

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Birimleri arar Bulunan yollar proje ayarlarına eklenir."

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Şimdi iptal edin, paketler yükleyin veya yolları düzeltin ve tekrar deneyin."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Arama Birimi Yolu"

#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr "Bu Birimi Atla"

#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
msgstr ""

#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Ekler ve Geçersiz Kılmalar"

#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Özel seçenekler ekler:"

#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Keyfi fpc seçeneklerini ekleyin, örneğin -O1 -ghtl -dFlag"

#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Tüm paketlere uygula"

#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Tüm paketlere ve projelere başvurun."

#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr "Ad \" %s \\ \"\" ile eşleşen tüm paketlere uygula "

#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Projeye uygula."

#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Yeni bir grup grubu oluşturun"

#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Özel Seçenek"

#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "Seçilen hedefi veya seçeneği sil"

#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "Özel seçenek eklemez:"

#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr "IDE Macro %s yok: = %s"

#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "OutDir (-FU) öğesini geçersiz kılmaz"

#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr "Ad \" %s \\ \"ile eşleşen tüm paketleri hariç tutun"

#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
#, fuzzy
#| msgid "expected \":=\" after macro name, but found \"%s\""
msgid "expected \":=\" after macro name but found \"%s\""
msgstr "Beklenen \": = \\ \"makro adından sonra, ancak \" %s \\ \"\" bulund"

#: lazarusidestrconsts.lismmexpectedmacronamebutfound
#, fuzzy
#| msgid "expected macro name, but found \"%s\""
msgid "expected macro name but found \"%s\""
msgstr "Beklenen makro adı, ancak \" %s \\ \"\" bulund"

#: lazarusidestrconsts.lismmfromto
#, fuzzy,badformat
msgid "From %s to %s"
msgstr "% S den %s\" y"

#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "IDE Makro"

#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr "IDE Makro %s: = %s"

#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr "Geçersiz karakter \" %s \\ \",\" %s "

#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr "Makro değerindeki geçersiz karakter \" %s \\ \""

#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "Makro adı eksik"

#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Seçili öğeyi aşağı taşı"

#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Seçili öğeyi yukarı taşı"

#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Yeni Hedef"

#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr "OutDir'i geçersiz kıl (-FU): %s"

#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Çıkış dizinini geçersiz kıl (-FU)"

#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "Çıkış dizinini geçersiz kıl -HB hedefi"

#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Bu tabloya son geri al"

#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Bir IDE makrosu ayarlayın, ör. LCLWidgetType: = win32"

#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr "Set \" %s \\ \""

#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Depolanmış IDE (environmentoptions.xml)"

#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Stored in project (.lpi)"

#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Proje oturumunda (.lps) saklanır"

#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Hedefler:"

#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Bu ızgaraya son değişikliği geri al"

#: lazarusidestrconsts.lismmusesystemencoding
msgid "Use system encoding"
msgstr "Sistem kodlamasını kullan"

#: lazarusidestrconsts.lismmusesystemencodinghint
msgid "Disable support for UTF-8 default string encoding."
msgstr "UTF-8 varsayılan dizge kodlamasının desteğini devre dışı bırak"

#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr "Değer \" %s \\ \""

#: lazarusidestrconsts.lismmwas
#, fuzzy,badformat
msgid "(was \"%s\")"
msgstr "(\"% S \\ \")"

#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr ""

#: lazarusidestrconsts.lismode
msgid ", Mode: %s"
msgstr ", Mod: %s"

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""

#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "& Değiştir"

#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Daha"

#: lazarusidestrconsts.lismoresub
#, fuzzy
#| msgid "More >>"
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Devamı >>"

#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Hareket"

#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Dosyaları Taşı"

#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "Dosyaları taşı mı?"

#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, fuzzy,badformat
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "% S dosya (lar) ı, %s klasöründen %s %s %sof %s dizinine mi taşı?"

#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Taşı \" %s \\ \"bir konum aşağı"

#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Taşı \" %s \\ \"bir konum yukarı"

#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "Dosyaları Taşı veya Kopyala mı?"

#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr " %s dosya (lar) ı, %s klasöründen %s %s %sof %s ya da kopyala?"

#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Sayfayı Taşı"

#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Seçilen öğeyi aşağıya taşı (Ctrl + Aşağı)"

#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Seçili öğeyi yukarı taşı (Ctrl + Yukarı)"

#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Taşınmak: "

#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Bu birimlerin taşınması kullanım alanlarını kıracaktır. Ayrıntılar için Mesajlar penceresine bakın."

#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr ""

#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr ""

#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr ""

#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr ""

#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr ""

#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr ""

#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr ""

#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr ""

#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr ""

#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(MS)"

#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr "Mesaj renkleri"

#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr "Birden çok dizin noktalı virgül ile ayrılır"

#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ", Birden çok paket:"

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Dosyaları dosyaya kaydet (* .txt)"

#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Ad"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "İsim çakışması"

#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Etkin yapı modunun adı"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Yeni prosedürün adı"

#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Asla"

#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Yeni"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Yeni Sınıf"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Yeni konsol uygulaması"

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
#, fuzzy,badformat
msgid "Create a new editor file.%sChoose a type."
msgstr "Yeni bir düzenleyici dosyası oluşturun.% SBir tür seçin\""

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Yeni bir boş metin dosyası oluştur."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
#, fuzzy,badformat
msgid "Create a new project.%sChoose a type."
msgstr "Yeni bir proje oluşturun.% SBir tür seçin\""

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
#, fuzzy,badformat
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Yeni bir standart paket oluşturun.% SA paketi birimler ve bileşenlerden oluşan bir koleksiyon."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Veri modülüyle yeni bir birim oluşturun."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Çerçeveli yeni bir birlik oluştur."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "LCL formuyla yeni bir birim oluşturun."

#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Bir proje formundan veya bileşenden devralın"

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Hiçbir öğe seçilmedi"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Lütfen önce bir öğe seçin."

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Yeni kodlama:"

#: lazarusidestrconsts.lisnewmacroname
#, fuzzy,badformat
msgid "Macro %d"
msgstr "Makro% d"

#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Yeni Macroname"

#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr ""

#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr ""

#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Yeni sayfa"

#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(yeni proje)"

#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Yeni kaydedilen makrolar, kaydedilmeyecek"

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "Kullanım bölümlerine yeni birimler eklendi"

#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Yok hayır"

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Yedekleme dosyası yok"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Oluşturulacak hiçbir profil seçilmedi."

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Değişiklik yok"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Kod seçilmedi"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Herhangi bir derleyici seçeneği devralınmadı."

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "Ipucu yok"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Hiçbir IDE penceresi seçilmedi"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Hayır LFM dosyası"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Makro seçilmedi"

#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr "(Mesaj seçilmedi)"

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "isimsiz"

#: lazarusidestrconsts.lisnone
#, fuzzy,badformat
msgid "%snone"
msgstr "% Snone"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "Hiçbiri, birini seçmek için tıkla"

#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr "(Hiçbiri seçilmedi)"

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "Hiçbir düğüm seçilmedi"

#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "Pascal dosyası yok"

#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file \"%s\" found."
msgstr "\" %s \\ \"hiçbir program dosyası bulunamadı."

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Hiçbir ResourceString Bölümü bulunamadı"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalde filtre düzenli bir ifadedir, basit sözdiziminde a. Normal bir karakterdir, a * sta"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Dizge sabiti bulunamadı"

#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "Designtime olmayan bir paket"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Yükleme paketi değil"

#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid Pascal identifier"
msgstr "Geçerli bir Pascal tanımlayıcı değil"

#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr "Not"

#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Alt"

#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Ayrıldı"

#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Sağ"

#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Üst"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "NOT: Free Pascal Kaynakları için Şablon Tanımlama Oluşturulamadı"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "NOT: Lazarus Kaynakları için Şablon Tanımlama Oluşturulamadı"

#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "Şablon seçilmedi"

#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
msgstr "% S satırında %s satırında %s sütununda bulunamadı.% S İleti güncelliğini yitirebilir."

#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Uygulanmadı"

#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Henüz uygulanmadı: %s %s"

#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "yüklü değil"

#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr ""

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Şimdi değil"

#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Şimdi yüklendi:"

#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Yaratmak"

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Yeni bir proje oluştur"

#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Dönüştürülecek dosya sayısı: %s"

#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr "Nesne Denetçisi, tasarımcılarda bileşenler seçildiğinde görünür hale gelir."

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Nesne Pascal - varsayılan"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "Nesne yolu"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Nesne Denetleyicisi Sık Kullanılanları sekmesine geç"

#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "Kapalı"

#: lazarusidestrconsts.lisofpackage
#, fuzzy,badformat
msgid " of package %s"
msgstr "% S paketinin"

#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr "Proje Müfettişinin"

#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Favori özelliklere ekle"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Favori özellik \" %s \\ \"için bir temel sınıf seçin."

#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class \"%s\" not found."
msgstr "Sınıf \" %s \\ \"bulunamadı."

#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Favori özelliklerden kaldır"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "Otomatik yükleme dinamiği"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "Otomatik yükle statik"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Açıklama: "

#: lazarusidestrconsts.lisoipdescriptiondescription
#, fuzzy,badformat
msgid "%sDescription:  %s"
msgstr "% SDescription: %s"

#: lazarusidestrconsts.lisoipfilename
msgid "Filename:  %s"
msgstr "Dosya adı: %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "Kurulu dinamik"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "Kurulu statik"

#: lazarusidestrconsts.lisoiplicenselicense
#, fuzzy,badformat
msgid "%sLicense:  %s"
msgstr "% SLicense: %s"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "eksik"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "değiştirilmiş"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Açık Yüklü Paket"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Paket ismi"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Lütfen bir paket seçin"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "sadece oku"

#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Belirtmek, bildirmek"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, fuzzy,badformat
#| msgid "%sThis package is installed, but the lpk file was not found"
msgid "%sThis package is installed but the lpk file was not found"
msgstr "% SBu paket kuruldu, ancak lpk dosyası bulunamadı"

#: lazarusidestrconsts.lisok
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "TAMAM"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Old Class"

#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "?"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Kesme çizgisinde (örn. Dönüş veya enter tuşu)"

#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr ""

#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr ""

#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr ""

#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr ""

#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr "Sadece bu normal ifadeye uyan mesajlar:"

#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr "Yalnızca bu FPC kimliklerine sahip olan iletiler (virgülle ayrılmış):"

#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr ""

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Yalnızca tüm kelimeleri aramak"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Panoya yapıştırmada"

#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Açık"

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "XML dosyası olarak aç"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Açık ünitede açık tasarımcı"

#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr "Form her zaman kaynak birimi açıldığında tasarımcıya yüklenir."

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Varolan dosyayı aç"

#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Açık dosya"

#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Açık dosya"

#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr ""

#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr ""

#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr ""

#: lazarusidestrconsts.lisopenlfm
#, fuzzy,badformat
msgid "Open %s"
msgstr "% S aç"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Açık Paket?"

#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Açık paket %s"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Açık Paket Dosyası"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Projeyi Aç mı?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Açık proje"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Tekrar açık proje"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Proje Dosyasını Aç"

#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Açık sembolik bağ"

#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Açık hedef"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Dosyayı normal kaynak olarak aç"

#: lazarusidestrconsts.lisopenthepackage
#, fuzzy,badformat
msgid "Open the package %s?"
msgstr "% S paketini açsın mı?"

#: lazarusidestrconsts.lisopentheproject
#, fuzzy,badformat
msgid "Open the project %s?"
msgstr "% S projesini açsın mı?"

#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr "Açık Aracı Seçenekleri"

#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr ""

#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr "Açık URL"

#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Açık XML"

#: lazarusidestrconsts.lisoptions
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Seçenekler"

#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr "Seçenekler değişti, -B ile temiz yeniden derlendi."

#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr ""

#: lazarusidestrconsts.lisor
msgid "or"
msgstr "veya"

#: lazarusidestrconsts.lisos
msgid ", OS: %s"
msgstr ", OS: %s"

#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
#, fuzzy,badformat
#| msgid "other sources path of package \"%s\" contains directory \"%s\", which is already in the unit search path."
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr "\"% S \\ \"paketinin diğer kaynakları% \" %s \\ \"dizini içeriyor; bu da zaten birimin içind"

#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr ""

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Dili geçersiz kılmak - örneğin --language = de. Olası değerler için"

#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr ""

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
#, fuzzy,badformat
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "% Soverride varsayılan derleyicidir. Örneğin ppc386 ppcx64 ppcppc vb. Varsayılan ortamda depolanı"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
#, fuzzy,badformat
msgid "%soverride the project or IDE build mode."
msgstr "% Soverride proje veya IDE derleme  modu."

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, fuzzy,badformat
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "% Sverride projenin cpu örn .: i386 x86_64 powerpc powerpc_64 vb. Öntanımlı: %s"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, fuzzy,badformat
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%\" proje işletim sistemini soverride.örneğin win32 linux default: %s "

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr " %sverride proje widget'ını.\" \"Örn: gtk gtk2 qt win32 karbon varsayılan: %s"

#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Dosyanın üzerine yazılsın mı?"

#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Diske dosya üzerine yaz"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Sahibi' zaten TReader / TWriter tarafından kullanılıyor, lütfen başka bir ad seçin."

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Paket"

#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "Paket %s"

#: lazarusidestrconsts.lispackage3
msgid ", package %s"
msgstr ", Paket %s"

#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Paket bilgisi"

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Paket adı ile başlar ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Paket adı içeriyor ..."

#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr "Paket bir çıkış dizinine ihtiyaç duyar."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Paketin kurulum ihtiyacı var"

#: lazarusidestrconsts.lispackageoption
msgid "Package \"%s\" Option"
msgstr "Paket \" %s \\ \"Seçenek"

#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Paket çıktı dizinleri"

#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Paket kaynak dizinleri"

#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr "Paketleri = %s / %s birimleri = %s / %s tanımlayıcıları = %s / %s satırları = %s baytları = %s"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "Paket birimi"

#: lazarusidestrconsts.lispage
msgid "Page"
msgstr "Sayfa"

#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr "Sayfa ismi"

#: lazarusidestrconsts.lispagenamealreadyexists
msgid "Page name \"%s\" already exists. Not added."
msgstr "Sayfa adı \" %s \\ \"zaten var, eklenmedi."

#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr "Panik"

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", Ayrıştırılmış"

#: lazarusidestrconsts.lisparser
msgid "parser \"%s\": %s"
msgstr "Ayrıştırıcı \" %s \\ \": %s"

#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr ""

#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Geçiş Kontu"

#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
msgid "passing compiler define \"%s\" twice with different values"
msgstr ""

#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
msgid "passing compiler option -%s twice with different values"
msgstr ""

#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Yapıştırmak"

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "Panoya yapıştır"

#: lazarusidestrconsts.lispastefromclipboard
#, fuzzy
#| msgid "Paste from clipboard"
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Panodan yapıştır"

#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr "Pastel renkler"

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Yol"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Gözat"

#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Geçersiz Yolları Sil"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Yolu aşağı kaydır (Ctrl + Aşağı)"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Yolu yukarı hareket ettir (Ctrl + Yukarı)"

#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Listeye yeni yol ekle"

#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Seçili yolu sil"

#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Varolmayan (gri) yolları listeden kaldır"

#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Seçili yolu yeni bir yolla değiştir"

#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Listeye şablon ekle"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Yol şablonları"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Arama yolları:"

#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "Anlık önbellek yolunun yolu"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Make programının yolu"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Başarısız Örnek için Yol:"

#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Pause"

#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Paket adını kullanmak için temizle"

#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Lfm'in I18N'sini devre dışı bırak"

#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr "Dosyaları Dosya Sisteminden Ekle"

#: lazarusidestrconsts.lispckeditaddotheritems
msgid "Add other items"
msgstr "Diğer öğeleri ekle"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Projeye Ekle"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Değişiklikleri uygula"

#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr ""

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Seçilen ünitenin %sRegister %s prosedürünü çağır"

#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Bağımlılıkları temizle ..."

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Varsayılan / tercih edilen dosya adı bağımlılığını temizle"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Her şeyi derleyin?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Derleme paketi"

#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Paket %s için Derleyici Seçenekleri"

#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "Create fpmake.pp"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Makefile Yarat"

#: lazarusidestrconsts.lispckeditdefault
#, fuzzy,badformat
msgid "%s, default: %s"
msgstr "% S, varsayılan: %s"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Bağımlılık Özellikleri"

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit general options"
msgstr "Genel seçenekleri düzenle"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Dosya Özellikleri"

#: lazarusidestrconsts.lispckeditfpmakepackage
msgid "(fpmake)"
msgstr ""

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Yükle"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Geçersiz maksimum sürümü"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Geçersiz minimum sürüm"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Maksimum Sürüm:"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Minimum Sürüm:"

#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Değiştirildi: %s"

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Bağımlılığı aşağıya kaydır"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Bağımlılığı yukarı taşı"

#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Paket %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Paket \" %s \\ \"değişti %sSave paketi?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "Paket %s kaydedilmedi"

#: lazarusidestrconsts.lispckeditpage
#, fuzzy,badformat
msgid "%s, Page: %s"
msgstr "% S, Sayfa: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Yeniden bağımlılık ekle"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Dosyayı yeniden ekle"

#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Salt Okunur: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Gerekli Tüm Yeniden Derle"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Yeniden Derle Temizle"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Bu ve gereken tüm paketleri yeniden derleyin?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Kayıtlı eklentiler"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Kayıt birimi"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Bağımlılığı kaldır"

#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Bağımlılığı Kaldır?"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Bağımlılığı kaldır \" %s \\ \" %sfrom paket \" %s \\ \"?"

#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Çıkarılan Dosyalar"

#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Gerekli paketler kaldırıldı"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Dosyayı kaldır"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Dosya kaldırılsın mı?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "\" %s \\ \" %sfrom paket \" %s \\ \"dosyasını kaldır\" "

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Seçili öğeyi kaldır"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Gerekli Paketler"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Paket Kaydet"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Bu bağımlılık için dosya adı varsayılan olarak sakla"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Bu bağımlılık için dosya adını tercih ettiğiniz gibi sakla"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, fuzzy,badformat
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "\"% S \\ \"maksimum sürümü geçerli bir paket sürümü değil %s (iyi örnek 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, fuzzy,badformat
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "\"% S \\ \"minimum sürümü geçerli bir paket sürümü değil %s (iyi örnek 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Kaldır"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Görünüm paketi Kaynağı"

#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "Temel, kaldırılamaz"

#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Yüklü"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Bir sonraki başlatmada yükle"

#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sState:"

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Bir sonraki başlatmada kaldır (kurulu pakete ihtiyaç duyulmadığı sürece)"

#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "%s paketini kaldır"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Bağımlı paketlere ve projelere seçenek ekleme"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Bağımlı paketlere / projelere yol ekle"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Yazar"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Gerektiği gibi otomatik olarak yeniden oluşturun"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Hepsini yeniden derlenirken  otomatik derle"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Özel"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Açıklama / Özet"

#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Designtime"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Designtime ve çalışma zamanı"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "IDE Entegrasyonu"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Dahil"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Geçersiz paket türü"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Kütüphane"

#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Lisans"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Bağlayıcı"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Majör"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Manuel derleme (otomatik olarak asla)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Minör"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Nesne"

#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Paket Seçenekleri"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Paket Tipi"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Sağlar"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Serbest bırakmak"

#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Süre"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, fuzzy,badformat
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Paket \" %s \\ \"otomatik kurulum bayrağı var.% SBu, IDE'ye yükleneceği anlamına geliyor.% SInst"

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Bu pakette aşağıdaki paketler aynıdır:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Güncelleme / Yeniden Oluşturma"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Kullanım"

#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Paket:"

#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Fpdoc xml dosyaları için arama yolları: Birden fazla yol, noktalı virgülle ayrılmış olmalıdır."

#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Gereksiz bağımlılıkları göster"

#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Form kaydedildiğinde, IDE tüm TTranslateString özelliklerini paket po dosyasına kaydedebilir"

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "İptal"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "İlerleme"

#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Dizini daralt"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Çatışma bulundu"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Sanal Birimi Düzenle"

#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Dizini genişlet"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Dosya adı:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Dosyaları Düzeltmek Vaka"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Geçersiz birim dosya adı"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Geçersiz ünite adı"

#: lazarusidestrconsts.lispemissingfilesofpackage
#, fuzzy,badformat
msgid "Missing files of package %s"
msgstr "% S paketinin eksik dosyaları"

#: lazarusidestrconsts.lispendingon
msgid "Pending (On)"
msgstr ""

#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Yeni dosya dahil değil yolunda"

#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Hiç dosya yok, tüm dosyalar var."

#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Dosyaları kaldır"

#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Paketi geri al"

#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Paketini Farklı Kaydet ..."

#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Dizin hiyerarşisini göster"

#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Eksik Dosyaları Göster"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Dosyaları Kalıcı Olarak Sırala"

#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Dosyaları alfabetik olarak sırala"

#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, fuzzy,badformat
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "\" %s \\ \"dosyası şu anda paketin kapsama yolunda değil.% SAdd \" %s \\ \"ekleme p'ye \" %s \\ \"eklend"

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "UnitName:"

#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Dizindeki tüm birimleri kullan"

#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Dizinde hiçbir birim kullan"

#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Paket bağımlılıklarını temizle"

#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Seçimi Temizle"

#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "CompiledSrcPath eklentisi"

#: lazarusidestrconsts.lispkgdefsnamespaces
msgid "Namespaces"
msgstr ""

#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Çıkış dizini"

#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Paket Kaynak Dizini İşareti"

#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Birim Yolu"

#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Bağımlılıkları sil"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, fuzzy,badformat
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "% S paketindeki tüm değişiklikleri unutmak ve dosyadan yeniden yüklemek istiyor musunuz?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Yeni birim ünite yolunda değil"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Yayınlama Paketi"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Paketi geri mi döndürdün?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, fuzzy,badformat
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "\"% S \\ \" %s dosyası şu anda paketin birim yolunda değil.% S \" %s \\ \"birim yoluna eklensin mi?"

#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr "Paket için daha fazla işlev"

#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "İkili"

#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Dosyayı ekle"

#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Sorun xml dosyası"

#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Lazarus form metni"

#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus kaynağı"

#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Ana ünite"

#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Metin"

#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Sanal Birim"

#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Paket dizini.Parametresi paket kimliğidir, örneğin \" Adı \\ \"veya \" Adı 1.0 \\ \""

#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Paket, dosya arama yolunu içerir. Parametre paket kimliğidir, örneğin \" İsim \\ \"veya \" İsim 1.0 \\ \""

#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Paket adı. Parametre paket kimliğidir, örneğin \" İsim \\ \"veya \" Adı 1.0 \\ \""

#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Paket çıkış dizini.Parametresi paket kimliğidir, örneğin \" İsim \\ \"veya \" Adı 1.0 \\ \""

#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Paket kaynağı arama yolu. Parametre paket kimliğidir, örneğin \" İsim \\ \"veya \" Adı 1.0 \\ \""

#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Paket birimi arama yolu. Parametre paket kimliğidir, örneğin \" İsim \\ \"veya \" Adı 1.0 \\ \""

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, fuzzy,badformat
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "% SPaket %s için yeni bağımlılık ekleme: paket %s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, fuzzy,badformat
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "% SProje %s için yeni Bağımlılık ekleme: paket %s"

#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr ""

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Belirsiz birimler bulundu"

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Otomatik olarak yüklenen paketler"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr " %sBu paketler bağlı\" Bu bir paketin diğerini kullandığı anlamına gelir, yoksa ikimiz d"

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Bozuk bağımlılık"

#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Dairesel bağımlılıklar bulundu"

#: lazarusidestrconsts.lispkgmangcompilepackage
#, fuzzy,badformat
msgid "Compile package %s"
msgstr "% S paketini derle"

#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Sil başarısız oldu"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Eski Paket Dosyasını Sil mi?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file \"%s\"?"
msgstr "Eski paket dosyasını \" %s \\ \"sil\" "

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Sahibi Olmayan Bağımlılık: %s"

#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Dosya okunurken hata oluştu"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Hata Okuma Paketi"

#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Hata: po dosyalarının güncellenmesi %s paketinde başarısız oldu"

#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Dosya yazarken hata oluştu"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Hata Yazma Paketi"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Dosya zaten pakette"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Dosya Projede"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Dosya adı Packagename'den farklı"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Dosya adı başka bir paket tarafından kullanılıyor"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Dosya adı proje tarafından kullanılıyor"

#: lazarusidestrconsts.lispkgmangfilenotfound
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "Dosya \" %s \\ \"bulunamadı."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Dosya kaydedilmedi"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr " %s paketinin kurulması paketi otomatik olarak yükleyecek:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr " %s paketinin kurulması paketleri otomatik olarak yükleyecek:"

#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Geçersiz Derleyici dosya adı"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Geçersiz dosya uzantısı"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Geçersiz paket dosya uzantısı"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Geçersiz paket dosya adı"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Geçersiz paket adı"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Geçersiz Paket Adı"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, fuzzy,badformat
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr " %s dosyası yükleniyor, %s %s dosyası %s dosyasından olacak.% S eski paket değiştirildi.% S esk"

#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "NewPackage"

#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Paket: %s"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Paket çakışmaları"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "Paket bir designtime paketi değil"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Paket gerekiyor"

#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "Paket ana kaynak dosyası"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Paket adı zaten var"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Paketlerin uzantısı .lpk olmalıdır"

#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Lütfen önce paketi derleyin."

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Dosyayı bir pakete eklemeden önce kaydedin."

#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Proje: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Lazarus'u yeniden derle?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Dosya küçük harfini yeniden adlandırın?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file \"%s\"?"
msgstr "Varolan dosyayı değiştir \" %s \\ \"?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Dosyayı Değiştir"

#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Bir veya daha fazla gerekli paket bulunamadı Ayrıntılar için paket grafiğine bakınız."

#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name.\n"
msgstr ""

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Paketi kurtar?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Paket Kaydet %s (* .lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, fuzzy,badformat
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Dosya küçük harfe yeniden adlandırılsın mı?% S \" %s \\ \"?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Bu paketi atla"

#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "Statik paketler yapılandırma dosyası"

#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
#, fuzzy,badformat
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "% S paketinin derleyici dosyası geçerli bir yürütülebilir değil: %s %s"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "\"% S \\ \" %s dosyası zaten %s paketinde bulunuyor."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file \"%s\" is not a Lazarus package."
msgstr "\" %s \\ \"dosyası bir Lazarus paketi değil."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, fuzzy,badformat
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "\"% S \\ \"dosya adı, dosyadaki \" %s \\ \"paket adıyla uyuşmuyor.% SChange paketi "

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, fuzzy,badformat
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "Dosya adı \" %s \\ \"geçerli projenin bir parçası.% SProjects ve Paketler dosya paylaşmamalıdı"

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, fuzzy,badformat
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "Dosya adı \" %s \\ \"% \" %s \\ \" %sin dosya \" %s \\ \"tarafından kullanılıyor."

#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr " %s paketinin \" %s \\ \"dosyası bulunamadı."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Aşağıdaki paket yüklenemedi:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Aşağıdaki paketler yüklenemedi:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, fuzzy,badformat
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "% SBunların %s %s kullanım bölümüne eklenecek: %s %s"

#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
#, fuzzy,badformat
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
msgstr "Paket \" %s \\ \"derleyemedi.% SDiğerini yükleme listesinden kaldırın?"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr " %s \" %s \\ \"içindeki paket dosyası adı \" %s \\ \"geçerli bir Lazarus paket adı değil."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, fuzzy,badformat
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr " %s paketi yalnızca bir çalışma zamanı paketi.% SRuntime yalnızca paketler IDE'ye kurulamıyor."

#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, fuzzy,badformat
#| msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\", which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "\"% S \\ \"paketi otomatik olarak derlenir ve çıktı dizini \" %s \\ \"dir"

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, fuzzy,badformat
#| msgid "The package \"%s\" is marked for installation, but cannot be found.%sRemove dependency from the installation list of packages?"
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "\" \\ \" %s \" paketi kurulum için işaretlenmiş ancak bulunamadı.% SBağımlılık "

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, fuzzy,badformat
#| msgid "The package %s is required by %s, which is marked for installation.%sSee package graph."
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr " %s paketi kurulum için işaretlenmiş %s tarafından gerekli.% SPaket grafiğini göster."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Paket adı \" %s \\ \"geçerli bir paket adı değil %sPlease lütfen başka bir ad seçin (örn. Package1.l"

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, fuzzy,badformat
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "\"% S \\ \"dosyasının% \" %s \\ \"paketi adı \" %s \\ \"geçersiz."

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, fuzzy,badformat
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Paket \" %s \\ \"işaretlendi.% SCurrently Lazarus yalnızca statik bağlantılı paketleri destekliyor"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, fuzzy,badformat
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Kurulum için \" %s \\ \"paketi gösterildi.% SCurrently Lazarus yalnızca statik bağlantılı payı destekliyo"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, fuzzy,badformat
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Proje paketi \" %s \\ \"gerektiriyor.% S Ama bulunamadı.Proje -> Proje Müfettişine bakınız"

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, fuzzy,badformat
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Aynı ada sahip iki birim var: %s1. \"% S \\ \" %s %s2. \"% S \\ \"den %s"

#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "Paketlerde dolaşımlı bir bağımlılık var. Bkz. Paket grafiği."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Bir paketle aynı adı taşıyan bir FPC birimi var: %s \" %s \\ \""

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "\" \" %s \" %s \\ \"den %s ile aynı isimli bir FPC birimi var"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, fuzzy,badformat
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "\" \"\" %s \\ \"adı olan başka bir paket zaten var.% SConflict paketi: \" %s \\ \" %sFile: \" %s \\ \""

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, fuzzy,badformat
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "\" \" %s \" %s \\ \"dosyası yüklenmiş bir paket zaten \" %s \\ \"var.% SPaket -> Paket Grafiği'ni gör.% SRepl"

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Gerekli paketlerde kaydedilmemiş bir paket var, bkz. Paket grafiği."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, fuzzy,badformat
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Bir paket olarak aynı adı taşıyan bir birim var: %s1. \"% S \\ \" %s %s2. \"% S \\ \""

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Bu sanal bir paket, henüz kaynağı yok, lütfen önce paketi kaydedin."

#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Dizin oluşturulamadı"

#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory \"%s\"%sfor package %s."
msgstr "Paket %s için \" %s \\ \" %s çıktı dizini oluşturulamadı."

#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory \"%s\"%sfor package %s."
msgstr "Paket kaynağı dizini \" %s \\ \" %s için %s oluşturulamadı."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, fuzzy,badformat
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Lazarus için hedef dizin oluşturulamadı: %s \" %s \\ \".% SBu dizin yeni cha için gerekl"

#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file \"%s\"."
msgstr "Dosya \" %s \\ \"silinemiyor."

#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Dosya silinemiyor"

#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file \"%s\"%sfor package %s."
msgstr "Eski durum dosyasını silemiyor \" %s \\ \" %s paket %s için."

#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Paket yüklenemiyor"

#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
#, fuzzy,badformat
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
msgstr "Paket \" %s \\ \"açılamıyor.% SBu paket kurulum için işaretlendi."

#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
#, fuzzy,badformat
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
msgstr " %s durum dosyasını okunamıyor \" %s \\ \" %sof paketi %s.% SError: %s"

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, fuzzy,badformat
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr " %s dosyası \" %s \\ \" %s dosyası \\ %s \\ %sError: %s"

#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
#, fuzzy,badformat
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
msgstr " %s \" %s \\ \" %sfüzk dosyası %s.% SError: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Paketi kaldırın mı?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Paket %s kaldırılsın mı?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Kaydedilmemiş paket"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Birimi kullan"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, fuzzy,badformat
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Uyarı: Dosya \" %s \\ \"% mevcut projeye ait."

#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "Tutmak"

#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "yeni"

#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "Kaldır"

#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Bir paket seçin"

#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "Yüklü"

#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Cannot register components without unit"
msgstr "Birim olmayan bileşenler kaydedilemiyor"

#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class \"%s\" already defined"
msgstr "Bileşen Sınıfı \" %s \\ \"zaten tanımlandı"

#: lazarusidestrconsts.lispkgsysfilename
#, fuzzy,badformat
msgid "%s%sFile Name: \"%s\""
msgstr "% S %sFile Adı: \" %s \\ \""

#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Geçersiz bileşen sınıfı"

#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Geçersiz Birim Adı: %s"

#: lazarusidestrconsts.lispkgsyslpkfilename
#, fuzzy,badformat
msgid "%s%slpk file: \"%s\""
msgstr "% S %slpk dosyası: \" %s \\ \""

#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Paket dosyası bulunamadı"

#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "Paket kaydı hatası"

#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Kayıt işlemi nil"

#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
#, fuzzy
#| msgid "RegisterUnit was called, but no package is registering."
msgid "RegisterUnit was called but no package is registering."
msgstr "RegisterUnit çağrıldı, ancak hiçbir paket kayıt yapmıyor."

#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
#, fuzzy,badformat
msgid "%s%sThe lpk file was not found."
msgstr "% S %sLpk dosyası bulunamadı."

#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
#, fuzzy,badformat
#| msgid "The package \"%s\" is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Paket \" %s \\ \"kuruldu, ancak geçerli bir paket dosyası (.lpk) bulunamadı.% SA kırık kukla paket"

#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Varsayılan paket bu, yalnızca paketsiz bileşenler için kullanılır.Bu bileşenler dışarıd"

#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
#, fuzzy
#| msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this."
msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "\" \"Bu paket kuruldu, ancak lpk dosyası bulunamadı, tüm bileşenleri devre dışı bırakıldı"

#: lazarusidestrconsts.lispkgsysunitname
#, fuzzy,badformat
msgid "%s%sUnit Name: \"%s\""
msgstr "% S %sUygul Adı: \" %s \\ \""

#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
#, fuzzy,badformat
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr "Birim \" %s \\ \"lpk dosyasında bulunamadı.% S Muhtemelen bu lpk dosyası bunu oluşturmak için kullanılmadı"

#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr "Birim \" %s \\ \"paketten kaldırıldı (lpk)"

#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
#, fuzzy
#| msgid "The following dependencies are not needed, because of the automatic transitivity between package dependencies."
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr "Aşağıdaki bağımlılıklara, paketin otomatik geçişi nedeniyle ihtiyaç yoktur"

#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, fuzzy,badformat
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "\" \"Proje, aşağıdaki paketlerin çıktı dizinini geçersiz kılar.% SSee Proje / Proje Opt"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Bu dosya herhangi bir yüklü pakette değil."

#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr "Geçişlilik"

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Paket dosyası \" %s \\ \"okunamadı %sError: %s"

#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Oyun"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Küresel"

#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr ""

#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr ""

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Paket Bağlantıları"

#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr "Küresel bağlantıları göster"

#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr ""

#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr "Kullanıcı bağlantılarını göster"

#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr ""

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Kullanıcı"

#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
#, fuzzy
#| msgid "Please fix the error shown in the message window, which is normally below the source editor."
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr "Lütfen normalde kaynak düzenleyicinin altında olan mesaj penceresinde gösterilen hatayı düzeltin."

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Lütfen çalıştırmadan önce bir ünite açın."

#: lazarusidestrconsts.lispleaseselectatleastonebuildmode
msgid "Please select at least one build mode."
msgstr ""

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Lütfen yeni bir prosedür / yöntem çıkarmak için bazı kodları seçin."

#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Tüm>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Yazı Tipini Değiştir"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Yöntem adını panoya kopyala"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Metodun herhangi bir parçasını eşleyerek filtreleme"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Yöntemin başlangıcıyla eşleşen filtreleme"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Seçime Git"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Yok>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "& Nesneler"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "İşlem Listesi"

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tür"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr ".po dosya dizini seçin"

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Herhangi bir oturum bilgisi kaydetme"

#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Pointer"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr ".lps dosyasını IDE yapılandırma dizinine kaydedin"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr ".lpi dosyasına kaydet"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr ".lps dosyasını proje dizinine kaydedin"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Oturum bilgisini\" içine kaydet "

#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ".lpi proje ana bilgi dosyasıdır, .lps yalnızca oturum verisi için ayrı bir dosyadır."

#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr "Konum"

#: lazarusidestrconsts.lispositionoutsideofsource
#, fuzzy,badformat
msgid "%s (position outside of source)"
msgstr "% S (kaynak dışındaki konum)"

#: lazarusidestrconsts.lisppuinwrongdirectory
msgid "ppu in wrong directory=%s."
msgstr "Ppu yanlış dizindeki = %s."

#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
#, fuzzy,badformat
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr "% S.ppu bulunamadı. Fpc.cfg dosyanızı kontrol edin."

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Önceden geçen kelime"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
#, fuzzy
#| msgid "primary config directory, where Lazarus stores its config files. Default is "
msgid "primary config directory where Lazarus stores its config files. Default is "
msgstr "Lazarus'un yapılandırma dosyalarını depoladığı birincil yapılandırma dizini.Varsayılan değer"

#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Birincil yapılandırma yolu"

#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr "Önceki %s"

#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Öncelikli"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Özel"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Özel Yöntem"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, fuzzy,badformat
#| msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages, which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Muhtemelen devam etmeden önce bazı paketler yüklemeniz gerekir.% SWarning: %s Projede fo"

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Prosedür"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Arabirimli Prosedür"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Program tespit edildi"

#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Bazı yararlı ayarlarla birlikte bir Free Pascal komut satırı programı eklendi."

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Program kaynağı, .pas, .pp veya .lpr gibi bir Pascal uzantısına sahip olmalıdır"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Bağımlılık zaten var"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Editör Dosyalarını Ekle"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Geçersiz Min-Max sürümü"

#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid Pascal unit name"
msgstr "Geçersiz Pascal birim adı"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Geçersiz sürüm"

#: lazarusidestrconsts.lisprojaddlocalpkg
msgid "Local (%s)"
msgstr ""

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Maksimum Sürüm (isteğe bağlı):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Minimum Sürüm (isteğe bağlı):"

#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr ""

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Yeni Gereksinim"

#: lazarusidestrconsts.lisprojaddonlinepkg
msgid "Online (%s)"
msgstr ""

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Paket ismi:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Paket bulunamadı"

#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr ""

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "Bağımlılık \" %s \\ \"bulunamadı %sPlease mevcut bir paketi seçin."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Maksimum Sürüm \" %s \\ \"geçersizdir.% SLütfen formunu kullanınız: major.minor.release.build %sSınav içi"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Maksimum Sürüm, Minimim Sürümünden daha düşüktür."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Minimum Sürüm \" %s \\ \"geçersiz.% SÜzelik major.minor.release.build %sDeğişimi kullanı"

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Proje zaten \" %s \\ \"paketi için bağımlılık yapıyor."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, fuzzy,badformat
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "\"% S \\ \"birim adı %swith dosyası \" %s \\ \"projesinde zaten mevcut."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "\" %s \\ \"birim adı %swith dosyası seçiminde zaten mevcut: \" %s \\ \"."

#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name \"%s\" is not a valid Pascal identifier."
msgstr "\" \\ \" %s \" birim adı geçerli bir Pascal tanımlayıcı değil. "

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Birim adı zaten var"

#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr "Proje %s"

#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Proje:"

#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "Proje"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Proje değiştirildi"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Proje disk üzerinde değişti"

#: lazarusidestrconsts.lisprojectcount
#, fuzzy,badformat
msgid "%d projects"
msgstr "% D proje"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Proje dizini"

#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Görev çubuğundaki başlık, projenin dizin yolunu da gösterir"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Proje dosya adı"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Projeyi Dahil Et Yolu"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Proje bilgi dosyası algılandı"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Proje çalıştırılabilir"

#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr "Çalıştırılabilen bir ikili çalıştırılabilir üretir."

#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Proje"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Proje makro özellikleri"

#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr ""

#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Proje Seçeneği"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Proje Çıktı dizini (ör. Ppu dizini)"

#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Proje çıktı dizini"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Projenin ana dosyasının olması gereken dizin"

#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Proje Oturumu"

#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "Proje oturumu değişti"

#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Proje kaynak dizinleri"

#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
#, fuzzy,badformat
msgid "%0:s%0:s At address %1:x"
msgstr "% 0: s% 0: s adresinde% 1: x"

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr " %s projesinde istisna sınıfı ' %s' çıktı."

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Proje %s, ' %s' istisnasını kaldırdı: %s %s"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
#, fuzzy,badformat
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "% 0: s% 0: s% 2 adresindeki '% 1: s' dosyasında: x"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
#, fuzzy,badformat
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "% 0: s% 0: s% 2 satırındaki '% 1: s' dosyasında: d"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
#, fuzzy,badformat
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "% 0: s% 0: s% 2 satırındaki '% 1: s' dosyasında: d:% 0: s% 3: s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Proje Src Yolu"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "Proje birimi"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Proje Birimi Yolu"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Proje Sihirbazı"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Silme bağımlılığını onaylayın"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Dosyayı kaldırmayı onayla"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, fuzzy,badformat
msgid "Delete dependency for %s?"
msgstr "% S için bağımlılığı silinsin mi?"

#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Proje Müfettişi - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Gerekli paketler kaldırıldı"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr " %s dosyasından projeden kaldırılsın mı?"

#: lazarusidestrconsts.lisprojinspremoveitemsf
#, fuzzy,badformat
msgid "Remove %s items from project?"
msgstr "% S öğeyi projeden kaldır\""

#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
#, fuzzy,badformat
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "% S proje dosyasının %s durum dosyasını okunamıyor %sError: %s"

#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
#, fuzzy,badformat
msgid "Unable to write state file for project %s%sError: %s"
msgstr "% S %sError: %s projesi için durum dosyası yazamadı"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Her zaman derle (hiçbir şey değişmese bile)"

#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr "Bağımlılık kontrolünde bir hata varsa, normalde gerekli değilse gerekli olabilir."

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Hata"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Program kaynağındaki otomatik oluşturma form listesini değiştiremiyor %sPlease önce hataları düzeltin."

#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Proje Kaynak Dizini İşareti"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Değer isteyin"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Özellikler (değiştirmek veya kaldırmak)"

#: lazarusidestrconsts.lisproperty
msgid "%s property"
msgstr ""

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Korunmuş"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Korumalı Yöntem"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Genel Yöntem"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Yayımlanmış Yöntem"

#: lazarusidestrconsts.lispublishedto
msgid "Published to %s"
msgstr ""

#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr ""

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Proje dizini yayınla"

#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Projeyi Yayınla"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ".lrs dosyalarını çıkış dizinine kaydedin"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr "Kaynak FPC için mevcut olacak."

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Bir Pascal biriminin uzantısı .pp veya .pas olmalıdır"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Sanal birimi düzenle"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Bu ada sahip bir birim zaten var.% SFile: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "unitname geçerli bir Pascal tanımlayıcısı değil."

#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "IDE, kullanım yan tümcesi genişletirken birim adı kullanılır"

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, fuzzy,badformat
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Birim adı ve dosya adı uyuşmuyor.% SÖrneği: unit1.pas ve Birim1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Convert & Delphi Project"

#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "&Yeni proje"

#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "& Open Project"

#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Aç & Son Proje"

#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "View & Örnek Projeler"

#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "QuickFix hatası"

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Hızlı düzeltmeler"

#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Hızlı düzeltme: Birimi çıkarma"

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Arama tanımlayıcısı"

#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Çık"

#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "Ve Lazarus'tan Çık"

#: lazarusidestrconsts.lisrange
#, fuzzy
msgctxt "lazarusidestrconsts.lisrange"
msgid "Range"
msgstr "Menzil"

#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Okuma hatası"

#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Gerçekten silinsin mi?"

#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Son sekmeler"

#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Kayıt"

#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Kaydedilmiş"

#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Kayıt / Yapı"

#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Yeniden"

#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Sicilleri"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Düzenli ifade"

#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Göreli"

#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Göreceli yollar"

#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Kaldır"

#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Kaldır?"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Geçersiz tüm özellikleri kaldır"

#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Tüm mesaj türü filtrelerini kaldır"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Tüm birimleri kaldır"

#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Derleyici Seçeneğini Kaldır İletiyi Gizle"

#: lazarusidestrconsts.lisremovedependenciesfrompackage
msgid "Remove %s dependencies from package \"%s\"?"
msgstr " %s bağımlılıklarını \" %s \\ \"paketinden kaldır\" \"mı"

#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr "\" \\ \" %s \" özelliği kaldırıldı. "

#: lazarusidestrconsts.lisremovefilesfrompackage
msgid "Remove %s files from package \"%s\"?"
msgstr " %s dosyalarını \" %s \\ \"paketinden kaldır\" "

#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Kurulum listesinden kaldır"

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Projeden Kaldır"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Arama yolundan kaldır"

#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Ekle yolu kaldırılsın mı?"

#: lazarusidestrconsts.lisremovelocalvariable
#, fuzzy,badformat
msgid "Remove local variable %s"
msgstr "% S yerel değişkeni kaldır"

#: lazarusidestrconsts.lisremovelocalvariable3
msgid "Remove local variable \"%s\""
msgstr "Yerel değişken \" %s \\ \"kaldır\" "

#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Mesaj Türü Filtresini Kaldır"

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Varolmayan dosyaları kaldırma"

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Seçilen birimleri kaldır"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Onları kaldır"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "\" Diğer kaynaklardan \\ \"yolları kaldırın \" "

#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Birim yolunu kaldır mı?"

#: lazarusidestrconsts.lisremoveuses
msgid "Remove uses \"%s\""
msgstr "Kaldır \" %s \\ \"\" yı kullanıyor "

#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Adını değiştirmek"

#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Adını değiştirmek ..."

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Dosyayı yeniden adlandır?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Dosya yeniden adlandırılamadı"

#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Yeniden adlandırılmış Tanımlayıcıların listesini göster"

#: lazarusidestrconsts.lisrenameto
#, fuzzy,badformat
msgid "Rename to %s"
msgstr "% S için yeniden adlandır"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Küçük harfe yeniden adlandır"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Projeyi tekrar aç"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Başka bir kodlamayla tekrar aç"

#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Tekrar et"

#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Tekrarlama Sayısı:"

#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Değiştir"

#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "\" %s \\ \"\" %s \\ \"ile değiştirildi."

#: lazarusidestrconsts.lisreplacedtypeswiths
#, fuzzy,badformat
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "\"% S \\ \"\" %s \\ \"ile değiştirildi."

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Değiştirme"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Değiştirme işlevleri"

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Değiştirmeler"

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Bilinmeyen özellikleri ve türleri düzelt"

#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Tüm tanımlayıcıyı değiştir"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Seçimi değiştirme başarısız oldu."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "Http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Yeniden tara"

#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr "Reset"

#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Tüm dosya filtrelerini varsayılanlara sıfırla mu?"

#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "Sola, Üste, En, Seçili bileşenlerin yüksekliği atalarının değerlerine sıfırlansın mı?"

#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr "Kaynak adı benzersiz olmalıdır."

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Kaynak kaydetme hatası"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Projenin kaynak türü"

#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Tekrar başlat"

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Sonuç:"

#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
msgstr ""

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
#, fuzzy
#| msgid "returns list of all values of case variable in front of variable"
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent    // the case list will be generated without extra indentation\n"
msgstr "Değişkenin önündeki tüm değişkenlerin değer listesini döndürür"

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Geri döndürme başarısız"

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Sağ"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Doğru demirleme"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Doğru kenarlık alanı.Bu değer, taban sınırlarına eklenir ve coğrafi alana doğru kullanılı"

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the right side is anchored. Leave empty for parent."
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Bu, sağ tarafın demirlediği kardeş kontrolüdür, ebeveyn için boş bırakın."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Sağ taraflar"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Doğru alan eşit"

#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Kök"

#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr "Kök dizini"

#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Çalıştır"

#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "\" Run and Design time \\ \"paketlerinde herhangi bir sınırlama yoktur."

#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Çalıştır"

#: lazarusidestrconsts.lisrunning
#, fuzzy,badformat
msgid "%s (running ...)"
msgstr "% S (çalışıyor ...)"

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Dosya yürütülebilir değil"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application \"%s\" is not executable."
msgstr "Sunucu uygulaması \" %s \\ \"çalıştırılabilir değil."

#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Çalıştır"

#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Yalnızca çalışma zamanı, IDE'ye yüklenemez"

#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "\" Yalnızca çalışma zamanı \\ \"paketleri yalnızca projeler içindir. IDE'ye yüklenemez, "

#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
#, fuzzy
#| msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE, unless some design time package requires them."
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr "\" Çalıştırma zamanı \\ \"paketleri projeler tarafından kullanılabilir.İngilizce yüklenemez"

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Çalıştırma başarısız oldu"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Soyut Metotlar - henüz geçersiz kılınmadı"

#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Soyut metotların %s"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "İmleç sınıf bildirisinde değil"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE meşgul"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr " %s soyut bir sınıf, %s soyut yöntemleri var."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Soyut yöntem bulunamadı"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Seçilenlerin tümünü geçersiz kıl"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Seçilen ilk geçersiz kıl"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Hiçbir şey seçilmedi"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr " %s soyut yöntemleri geçersiz kılmak için %s vardır.% S Tasarruf öğelerinin oluşturulması gereken yöntemleri seçiniz"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Geçersiz kılmak için soyut yöntemler kalmadı."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Bu yöntem, geçerli sınıfta tanımlandığı için geçersiz kılınamaz"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Geçerli sınıfın soyut yöntemlerini gösteremiyor, çünkü"

#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Kaydet"

#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Hepsini kaydet"

#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Hepsini Kaydet"

#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Değiştirilen tüm dosyaları kaydet"

#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Tümünü Kaydet / Orijinal İletileri Dosyaya Kaydet ..."

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Kaydet ve çıkış iletişim kutusu"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Kaydedin ve IDE'yi yeniden oluşturun"

#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Farklı kaydet"

#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Değiştirilen dosyaları kaydet"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Değişiklikleri Kaydet?"

#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Değişiklikleri %s projesine kaydedilsin mi?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Geçerli düzenleyici dosyasını kaydet"

#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "IDE ayarları ile kaydedildi"

#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Proje oturumu ile kaydedildi"

#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Dosyayı farklı kaydet"

#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "\" %s \\ \" %s dosyayı kaydetmeden önce \" %s \\ \"kaydedilsin mi?"

#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Makroyu farklı kaydet"

#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Mesajları kaydet"

#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Projeyi %s kaydet (* %s)"

#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr "Oturum değişiklikleri %s projesine kaydedilsin mi?"

#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Katlamayı kaydet"

#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr "Kod editörü, blok bloklamayı (geçici olarak gizleme) destekler."

#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Atlama geçmişini kaydet"

#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr "Kod düzenleyicisinde bir tanımlayıcıya Ctrl-tıklama atlama geçmişinde saklanır."

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Ayarları kaydet"

#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Gösterilen Mesajları Dosyaya Kaydet ..."

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Kaydet "

#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr "Dosya \" %s \\ \"\" %s \\ \"olarak kaydedildiğinde satır %s, sütun %s karakterleri kayboluyor."

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Ölçekleme faktörü:"

#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr "Üst dizindeki dosyaları tara"

#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr "Kardeş dizinlerde (üst dizin ve alt öğeleri) kaynak dosyaları ara"

#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Tarama"

#: lazarusidestrconsts.lisscanning2
#, fuzzy,badformat
msgid "%s. Scanning ..."
msgstr "% S. Tarama ..."

#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Tarama üst dizini"

#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Arama yolları"

#: lazarusidestrconsts.lissearchunit
msgid "Search Unit \"%s\""
msgstr "Arama Birimi \" %s \\ \""

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
#, fuzzy
#| msgid "secondary config directory, where Lazarus searches for config template files. Default is "
msgid "secondary config directory where Lazarus searches for config template files. Default is "
msgstr "Ikincil yapılandırma dizini, burada Lazarus yapılandırma şablon dosyalarını arar.Varsayılan"

#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "İkincil yapılandırma yolu"

#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr "İkinci test"

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Bakın mesajlar."

#: lazarusidestrconsts.lisseeprojectprojectinspector
#, fuzzy,badformat
msgid "%sSee Project -> Project Inspector"
msgstr "% SSee Projesi -> Proje Müfettişi"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Bir yardım öğesi seçin:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Bir düğüm seçin"

#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr "Başka bir LCL widget'ı seçin (makro LCLWidgetType)"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Delphi form dosyalarını seçin (* .dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Seçilmiş"

#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr "Seçilen ek:"

#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "Seçilmiş ve alt kontroller"

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(Alt komşu seçildi)"

#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Seçilmiş Komutanın Haritalaması"

#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "Kurulum için seçildi"

#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "Kaldırma için seçildi"

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(Seçili sol komşu)"

#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr "Mesaj penceresinde seçilen mesaj:"

#: lazarusidestrconsts.lisselectedmodeswerecompiled
msgid "Selected %d modes were successfully compiled."
msgstr ""

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(Seçilmiş doğru komşu)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(Seçkin üst komşu)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Dosyayı seçin"

#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Select FPC kaynak dizini"

#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr ""

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Seçim dize sabitini aşıyor"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Seçim aracı"

#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Select Lazarus kaynak dizini"

#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr " %s yolunu seç"

#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "Hedef dizini seçin"

#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Set all colors:\" Tüm renkleri ayarla"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Varsayılana ayarla"

#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr "Derleyici mesajlarını başka bir dile çevirecek şekilde ayarlayın (yani İngilizce değil). Örneğin"

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Varsayılan girintiyi ayarla)"

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Kısa:"

#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Kısa, yol yok"

#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr "Uygulama başlatıldığında \" %s \\ \"bileşeni otomatik olarak oluşturulmalı mı?"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Göstermek"

#: lazarusidestrconsts.lisshowabstractmethodsof
msgid "Show abstract methods of \"%s\""
msgstr "Soyut yöntemleri göster \" %s \\ \""

#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Bileşen ağacını göster"

#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr ""

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Bildiri ipuçlarını göster"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Modlar arasındaki farkları göster ..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Boş birimleri / paketleri göster"

#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr "Show FPC message \" satırları derlendi \\ \""

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Glifleri Göster"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Cilt payını göster"

#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Yardımı göster"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Göster ipuçları"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Tanımlayıcıları göster"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Bilgi kutusunu göster"

#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Mesaj Tip Kimliğini Göster"

#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr ""

#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Sadece değişiklik göster"

#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
#, fuzzy
#| msgid "Show only one button in the taskbar for the whole IDE, instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr "\" \"Yalnızca görev çubuğunda pencere başına bir yerine tüm IDE için bir düğme gösterin.\" Bazı Linux Rüzga"

#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr ""

#: lazarusidestrconsts.lisshowoverviewgutter
#, fuzzy
#| msgid "Show overview Gutter"
msgid "Show overview gutter"
msgstr "Genel bakış Cilt Payı"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Paketleri göster"

#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Kaynak düzenleyicinin konumunu göster"

#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "En son kullanılan tanımlayıcıları en üstte göster"

#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Göreli yolları göster"

#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr "Tüm kontrolleri ağaç hiyerarşisinde gösterir."

#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr "Alttaki kutu, seçili mülk için açıklama gösterir."

#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr "En önemli ayarlar için kurulum iletişim kutusunu göster"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Özel karakterleri göster"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Durum çubuğunu göster"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Birimleri göster"

#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr "Başlatma / sonlandırma bölümlerine sahip birimleri göster"

#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr "Bu birimler, program / uygulama tarafından kullanılan genel verileri başlatabilir. Dikkatli bir şekilde kaldırın."

#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Kullanılmayan birimleri göster ..."

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Hata ayıklarken değer ipuçlarını göster"

#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "Sürümü göster ve çık"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "En küçültmek"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Kardeş"

#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Basit Program"

#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "En basit Free Pascal komut satırı programı."

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Basit sözdizimi"

#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Hataları atla"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Dosyayı atla"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Dosyayı atla ve yüklemeye devam et"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Son proje yüklemeyi atla"

#: lazarusidestrconsts.lisskipthesewarnings
msgid "Skip these warnings"
msgstr "Bu uyarıları atla"

#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr "Daha yavaş ama daha doğru."

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Daha hızlı değil, daha küçük"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Maçlar"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Üzgünüz, bu tür henüz uygulanmadı"

#: lazarusidestrconsts.lissortforscope
msgid "Sort for scope"
msgstr "Kapsam alanı için sıralama"

#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr "Sıralama"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Artan"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Harfe duyarlı"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Azalan"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Alan"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Alanı Yoksay"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Çizgiler"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Seçenekler"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragraf"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Önizleme"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Onayla"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Sıralama seçimi"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Kelimeler"

#: lazarusidestrconsts.lissortunicoderangelistalphabetically
msgid "Sort Unicode range list alphabetically"
msgstr ""

#: lazarusidestrconsts.lissourceanddestinationaresame
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr ""

#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Kaynak ve Hedef aynı: %s %s"

#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source Breakpoint ..."
msgstr "& Kaynak Kesme Noktası ..."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory \"%s\" does not exist."
msgstr "Kaynak dizini \" %s \\ \"mevcut değil."

#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Kaynak Düzenleyici Pencere Yöneticisi"

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Kaynak değiştirildi"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Sayfa kaynağı \" %s \\ \"değişti Save?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
#, fuzzy,badformat
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "Sayfaların kaynakları değişti. Sayfayı kaydet \" %s \\ \"? (% D daha fazla)"

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Kaynak yolları"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Eşit alan"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Src OS"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Arama"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Metin ara"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Dönüşümü Başlat"

#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "IDE'yi Başlat"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Yeni bir proje ile başla"

#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr "Durum çubuğu, mülkün adını ve yayınlandığı sınıfı gösterir."

#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Dur"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Mevcut hata ayıklamasını durdurun ve projeyi yeniden oluşturun?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Hata ayıklamayı durdur mu?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Hata ayıklamayı durdurun?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "İstisna Durdur"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Hata ayıklamayı durdurun\""

#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Yol sınırlayıcılarını sakla \\ ve / as"

#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Garip lpi dosyası"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Akış hatası"

#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Dize"

#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Stil"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Alt Prosedür"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Aynı seviyedeki Alt Prosedür"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Başarı"

#: lazarusidestrconsts.lissuccessfullyexported
msgid "Successfully exported to \"%s\"."
msgstr "\" \\ \" %s \" e başarıyla ihraç edildi. "

#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
#, fuzzy,badformat
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr "% D BuildMod \" %s \\ \"ya başarıyla ihraç edildi."

#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
msgid "Successfully exported compiler options to \"%s\"."
msgstr "Derleyici seçeneklerini \" %s \\ \"olarak başarıyla ihraç etti."

#: lazarusidestrconsts.lissuccessfullyimported
#, fuzzy,badformat
msgid "Successfully imported from \"%s\"."
msgstr "\"% S \\ \"adresinden başarıyla alındı."

#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
#, fuzzy,badformat
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr "\"% S \\ \"adresinden% d BuildMod'u başarıyla içe aktardı."

#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
#, fuzzy,badformat
msgid "Successfully imported compiler options from \"%s\"."
msgstr "\"% S \\ \"dizininden derleyici seçenekleri başarıyla alındı."

#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Yeni dosyanın varsayılan adını küçük harflerle öner"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Şüpheli yol içeriyor"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Şüpheli birim yolu"

#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "SVN Düzeltmesi:"

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Geçersiz değişken adı"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, fuzzy,badformat
msgid "\"%s\" is not a valid identifier."
msgstr "\"% S \\ \"geçerli bir tanımlayıcı değil."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Sistem değişkenini geçersiz kıl"

#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Anahtar Filtresi Ayarları"

#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr "Bileşen adını sorduktan sonra Favoriler sekmesine geçin."

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Sözdizimi modu"

#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "System.ppu bulunamadı. Fpc.cfg dosyanızı kontrol edin."

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Sekme"

#: lazarusidestrconsts.listaborderconfirmsort
#, fuzzy,badformat
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "\"% S \\ \"konumundaki tüm alt denetimlerin sekme sıralarını konumlarına göre mi?"

#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Seçilen denetimi sekme sırasına getir"

#: lazarusidestrconsts.listaborderof
#, fuzzy,badformat
msgid "Tab Order of %s"
msgstr "% S Sekmesi Sırası"

#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr ""

#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr ""

#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Kontroller için X ve Y pozisyonlarına göre sekme sırasını hesapla"

#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Seçili denetimi sekme sırasına taşıyın"

#: lazarusidestrconsts.listabsfor
#, fuzzy,badformat
msgid "Tabs for %s"
msgstr "% S için sekmeler"

#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr "Bir Anlık Fotoğraf Alın"

#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Hedef:"

#: lazarusidestrconsts.listarget2
msgid ", Target: %s"
msgstr ", Hedef: %s"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Hedef CPU"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Hedef dosya adı: (-o, empty = birim çıktı dizini kullan)"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Hedef dosya adı (-o):"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Projenin hedef dosya adı"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Hedef dosya adı + params"

#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "Hedef yalnızca okunabilir"

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Hedeflenen İşletim Sistemi"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Düzenlenebilir Hücre"

#: lazarusidestrconsts.listemplateeditparamcellhelp
#, fuzzy,badformat
#| msgid "Inserts an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit)%0:s%0:s  while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\"%0:sThe quotes are optional%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked. (the 3rd refers to \"2\") %0:s%0:s\"sync can be shortened to \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")"
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s  while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "Düzenlenebilir bir Hücre ekler.Hücreler sekme tuşunu kullanarak gezilebilir.% 0: s\" param \\ \"makrosu alı"

#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "Şablon dosyası"

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Dizini test et"

#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "Test URL'si"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "Uygulama Paket \" %s \\ \"için oluşturuldu"

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, fuzzy,badformat
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "\" %s \\ \"sınıfı bir TControl'tir ve olmayan bir denetleyiciye yapıştırılamaz.% S yapıştırılamaz."

#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The Codetools found an error:%s%s"
msgstr "Codetools bir hata buldu: %s %s"

#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
#, fuzzy,badformat
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "\"% S \\ \"derleyici dosyası doğru görünmüyor: %s %s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, fuzzy,badformat
#| msgid "The component %s can not be deleted, because it is not owned by %s."
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "% S bileşeni silinemiyor, çünkü %s tarafından sahip değil."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, fuzzy,badformat
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "\"% S \\ \"sınıfının bileşen editörü şu hatayı oluşturdu: %s \" %s \\ \""

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, fuzzy,badformat
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr " %s \" %s \\ \" %s fi \\ %s \" %s \\ \" %s \" %s \\ \" %s "

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, fuzzy,badformat
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "% S bileşeni %s'dan devralındı.% SDeğiştirilmiş bir bileşen silmek için atayı aç ve d"

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, fuzzy,badformat
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr " %s bileşeni %s'dan miras alınmıştır.% STürekli bir bileşeni yeniden adlandırmak atayı açar ve yeniden başlatır"

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "Bileşen adı, form / veri modülündeki tüm bileşenlerde benzersiz olmalıdır. Ad "

#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "Yapılandırma indirgenir / dönüştürülür."

#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, fuzzy,badformat
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "% S, varolmayan bir dizin içeriyor: %s %s"

#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, fuzzy,badformat
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr " %s bir yıldız * karakteri içeriyor.% SLazarus bunu normal karakter olarak kullanıyor v"

#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "Şu anki FPC'nin yapılandırma dosyası yok, muhtemelen bazı birimleri özlüyor olacak"

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, fuzzy,badformat
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "\"% S \\ \" %s hata ayıklayıcı mevcut değil veya çalıştırılabilir değil.% S Araçlar -> Seçenekler -> Hata ayıklayıcıyı seçm"

#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr "Hata ayıklayıcı yürütülebilir dosyasının adı genellikle \" %s \\ \"dir, lütfen tam dosya yolunu belirtin."

#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "Varsayılan mod, oturumda değil, projede saklanmalıdır."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s\"%s\" does not exist."
msgstr " %s hedef dizini \" %s \\ \"mevcut değil."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
#, fuzzy,badformat
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "\"% S \\ \"hedef dizini yok %sLütfen proje hedef dosya adını kontrol edin Men"

#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "\" \"\" %s \\ \"dizini herhangi bir proje içerme dosyası içermiyor"

#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
#, fuzzy,badformat
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "\"% S \\ \"dizini artık hiçbir proje birimi içermiyor. Bu dizini projeni"

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "\" \\ \" %s \" dizini birim yolunda artık gerekli değil %sRemove it? "

#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory \"%s\" is not writable."
msgstr "\" %s \\ \"dizini yazılabilir değil."

#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr " %s dizini bulunamadı."

#: lazarusidestrconsts.listhefile
#, fuzzy,badformat
msgid "The file \"%s\""
msgstr "Dosyalar\""

#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Dosya %s bir lpi dosyası gibi görünmüyor."

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "\" \"Dosya dizini, bildirim bulma gibi işlevler için gerek duyulur. Tarama sırasında kaynaklarÄ"

#: lazarusidestrconsts.listhefileisasymlinkopeninstead
#, fuzzy,badformat
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
msgstr "\" %s \\ \"dosyası bir sembolik bağ.% SOpen \" %s \\ \"yerine?"

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, fuzzy,badformat
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "\" %s \\ \"dosyası bir Lazarus projesi değil.% SBu \" %s \\ \"için yeni bir proje oluşturun?"

#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr "Dosya maskesi \" %s \\ \"geçersiz."

#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "Dosya maskesi \" %s \\ \"geçerli bir düzenli ifade değil."

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, fuzzy,badformat
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "\"% S \\ \"dosyası bir program gibi görünüyor.% S Geçerli projeyi kapatın ve yeni bir Lazarus projesi oluşturun"

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr " %s dosyası mevcut bir Lazarus Projesinin program dosyası gibi görünüyor\""

#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
#, fuzzy,badformat
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
msgstr " %s paketinin kaynak dizinlerinden birinde% \" %s \\ \"dosyası bulundu v"

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, fuzzy,badformat
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "\"% S \\ \"dosyası bulunamadı.% SBunu kendiniz bulmak istiyor musunuz?"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, fuzzy,badformat
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "\"% S \\ \"dosyası bulunamadı %sGünlük proje yüklenmeye devam edecek, %sAbort yükü durduraca"

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr " %s tarafından kullanılan aşağıdaki yöntemler kaynakta değil %s %s %s %s %sÇıkan referansları kaldır\""

#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "FPC kaynak dizini \" %s \\ \"doğru görünmüyor: %s %s"

#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
#, fuzzy,badformat
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "Free Pascal derleyici yürütülebilir dosyasının adı genellikle \" %s \\ \"dir. Ayrıca hedef s"

#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr "IDE hala derleniyor."

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Tanımlayıcı bir birimdir, lütfen birimi yeniden adlandırmak için Dosya - Farklı Kaydet işlevini kullanın."

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, fuzzy,badformat
#| msgid "The key %s%sis already assigned to %s.%sRemove the old assignment and assign the key to the new function%s%s?"
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "Anahtar %s %s zaten %s atanıyor.% S Eski atamayı kaldır ve anahtarı yeni f'ye at"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, fuzzy,badformat
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "Uygulama Paket %s %s yürütülmek için yalvardı yok ya da çalıştırılabilir değil.% SDeğe"

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, fuzzy,badformat
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "Başlatılan uygulama \" %s \\ \" %s yok ya da çalıştırılabilir değil.% S Çalıştır -> Parametreleri çalıştı"

#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
#, fuzzy,badformat
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "Lazarus dizini IDE kaynaklarını ve LCL'nin paket dosyalarını ve birçok standı içeriyo"

#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
#, fuzzy,badformat
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "\"% S \\ \"Lazarus dizini doğru görünmüyor: %s %s"

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
#, fuzzy
#| msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "LFM (Lazarus form) dosyası geçersiz özellikler içeriyor"

#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "\" \\ \" %s \" makrosu \\ \" %s \" ile başlamaz. "

#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "\" Make \\ \"yürütülebilir dosyanın adı genellikle \" %s \\ \"dir IDE'u oluşturmak için gereklidir"

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Yeni ekleme dosyası henüz include arama yolunda değil %sAdd dizini %s mi?"

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Yeni birim henüz birim arama yolunda değil %sAdd dizini %s?"

#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "Eski yapılandırma güncellenecektir."

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\" Diğer kaynaklar \\ \"zaten \" Diğer birimler dosyaları \\ \" %s %s"

#: lazarusidestrconsts.listheoutputdirectoryismissing
#, fuzzy,badformat
msgid "The output directory \"%s\" is missing."
msgstr "\"% S \\ \"çıktı dizini eksik."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr " %s dizininin çıktı dizini %s içerdiği arama yolunda listeleniyor."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr " %s dizininin çıkış dizini, %s dizisinin devralınan kapsayıcı arama yolunda listeleniyor."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr " %s çıktı dizini, %s ürününün devralınan birim arama yolunda listeleniyor."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr " %s çıktı dizini %s birim arama yolunda listeleniyor."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "Çıkış dizini ayrı bir dizinde olmalı ve herhangi bir kaynak dosyası içermemelidir."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "Sahip sınıfının bu adı var"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Sahibinin adı var"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, fuzzy,badformat
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr " %s paketi \" %s \\ \"yolunu IDE'nin include yoluna ekliyor.% SBu muhtemelen bir yanlış yapılandırm"

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, fuzzy,badformat
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr " %s paketi, \" %s \\ \"yolunu IDE birim yoluna ekliyor.% SBu muhtemelen yanlış yapılandırmadı"

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Paket zaten bu ada sahip bir birim içeriyor."

#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, fuzzy
#| msgid "The package %s cannot be installed, because it requires the package \"%s\", which is a runtime only package."
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr " %s paketi yüklenemiyor, çünkü \" %s \\ \"paketi gerektiriyor, bu da bir runtime o"

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, fuzzy
#| msgid "The package %s can not be uninstalled, because it is needed by the IDE itself."
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr "\" \" %s paketi kaldırılamaz, çünkü IDE kendisi tarafından gerekli."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, fuzzy,badformat
#| msgid "The package %s does not have any \"Register\" procedure, which typically means, it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr " %s paketi herhangi bir \" Kayıt \\ \"prosedürüne sahip değil, genelde provi deği"

#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr " %s paketi zaten listede"

#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr " %s paketi bir tasarım zamanı paketi değil, IDE'ye kurulamıyor\""

#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "\" \\ \"make \" yolu doğru değil: \\ \" %s \" "

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, fuzzy,badformat
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "\" \\ \"make \" programı bulunamadı.% SBu araç Lazarus'u oluşturmak için gereklidir. "

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Proje derleyici seçenekleri ve ana kaynaktaki yönergeler farklıdır. Yeni birim için "

#: lazarusidestrconsts.listheprojectdoesnotusedwarf
msgid "The project does not write debug info in Dwarf format. The \"%s\" supports only Dwarf."
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, fuzzy,badformat
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "\" \"Proje, LCLBase tarafından gerekli olan LCL birim arayüzlerini kullanmıyor"

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Projenin ana kaynak dosyası yok."

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "Proje bilgi dosyası \" %s \\ \" %s proje ana kaynak dosyasına eşit!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "Proje bilgi dosyası \" %s \\ \" %shas disk üzerinde değişti."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, fuzzy,badformat
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Proje, %s oluşturulmadan önce kaydedilmelidir. Test Dizini seçeneğini IDE seçeneklerinde, %syo"

#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr ""

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, fuzzy,badformat
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Proje hedef OS = %s ve CPU = %s kullanıyor.% S Bu hedef için system.ppu FP'de bulunamadı"

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
#, fuzzy,badformat
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr "\" \"Proje hata ayıklama simgelerini harici bir dosyaya yazıyor. \"% S \\ \"sadece sembolleri destekliyo"

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr ""

#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
#, fuzzy,badformat
msgid "%sThere are additional notes for this message on%s"
msgstr "% SBu ileti için %s üzerinde ek notlar var"

#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr "Çelişen anahtarlar yok"

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Dizinde aynı ada sahip başka dosyalar var, %svhich yalnızca farklı durumda: %s %s %sDele"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, fuzzy,badformat
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr " %s adlı dosyada aynı isim ve benzeri bir uzantıya sahip bir dosya var: %s %sGüçlü Dosya: %s"

#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Bu ada sahip zaten bir yapı modu var."

#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr "zaten %s isminde bir bileşen sınıfı var."

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "zaten bu isimdeki bir bileşen var"

#: lazarusidestrconsts.listhereisalreadyafilein
msgid "There is already a file%s%s%sin %s"
msgstr "zaten %s %s %sin %s adlı bir dosya var"

#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
#, fuzzy,badformat
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr " %s dosyasında \" %s \\ \"dosyası zaten var: %s %sNew: %s %s %sDevam edilsin mi?"

#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, fuzzy,badformat
msgid "There is already a form with the name \"%s\""
msgstr "\"% S \\ \"adı olan bir form zaten var"

#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name \"%s\"."
msgstr "\" \"\" %s \\ \"adı olan bir makro zaten var."

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "\" \"\" %s \\ \"\" adı olan bir IDE makrosu zaten var "

#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr "Listede bir %s paket zaten var"

#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
#, fuzzy,badformat
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr " %s %sinde bir birim \" %s \\ \"zaten var: %s %sNew: %s %s Birimin searc olduğundan emin olmanız gerekiyo"

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, fuzzy,badformat
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "\"% S \\ \"adı olan bir birim zaten var Pascal tanımlayıcıları benzersiz olmalıdır."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Projede \" %s \\ \"adı olan bir birim var %sLütfen farklı bir ad seçin"

#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr " %s dizininde hiçbir fpc.exe yok. Genellikle make çalıştırılabilir dosyası birlikte kuruldu"

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "En az bir yapı modu olmalı."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "Kaynak sınıfı \" %s \\ \"\" %s \\ \"dan iniyor Muhtemelen bu TForm için bir yazım hatasıdır."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Seçili bileşen %s yazarken bir hata oluştu: %s: %s %s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Seçilen bileşen %s'nin ikili akışını dönüştürürken bir hata oluştu: %s: %s %s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Bileşen akışını panoya kopyalarken bir hata oluştu: %s %s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "Kök bileşen silinemez."

#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Bu dosyalar silinecek"

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Bu ayarlar proje ile birlikte saklanır."

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Bu birimler bulunamadı:"

#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
#, fuzzy,badformat
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Tarama ve kod tamamlama için Free Pascal paketlerinin kaynakları gereklidir. Örnek içi"

#: lazarusidestrconsts.listhetargetdirectoryisafile
msgid "The target directory is a file:%s"
msgstr ""

#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr ""

#: lazarusidestrconsts.listhetargetisnotwritable
msgid "The target %s is not writable."
msgstr "Hedef %s yazılabilir değil."

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "Test Dizini bulunamadı: %s \" %s \\ \" %s (IDE seçeneklerine bakın)"

#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit \"%s\" already exists."
msgstr "Birim \" %s \\ \"zaten var."

#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "Birim %s paketine ait."

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, fuzzy,badformat
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "% S birimi %s birim yolunda iki kez var:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "Birimin adı var"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, fuzzy,badformat
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "\"% S \\ \"birim dosyası küçük harf değil %sFree Pascal derleyici, tüm vaka için arama yapmıyo"

#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
#, fuzzy,badformat
#| msgid "The unit %s is part of the FPC sources, but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "\" \" %s birimi FPC kaynaklarının bir parçası, ancak ilgili fpdoc xml dosyası bulunamadı.% SEit"

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr " %s birimi diğer dosyalar tarafından kullanılıyor, %sUpdate otomatik olarak başvuruyor?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "Ünitenin kendisi zaten \" %s \\ \"ismine sahip ve Pascal tanımlayıcıları benzersiz olmalı."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, fuzzy,badformat
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "\"% S \\ \"biriminde arama yolu %s paketinin \" %s \\ \"kaynak dizinini içeriyor"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, fuzzy,badformat
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "\"% S \\ \"çalışma dizini yok %sLütfen çalışma dizinini Menü> Çalıştır"

#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr "Bu bileşen zaten %s isminde bir sınıf içeriyor."

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Bu işlevin kaynak düzenleyicisinde açık bir .lfm dosyası olması gerekir."

#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "Bu yardım mesajı"

#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr "Bu, IDE dışında test ederek bir tasarım zamanı paketi için bir test projesi."

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, fuzzy,badformat
#| msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Bu, bir Pascal dosyası gibi görünüyor.% S Çeşitli p'lerden kaçınmak için küçük harfli dosyaların kullanılması önerilir"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr ""

#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Bu proje sadece varsayılan yapı moduna sahip."

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, fuzzy,badformat
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Bu kurulum tarafından Lazarus'u oluşturmak için bu seçenekler seti desteklenmiyor. \"% S \\ \"dizini "

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, fuzzy,badformat
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Bu ifade açılamıyor.% SPlease yeni bir prosedür / yöntem ayıklamak için bazı kod seçin."

#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr "Bu, tüm yapı modlarını bir defada değiştirmeye izin verecek, henüz uygulanmadı."

#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Bu dairesel bağımlılık yaratacaktır."

#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
#, fuzzy,badformat
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "Bu, panoya bir sürü metin ( %s) koyar.% SProceed?"

#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr "Konular"

#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Geçerli"

#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "İşlev"

#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr "Goto"

#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Hat"

#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr "Konuları değerlendirilmedi"

#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Kaynak"

#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Belirtmek, bildirmek"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Başlık"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Görev çubuğundaki başlık, örneğin şunu gösterir: project1.lpi - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Başlık (varsayılan olarak boş bırakın)"

#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "İşlev: yol sınırlayıcı ekleme"

#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: remove trailing path delimiter"
msgstr "İşlev: sondaki yol sınırlayıcı kaldır"

#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "İşlev: dosya uzantısını ayıklayın"

#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "İşlev: dosya adı + uzantısını ayıkla"

#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "İşlev: yalnızca dosya adını ayıkla"

#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "İşlev: dosya yolunu ayıkla"

#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(Bilinmeyen makro: %s)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Yolu:"

#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Dosya adlarını tam yol veya göreceli yolla gösteren geçiş yapma"

#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr "Araç Çubuğu Yapılandırması"

#: lazarusidestrconsts.listoolbaroptions
msgid "Toolbar"
msgstr "Araç Çubuğu"

#: lazarusidestrconsts.listoolbaroptionshighlight
msgid "Highlight toolbars buttons"
msgstr "Araç çubuklarının vurgulanması düğmeleri"

#: lazarusidestrconsts.listoolbaroptionsraise
msgid "Raise toolbars"
msgstr "Araç çubuklarını kaldırma"

#: lazarusidestrconsts.listoolhasnoexecutable
#, fuzzy,badformat
msgid "tool \"%s\" has no executable"
msgstr "\"% S \\ \"aracı çalıştırılabilir değil"

#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "Araç Başlığı: Başarısız"

#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "Alet Başlığı: Çalışıyor"

#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "Araç Başlığı: Kaydırıldı"

#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "Araç Başlığı: Başarı"

#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "Araç %s çıkış koduyla durduruldu, daha fazla bilgi almak için bağlam menüsünü kullanın."

#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr ""

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Üst"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "En üst demir"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Üst kenar boşluk: Bu değer, taban sınırlarına eklenir ve denetimin üzerindeki boşluk için kullanılı"

#: lazarusidestrconsts.listopinfoview
#, fuzzy
#| msgid "Show Class/Proc Hint"
msgid "Show Class/Procedure hint"
msgstr "Sınıf / Proc İpucu Göster"

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Tops"

#: lazarusidestrconsts.listopsiblingcomboboxhint
#, fuzzy
#| msgid "This is the sibling control to which the top side is anchored. Leave empty for parent."
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Bu, üst tarafın demirlendiği kardeş kontrolüdür, ebeveyn için boş bırakın."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Üstteki alan eşit"

#: lazarusidestrconsts.listotalpages
msgid "Total Pages: %s"
msgstr "Toplam sayfa: %s"

#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "İngilizce İletileri Çevir"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Ağacın yenilenmesi gerekiyor"

#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Taşınan iki taşınan dosya aynı dosya adına sahip olacaktır: %s %s %s %s %sin %s"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Türler (değiştirilmezse kaldırılmaz)"

#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Ek dizinler:"

#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Tüm paket üniteleri"

#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Tüm kaynak editör birimleri"

#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Tüm birimler"

#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "Varsayılan olarak yalnızca proje birimleri ve kaynak editör birimleri aranır"

#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Tüm düğümleri daralt"

#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Tüm düğümleri genişlet"

#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr "Dosya: %s"

#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Filtre)"

#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr "Uygulama Kullanımları: %s"

#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr "Uygulama kullanır: %s"

#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr "Arayüz Kullanır: %s"

#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr "Arabirim kullanır: %s"

#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Projeler ve paketler"

#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Tarama ..."

#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr "Tarama: %s birimi ..."

#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Arama)"

#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "Bu cümlenin bir sonraki varlığını bul"

#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "Bu cümle ile sonraki birimi bulun"

#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "Bu cümlenin önceki oluşumunu bul"

#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "Bu cümleyle önceki birimi bulun"

#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Seçilen birimler"

#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Dizinler için düğümleri göster"

#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "Proje ve paketler için düğümleri göster"

#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Birimler"

#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr "Birimler: %s"

#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr "Uygulamalar Tarafından Kullanılıyor: %s"

#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr "Uygulamalar tarafından kullanılır: %s"

#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr "Arayüzler tarafından kullanılıyor: %s"

#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr "Arayüzler tarafından kullanılır: %s"

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Bu mesajı tekrar gösterme."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Normal ifade hatası"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "UTF-8 olmadan yazı tipi"

#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Git satırına:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Bulunamadı"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Bu \" %s \\ \" %s \" %s \\ \"ile değiştirilsin mi?"

#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Aranıyor: %s"

#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Baştan aramaya devam et?"

#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Aramadan sonuna kadar devam etsin mi?"

#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Arama dizesi ' %s' bulunamadı!"

#: lazarusidestrconsts.lisuethecurre
#, fuzzy,badformat
#| msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Şu anki editör yazı tipi UTF-8'i desteklemiyor, ancak sisteminiz kullanıyor gibi görünüyor"

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Clear cache include"

#: lazarusidestrconsts.lisuidbytes
#, fuzzy,badformat
msgid "%s bytes"
msgstr "% S bayt"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Dahil olan:"

#: lazarusidestrconsts.lisuidinproject
msgid "In project:"
msgstr "Projede:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Hatları:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Ad:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "yok hayır"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Boyut:"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Tür:"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "Evet"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "CodeTools Değerlerini Göster"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Unable to convert binary stream to text"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Kopyala bileşenlerini panoya kopyalanabilir"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, fuzzy,badformat
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Kaynak dosyası %s \" %s \\ \"kaynak başlığına yorum eklenemedi.% S Muhtemelen bir sözdizimi hatası."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, fuzzy,badformat
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Kaynak T %s: FORMDATA %s kaynağına eklenemiyor \" %s \\ \".% S Muhtemelen bir sözdizimi hatası."

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
#, fuzzy,badformat
#| msgid "Unable to add the dependency %s, because the package %s has already a dependency %s"
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr "% S bağımlılığı eklenemiyor çünkü %s paketi zaten bir bağımlılık %s"

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
#, fuzzy
#| msgid "Unable to add the dependency %s, because this would create a circular dependency. Dependency %s"
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr "Bağımlılık %s eklenemedi, çünkü bu bir dairesel bağımlılık yaratacak Bağımlılık %s"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
#, fuzzy
#| msgid "Unable to add %s to project, because there is already a unit with the same name in the Project."
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Projede aynı adı taşıyan bir birim zaten olduğundan %s projeye eklenemedi."

#: lazarusidestrconsts.lisunabletobackupfileto
#, fuzzy,badformat
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "\"% S \\ \"dosyasını \" %s \\ \"dosyasına yedekleyemiyorum!"

#: lazarusidestrconsts.lisunabletochangeclassofto
#, fuzzy,badformat
msgid "%s%sUnable to change class of %s to %s"
msgstr "% S %s %s sınıfını %s olarak değiştirilemiyor"

#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
msgid "Unable to change project scaled in source.%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
#, fuzzy,badformat
msgid "Unable to change project title in source.%s%s"
msgstr "Kaynakta proje başlığı değiştirilemiyor.% S %s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Hedef dizini temizlenemedi"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "\" %s \\ \"dosyasını temizleyemiyor %sPlease izinleri kontrol et."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Bileşen metni ikili biçimde dönüştürülemiyor: %s %s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Dosya \" %s \\ \" %sError: %s"

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr " %s dosyası \" %s \\ \" %sinto binary stream ( %s) dosyasının metin form verilerini dönüştürmek mümkün değil"

#: lazarusidestrconsts.lisunabletoconverttoencoding
msgid "Unable to convert to encoding \"%s\""
msgstr "\" \\ \" %s \" kodlamasına dönüştürülemez "

#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Dosya kopyalanamıyor"

#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file \"%s\"%sto \"%s\""
msgstr "Dosya \" %s \\ \" %sto \" %s \\ \"kopya edilemiyor"

#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory \"%s\"."
msgstr "\" \\ \" %s \" dizini oluşturulamadı. "

#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Dosya oluşturulamadı"

#: lazarusidestrconsts.lisunabletocreatefile2
#, fuzzy,badformat
msgid "Unable to create file \"%s\""
msgstr "\"% S \\ \"dosyası oluşturulamadı."

#: lazarusidestrconsts.lisunabletocreatefile3
#, fuzzy,badformat
msgid "Unable to create file%s\"%s\""
msgstr "% S dosyası \" %s \\ \"dosyası oluşturulamadı."

#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link \"%s\" with target \"%s\""
msgstr "Hedef \" %s \\ \"\" ile \\ \" %s \" bağlantısı oluşturulamadı "

#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
#, fuzzy
#| msgid "Unable to create new file, because there is already a directory with this name."
msgid "Unable to create new file because there is already a directory with this name."
msgstr "Yeni bir dosya oluşturulamadı, çünkü zaten bu ada sahip bir dizin var."

#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr "Yeni yöntem oluşturulamadı."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Geçici lfm arabelleği oluşturulamadı."

#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Silinemiyor"

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Belirsiz dosya \" %s \\ \"silinemiyor"

#: lazarusidestrconsts.lisunabletoexecute
msgid "unable to execute: %s"
msgstr "Yürütemedi: %s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Bu ya da kullanılan birimlerden herhangi birinde bir ResourceString bölümü bulunamadı."

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, fuzzy,badformat
msgid "Unable to find a valid classname in \"%s\""
msgstr "\"% S \\ \"'da geçerli bir sınıf adı bulunamadı"

#: lazarusidestrconsts.lisunabletofindfile
#, fuzzy,badformat
msgid "Unable to find file \"%s\"."
msgstr "\"% S \\ \"dosyası bulunamadı."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, fuzzy,badformat
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Dosya \" %s \\ \"bulunamadı.% SEğer projenize aitse, arama yolunu %sProject -> Com"

#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "LFM Akışında %s bulunamadı."

#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Yöntem bulunamadı."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr ".lfm dosyası %s \" %s \\ \"için Pascal birimi (.pas, .pp) bulunamadı\" "

#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
#, fuzzy,badformat
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "\" %s \\ \"bileşen sınıfı bulunamadı.% S RegisterClass üzerinden kayıtlı değil ve lfm yoktu"

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Editör değişiklikleri alınamadı."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Tasarımcı için kaynak bulunamadı."

#: lazarusidestrconsts.lisunabletoloadfile2
#, fuzzy,badformat
msgid "unable to load file %s: %s"
msgstr "% S dosyası yüklenemedi: %s"

#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package \"%s\""
msgstr "Paket \" %s \\ \"yüklenemedi"

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, fuzzy
#| msgid "Unable to load the component class \"%s\", because it depends on itself."
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "Yapı sınıfı \" %s \\ \"yüklenemiyor çünkü kendisine bağımlı."

#: lazarusidestrconsts.lisunabletoopen
#, fuzzy,badformat
msgid "Unable to open \"%s\""
msgstr "\"% S \\ \"açılamıyor \" "

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Atalar bileşeni açılamadı"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
#, fuzzy,badformat
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Tasarımcı açılamadı.% STaşıma sınıfı %s, TForm veya TDa gibi tasarlanabilir bir sınıfdan inmiyo"

#: lazarusidestrconsts.lisunabletoread
#, fuzzy,badformat
msgid "Unable to read %s"
msgstr "% S okunamadı"

#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Dosyayı okunamıyor"

#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file \"%s\"."
msgstr "Dosya \" %s \\ \"okunamadı."

#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file \"%s\"%sError: %s"
msgstr "Dosya okunamıyor \" %s \\ \" %sError: %s"

#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr "Lpi okunamıyor"

#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "ExitStatus işlemi okunamıyor"

#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s\"%s\"."
msgstr "Proje bilgi dosyası %s \" %s \\ \"okunamadı."

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Eski yedek dosyası \" %s \\ \"kaldırılamadı!"

#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
msgid "Unable to remove project scaled from source.%s%s"
msgstr ""

#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr "Proje başlığını kaynaktan kaldıramadı %s %s"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Belirsiz dosyayı \" %s \\ \" %sto \" %s \\ \"\" olarak yeniden adlandıramıyor "

#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Dosya yeniden adlandırılamıyor"

#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file \"%s\" to \"%s\"!"
msgstr "\" %s \\ \"dosyasını \" %s \\ \"olarak yeniden adlandırılamadı!"

#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file \"%s\"%sto \"%s\"."
msgstr "Dosya \" %s \\ \" %s \" %s \\ \"yeniden adlandırılamıyor."

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Kaynak formun adı yeniden adlandırılamadı."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Metni yeniden adlandıramıyor, lütfen ileti penceresinde gösterilen hatayı düzeltin."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Kaynaktaki değişken adını yeniden adlandırılamadı."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Çalıştırılamadı"

#: lazarusidestrconsts.lisunabletorun2
msgid "Unable to run \"%s\""
msgstr ""

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "AnchorSide Kontrolü ayarlanamadı"

#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Yöntem gösterilemiyor."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Seçili bileşenleri akışlayamadı"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Seçili bileşenleri akış yapılamadı."

#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr " %s akış yapılamadı: T %s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr " %s: T %s'nin ikili bileşen akışını metin haline dönüştürülemez."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Proje kaynağında CreateForm deyimi güncelleştirilemiyor"

#: lazarusidestrconsts.lisunabletowrite2
#, fuzzy,badformat
msgid "Unable to write \"%s\""
msgstr "\"% S \\ \"yazamıyor"

#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Dosya yazamadı"

#: lazarusidestrconsts.lisunabletowritefile2
msgid "Unable to write file \"%s\"."
msgstr "Dosya \" %s \\ \"yazamadı."

#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file \"%s\"%sError: %s"
msgstr "Dosya \" %s \\ \" %sError: %s yazamıyor"

#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
msgstr "Proje bilgi dosyası %s \" %s \\ \"yazamadı %sError: %s"

#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Proje oturumu dosyası %s \" %s \\ \"yazamadı %sError: %s"

#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "\" \\ \" %s \" dosyasına yazılamıyor. "

#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
#, fuzzy,badformat
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "% S %sError: %s için xml dize yazamadı"

#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Tümünü işaretleme"

#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Geri alma"

#: lazarusidestrconsts.lisuninstall
#, fuzzy,badformat
msgid "Uninstall %s"
msgstr "% S kaldırıldı"

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Kaldırmak imkansız"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Seçimi kaldır"

#: lazarusidestrconsts.lisunit
msgctxt "lazarusidestrconsts.lisunit"
msgid "Unit"
msgstr "Birim"

#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit \"%s\" has changed. Save?"
msgstr "Birim \" %s \\ \"değişti Kaydet mi?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Birim tanımlayıcı var"

#: lazarusidestrconsts.lisunitinpackage
#, fuzzy,badformat
msgid "%s unit %s in package %s"
msgstr "% S birimi %s, %s paketinde"

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Birim adı zaten projede"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Birim adı başlıyor ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Birim adı içeriyor ..."

#: lazarusidestrconsts.lisunitnotfound
msgid "unit %s not found"
msgstr "Birim %s bulunamadı"

#: lazarusidestrconsts.lisunitnotfoundatnewposition
msgid "unit %s not found at new position \"%s\""
msgstr "Birim %s yeni konumda \" %s \\ \"bulunamadı \" "

#: lazarusidestrconsts.lisunitnotfoundinproject
#, fuzzy,badformat
msgid "A unit not found in project %s"
msgstr "% S projesinde bulunmayan bir birim"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Birim Çıktı Dizini"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "Birim yolu"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Birim yolları"

#: lazarusidestrconsts.lisunitrequirespackage
#, fuzzy,badformat
msgid "unit %s requires package %s"
msgstr "% S birimi %s paketini gerektiriyor"

#: lazarusidestrconsts.lisunitsnotfoundinproject
#, fuzzy,badformat
msgid "Units not found in project %s"
msgstr "% S projesinde bulunmayan birimler"

#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "İmzasız"

#: lazarusidestrconsts.lisunusedunitsof
#, fuzzy,badformat
msgid "Unused units of %s"
msgstr "% S kullanılmayan birimleri"

#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Alışılmadık derleyici dosya adı Genellikle fpc, ppc veya ppcross ile başlar."

#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr ""

#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Yukarı"

#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Güncelleme bilgisi"

#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Yalnızca harf durumu değiştiğinde diğer prosedür imzalarını güncelleyin"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Kaynakları güncelle\" mi"

#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
msgid "Updating PO files failed for package %s"
msgstr "PO dosyası güncelleniyor %s paketinde başarısız oldu"

#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Yükseltme"

#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Yapılandırmayı yükselt"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "Büyük harf"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
#, fuzzy
#| msgid "Uppercase string given as parameter"
msgid "Uppercase string given as parameter."
msgstr "Parametre olarak verilen büyük harfli dize"

#: lazarusidestrconsts.lisurlonwikithebaseurlis
msgid "URL on wiki (the base url is %s)"
msgstr "Wiki'deki URL (temel url %s)"

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Kullanım mesajı (-h seçeneği)"

#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr ""

#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Ansistrings kullanın"

#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Boolean değerleri için CheckBox kullanın"

#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Özel seçeneklerdeki yorumları kullanın"

#: lazarusidestrconsts.lisusedby
#, fuzzy,badformat
msgid " used by %s"
msgstr "% S tarafından kullanılıyor"

#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Tasarım zaman paketlerini kullanın"

#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr "Otomatik oluşturulan formlar için kullanılır."

#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr ""

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Tanımlayıcıyı kullan"

#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr " %s içindeki tanımlayıcı %s'yi kullanın %s"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Uygulama başlatılıyor"

#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Paket %s içerisindeki paketi %s kullan"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Paket paketi kullanın"

#: lazarusidestrconsts.lisusepackageinproject
#, fuzzy,badformat
msgid "Use package %s in project"
msgstr "% S paketinde proje kullan"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Projede paketi kullan"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr "Listeye ekle \" %s \\ \""

#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Kullanıcı tanımlı metin biçimlendirme"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr "Listeden kaldır \" %s \\ \""

#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr "Listede aç \" %s \\ \""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Kullanıcının ev dizini"

#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Birime Kullanım Bölümüne Ekle"

#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr " %s biriminde %s birimini kullan"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "BOM ile UTF-8"

#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Değer"

#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Değer %s"

#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Değer:"

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Değerler"

#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr "Varsayılan değerlerden değiştirilen değerler .lfm dosyasında saklanır ve Obj'de farklı şekilde gösterilir"

#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Değişken"

#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr "Ayrıntılı"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Yöntem çağrılarını doğrulayın"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Sürüm"

#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Sürüm uyuşmazlığı"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Dikey"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Sürüm bilgilerini panoya kopyala"

#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "Çok Ayrıntılı"

#: lazarusidestrconsts.lisviewbreakpointproperties
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Kesme Noktası Özellikleri ..."

#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr "Kaynağı Görüntüle"

#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "Birleştirici Görüntüle"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Kaynağı Görüntüle (.lfm)"

#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Uyarı:"

#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
msgstr "Uyarı: belirsiz dosya bulundu: \" %s \\ \"Kaynak dosya: \" %s \\ \""

#: lazarusidestrconsts.liswarnings
msgid ", Warnings: %s"
msgstr ", Uyarılar: %s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
#, fuzzy,badformat
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "% S Uyarı: Bu ana ünitedir, yeni ana ünite %s.pas olacaktır."

#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&İzlemek"

#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr "İzlemek:"

#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr "Eylem izle"

#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr "Oku"

#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr "Okuma yazma"

#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr "Yazmak"

#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr "& Veri / İzleme Kesme Noktası ..."

#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr "& Data / watch breakpoint ..."

#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "İzleme Özellikleri"

#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr "Kapsamı izle"

#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "Küresel"

#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr "Beyan"

#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr "Create Data / İzleme Kesme Noktası ..."

#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr "Lazarus IDE %s\" ya hoş geldiniz"

#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Lazarus'a hoş geldiniz %s %sGeniş sürüm %s'tan %s %s içinde bir yapılandırma zaten var"

#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Bina ihtiyacı olan şey"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Birim yeniden adlandırıldığında, başvuruları güncelleyin"

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
#, fuzzy
#| msgid "When enabled the current options are saved to the template, which is used when creating new projects"
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr "Etkinleştirildiğinde, mevcut seçenekler yeni proje oluştururken kullanılan şablona kaydedilir"

#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr ""

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Kaynak editörü imleci hareket edince, kod gezgini içindeki geçerli düğümü gösterin"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr "Pencere menüsü, resim yazısının yerine tasarlanmış form adını gösterir"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr "Özellikle başlığı boş bırakırsanız kullanışlıdır."

#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr "Pencere üstünde kalır"

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ","

#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Uygun bir derleyici olmadan tarama ve derleme kodu hayal kırıklığı yaratacak."

#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr "Doğru bir hata ayıklayıcı olmadan hata ayıklama hayal kırıklığı yaratacaktır."

#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Uygun bir Lazarus dizini olmadan bir sürü uyarı alırsınız."

#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr "Uygun bir \" make \\ \"çalıştırılabilir olmadan, IDE derlemesi mümkün değildir."

#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Doğru FPC kaynakları olmadan kod tarama ve tamamlama çok sınırlı olacaktır."

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Gerekli paketler ile"

#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "Hepsini sil"

#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "Tümünü devre dışı bırak"

#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "Hepsini etkinleştir"

#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "İfade"

#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr "Denetleme bölmesi"

#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Özellikleri"

#: lazarusidestrconsts.liswlwatchlist
#, fuzzy
#| msgid "Watch List"
msgctxt "lazarusidestrconsts.liswlwatchlist"
msgid "Watches"
msgstr "İzleme Listesi"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "İmleçteki sözcükler geçerli düzenleyicide"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Bina için çalışma dizini"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Çalıştırmak için çalışma dizini"

#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Yazma Hatası"

#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Yazma hatası: %s %sFile: %s %s %s"

#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr ""

#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr ""

#: lazarusidestrconsts.liswrongversionin
#, fuzzy,badformat
msgid "wrong version in %s: %s"
msgstr "% S içindeki yanlış sürüm: %s"

#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "XML Hatası"

#: lazarusidestrconsts.lisxmlparsererrorinfileerror
#, fuzzy,badformat
msgid "XML parser error in file %s%sError: %s"
msgstr "% S dosyasındaki XML ayrıştırıcı hatası %sError: %s"

#: lazarusidestrconsts.lisyes
msgid "Yes"
msgstr "Evet"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Bireysel formlar için bunu paket düzenleyicisiyle devre dışı bırakabilirsiniz"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Bunu, proje denetçisindeki açılır menü aracılığıyla bireysel formlar için devre dışı bırakabilirsiniz"

#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr "FPC ve FPC kaynaklarını http://sourceforge.net/projects/lazarus/?source=dir adresinden indirebilirsiniz"

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Hata ayıklama veya derleme yaparken Lazarus'u derleyemezsiniz."

#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr ""

#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr ""

#: lazarusidestrconsts.lis_all_
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Tüm>"

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Kaynak Düzenleyici"

#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr "Silme seçildi"

#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr "geçersiz"

#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr "Lpk dosyası geçersiz ( %s)"

#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr "Lpk dosyası geçerli ( %s)"

#: lazarusidestrconsts.lrspldunabletodeletefile
#, fuzzy,badformat
msgid "Unable to delete file \"%s\""
msgstr "\"% S \\ \"dosyasını silemiyor"

#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr "geçerli"

#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr "Lpl dosyalarını yeniden tara"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Kullanılan bölümlere paket birimi ekle"

#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "İkili"

#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Ondalık"

#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr "Seçili Kayıt Cihazları İçin Ekran Tipi"

#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr "Biçim"

#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr "Hex"

#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr "Sekizli"

#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr "Çiğ"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Ters Ekle"

#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr ""

#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr "Eklemek"

#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Nitelikler"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Otomatik olarak üretim numarasını artır"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr "Proje her derlendiğinde arttı."

#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "&Derlemek:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Karakter takımı:"

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Geçerli sayfayı kapat"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Koşullu tanımlar"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Yeni tanım oluştur"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Enable i18n"

#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr "Enter PID"

#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr "Listedeki satırları bir dize ile filtreleyin"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
#, fuzzy
#| msgid "Found, but not listed here: "
msgid "Found but not listed here: "
msgstr "Bulundu, ancak burada listelenmedi:"

#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr ""

#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr ""

#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr ""

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "I18n Seçenekleri"

#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr ""

#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr "Çalıştırılabilir biçim destekliyorsa sürüm bilgisi saklanır."

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Sürüm bilgilerini çalıştırılabilir dosyaya ekle"

#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Afrikaans"

#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Arapça"

#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or English)"
msgstr "Otomatik (veya İngilizce)"

#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Katalan"

#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Çince"

#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Çek"

#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Flemenkçe"

#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "İngilizce"

#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Fince"

#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Fransızca"

#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Almanca"

#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "İbranice"

#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr "Macarca"

#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Endonezya"

#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "İtalyan"

#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japonca"

#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Litvanya"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Dil seçenekleri"

#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polonya"

#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr "Portekizce"

#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "Brezilya Portekizcesi"

#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Rusça"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Dil seçimi:"

#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Slovak"

#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "İspanyol"

#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Türk"

#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ukrayna"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "& Binbaşı sürümü:"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Mi & ne sürümü:"

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Diğer bilgi"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "PO Çıktı Dizini:"

#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Kaynak"

#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "Tüm kaynakları silinsin mi?"

#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr "Dosya adı"

#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Tür"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revizyon:"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Devralınan bir girişi seçin"

#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Yeni bir arama başlat"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Sürüm numarası"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Yardım menü komutları"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Komuta komutları"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "CodeTools komutları"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Metin sütun seçme komutları"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "İmleç hareketli komutlar"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Metin düzenleme komutları"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Dosya menü komutları"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Metin katlama komutları"

#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Makro"

#: lazarusidestrconsts.srkmcatmarker
#, fuzzy
#| msgid "Text marker commands"
msgid "Text bookmark commands"
msgstr "Metin işaretleyici komutları"

#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr "Çok satırlı komutlar"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Paket menü komutları"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Proje menü komutları"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Menü komutlarını çalıştır"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Metin arama ve değiştirme komutları"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Metin seçme komutları"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Kaynak Dizüstü bilgisayarın komutları"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Senkron Düzenleme"

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Eşzamanlı Düzenleme (Hücrede Değil)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Eşzamanlı Düzenleme (seçilirken)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Şablon Düzenleme"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Şablon Düzenleme (Hücre Değil)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Araçlar menü komutları"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Görünüm menü komutları"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Komut:"

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Fikir ayrılığı "

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "derlemeyi iptal et"

#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Özet Yöntemler ..."

#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "Adres kesme noktası ekle"

#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "Kaynak kesme noktası ekle"

#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "Veri / saat işareti ekle"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Atlama Noktası Ekle"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "Saat ekle"

#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Programa ekle"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Kod şablonu tamamlama"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Blok Kopyala"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Blok Sil"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Git başlasın"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Git blok sonuna"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Blok Gizle"

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Engel girintisi"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Blok Taşı"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Set block begin"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Set block end"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Blok göster"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Blok değiştir"

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Girilmeyen blok"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Program / proje oluştur"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Dosya oluştur"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Lazar Yap"

#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr "Birçok mod oluştur"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Char"

#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr "Temizle ve derle"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Tüm metni sil"

#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Tüm Yer İşaretlerini Temizle"

#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "Geçerli dosya için Yer İşaretlerini Temizle"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Sütun Seç"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Sütun Mutlak sonuna seç"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Sütun Kesin başlangıçta seç"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Sütun Seçimi Sola"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Sütun Seçimi Satır Sonu"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Sütun Seçimi Çizgi Başlat"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Satır başında metne sütun seç"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Sütun Seç Sayfa Alt"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Sütun Sayfa Aşağı Seç"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Sütun Seç Sayfa Üstü"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Sütun Sayfa Yukarı Seç"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Sağdaki sütun seç"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Kolon Seç"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Sütun Select Word Sol"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Sütun Seç Word Sağ"

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Sütun seçimi modu"

#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "Program / proje derleyin"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "Yapılandırma dosyası oluştur"

#: lazarusidestrconsts.srkmeccopy
#, fuzzy
#| msgid "Copy selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Seçimi panoya kopyala"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Editörü yeni pencereye kopyala"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Editörü bir sonraki boş pencereye kopyala"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Düzenleyiciyi önceden boş pencereye kopyala"

#: lazarusidestrconsts.srkmeccut
#, fuzzy
#| msgid "Cut selection to clipboard"
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Seçimi panoya bırak"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Satırın başına sil"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Imleçte imleci sil"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Satırın sonuna kadar sil"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Son Şararı Sil"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Sözcüğün başlangıcına sil"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Geçerli satırı sil"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Sözcüğün sonuna kadar sil"

#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Programdan kopma"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diff"

#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "İmleci aşağıya taşı"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "İmleci mutlak sonuna getir"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "İmleci mutlak başlangıca getir"

#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Boş Yöntemler ..."

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "IDE seçenekleri"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "Modifiye değerlendirmek /"

#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Çıkarma Prosedürü"

#: lazarusidestrconsts.srkmecexttool
#, fuzzy,badformat
msgid "External tool %d"
msgstr "Dış araç% d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Harici araçlar ayarları"

#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Metni Bul"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Blok diğer ucunu bul"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Blok başlangıç ââbul"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Bildirimi Bul"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Tanımlayıcı Referanslarını Bul"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Dosyalarda Bul"

#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Sonraki Bul"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Bir Sonraki Kelime Bulunduğunu Bul"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr "Aşırı yük bul"

#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr "Aşırı Yük Bulun ..."

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Önceki Bul"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Önceki Word Bulgusunu Bulma"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Prosedür Tanımını Bul"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr "Bul prosedür yöntemi"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "İmleçte Katla"

#: lazarusidestrconsts.srkmecfoldlevel
#, fuzzy,badformat
msgid "Fold to Level %d"
msgstr "Düzeye% d katlayın"

#: lazarusidestrconsts.srkmecgotoeditor
#, fuzzy,badformat
msgid "Go to editor %d"
msgstr "Editöre git% d"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Geçerli dosya dahil etme yönergesine gidin"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Satır Numarasına Git"

#: lazarusidestrconsts.srkmecgotomarker
#, fuzzy,badformat
#| msgid "Go to Marker %d"
msgid "Go to bookmark %d"
msgstr "İşaretleyiciye git% d"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Goto XY"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Guess Misplaced $ IFDEF"

#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr "İmleç parçasını sola taşı (örn. CamelCase)"

#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr "İmleci kısayol kelimesini sağa taşı (örneğin CamelCase)"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "ChangeLog girişini ekle"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Karakter Haritasından Ekle"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "CVS anahtar kelime Yazarını Ekle"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "CVS anahtar kelimesini tarih ekle"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "CVS anahtar kelime Üstbilgisini Ekle"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "CVS anahtar kelime kimliğini ekle"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "CVS anahtar kelime Günlüğü ekle"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "CVS anahtar kelime Adını ekle"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "CVS anahtar kelime Revizyon ekle"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "CVS anahtar kelime Kaynağı Ekle"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Geçerli tarihi ve saati ekle"

#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Tam Dosya Adını Ekle"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "GPL bildirimini ekleyin"

#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr "GPL'yi ekleme (tercüme edildi)"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Bir GUID ekle"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "LGPL bildirimini ekleyin"

#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr "LGPL bildirimini ekleyin (tercüme edildi)"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Hattı kır, imleci bırak"

#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr "Insert MIT notice"

#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr "Insert MIT notice (translated) (tercüme edildi)"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Ekle Modu"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Değiştirilmiş LGPL bildirimini ekleyin"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr "Değiştirilmiş LGPL bildirimini ekleme (tercüme edildi)"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Geçerli kullanıcı adını ekle"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "Kontrol"

#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Ters Tepki"

#: lazarusidestrconsts.srkmeckeymapleft
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Ayrıldı"

#: lazarusidestrconsts.srkmeckeymapright
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Sağ"

#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "İmleci sola taşı"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Satırı kır ve imleci hareket ettir"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "İmleci satır sonuna taşı"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Hat seçme modu"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "İmleci satır başlangıcına taşı"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "İmleci çizgiye başlama metnine taşı"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Kilit Editör"

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "Kaynak Dizesi Oluşturun"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Eşleşen ayraça git"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Editörü sola taşı"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Editörü en sola kaydır"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Editörü yeni pencereye taşı"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Editörü bir sonraki boş pencereye taşı"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Editörü önce boş pencereye taşı"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Editörü sağa taşı"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Editörün en sağına git"

#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr ""

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Sonraki Yer İşareti"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Sonraki editöre git"

#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr "Geçmişteki bir sonraki editöre geç"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Aynı Kaynakta Sonraki Düzenleyiciye Git"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Bir sonraki pencereye git"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normal seçim modu"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "İmleçte Dosyayı Aç"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Üzerine Yazma Modu"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "İmleci sayfanın altına getir"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "İmleci bir sayfa aşağıya taşı"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "İmleci bir sayfa sola taşı"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "İmleci bir sayfa sağa taşı"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "İmleci sayfanın üstüne getir"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "İmleci bir sayfa yukarı taşı"

#: lazarusidestrconsts.srkmecpaste
#, fuzzy
#| msgid "Paste clipboard to current position"
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Panoyu geçerli konuma yapıştır"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "Duraklama programı"

#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr "Tüm ekstra çerçeveleri temizle"

#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr "İmleç tuşları ekstra harfleri temizle"

#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr "İmleç tuşları tüm ekstra işaretleri taşır"

#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr "Ekstra şapka ekle"

#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr "Ekstra ayarla"

#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr "Ek kalemi çıkart"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Önceki Yer İşareti"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Önceki düzenleyiciye git"

#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr "Geçmişte önceki editöre git"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Aynı Kaynaktan Önceki Düzenleyiciye Git"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Önceki pencereye git"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "Hızlı derle, bağlantı yok"

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "Kesme noktasını kaldır"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Boş Yöntemleri Kaldır"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Kullanılmayan Birimleri Kaldır"

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Yeniden Adlandırma Kimliği"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Metni Değiştir"

#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Bir hatayı bildirme"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "Hata ayıklayıcıyı sıfırlayın"

#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "İmleci sağa taşı"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "Programı çalıştır"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "Dosya çalıştır"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "Parametreleri çalıştır"

#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr ""

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Bir satır aşağı kaydır"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Bir harften çık"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Sağa kaydır"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Bir satır yukarı kaydır"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Aşağı Seç"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Hepsini seç"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Sekmeleri seçimde boşluklara dönüştür"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Mutlak sonuna kadar seçin"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Mutlak başlangıca seç"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Seç Goto XY"

#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr "Parça kelimesini sola (örn. CamelCase) seçin"

#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr "Parça kelimesini doğru seçin (örn. CamelCase)"

#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr "Sol Seç"

#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Satır Sonunu Seçin"

#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Satır Başlamasını Seç"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Metin satırda başlamak için seçin"

#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Sayfa Altını Seç"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Aşağı Sayfa Seç"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Sayfa Solu Seç"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Sayfayı Doğru Seç"

#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Sayfa Üstünü Seç"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Sayfa Yukarı Seç"

#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr "Doğru Seç"

#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr ""

#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr ""

#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr "Yapışkan seçmeye başla"

#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr "Yapışkan seçmeye başlayın (Sütunlar)"

#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr "Yapışkan seçerek başlayın (Hat)"

#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr "Yapışkan seçimi durdur"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Yukarı Seç"

#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Kelimenin sol tarafını seçin"

#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Doğru kelimeyi seç"

#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Word Sol Seç"

#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Doğru Word'yi seçin"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Ücretsiz bir Yer İşareti ayarla"

#: lazarusidestrconsts.srkmecsetmarker
#, fuzzy,badformat
#| msgid "Set Marker %d"
msgid "Set bookmark %d"
msgstr "İşaretçi% d'yi ayarla"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Sekmesi"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Soyut Metotları Göster"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr "Kod Bağlamını Göster"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "Yürütme noktasını göster"

#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr ""

#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr ""

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "Programı durdur"

#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Makro Çal"

#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Makro Kaydet"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Hücrenin son konumuna git"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Hücrenin ilk konumuna git"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Select Cell"

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Kaçış"

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Bir Sonraki Hücre"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Sonraki Hücre (tümü seçildi)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Sonraki Hücre (yalnızca ilkler)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Sonraki Hücre (tümü seçilmiş / yalnızca ilkler)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Önceki Hücre"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Önceki Hücre (tümü seçildi)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Önceki Hücre (yalnızca ilkler)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Önceki Hücre (tümü seçilmiş / sadece ilkler)"

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Syncro düzenlenmeye başla"

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Hücrenin son konumuna git"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Hücrenin ilk konumuna git"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Hücreyi seçin"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Kaçış"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Bitiş"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Bir Sonraki Hücre"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Sonraki Hücre (döndür)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Sonraki Hücre (tümü seçildi)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Sonraki Hücre (döndür / tümü seçildi)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Sonraki Hücre (yalnızca ilkler)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr "Sonraki Hücre (yalnızca ilk önce döndür / döndür)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Sonraki Hücre (tümü seçilmiş / yalnızca ilkler)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr "Sonraki Hücre (döndür / tümü seçili / sadece ilkler)"

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Önceki Hücre"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Önceki Hücre (tümü seçildi)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Önceki Hücre (yalnızca ilkler)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Önceki Hücre (tümü seçilmiş / sadece ilkler)"

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Sözdizimi Kontrolü"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Montajcıyı görüntüle"

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "Kesme noktası değiştir"

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Kesme noktalarını görüntüle"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Çağrı yığınını görüntüle"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Kod tarayıcıyı görüntüle"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "View Code Explorer"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Bileşen paletini görüntüle"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Görüntüleyici hata ayıklayıcı çıktısı"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Form ve birim arasında geçiş"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "View Documentation Editor"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "IDE hız düğmelerini görüntüle"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Yerel değişkenleri görüntüle"

#: lazarusidestrconsts.srkmectogglemarker
#, fuzzy,badformat
#| msgid "Toggle Marker %d"
msgid "Toggle bookmark %d"
msgstr "İşaretçi% d'yi değiştir"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Geçerli Kelime vurgusunu değiştir"

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "İletileri görüntüle"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Toggle Mode"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Nesne Gösterimi Müfettişini Görüntüle"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Kayıtları görüntüle"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Görüntüleme kısıtlama tarayıcısı"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Arama Sonuçlarını Görüntüle"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Kaynak Düzenleyiciyi Görüntüle"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Saatleri görüntüle"

#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Hepsini aç"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "İmleçte Aç"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "Bilinmeyen editör komutu"

#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Kullanılmayan Birimler ..."

#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "İmleci yukarı taşı"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Çapa editörünü görüntüle"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Bileşenleri görüntüleme"

#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Editör makrolarını görüntüle"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Formları görüntüle"

#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Geçmişi Görüntüle"

#: lazarusidestrconsts.srkmecviewpseudoterminal
#, fuzzy
#| msgid "View Terminal Output"
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr "Terminal Çıkışını Görüntüle"

#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Görünüm Sekmesi Sırası"

#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Konuları Görüntüle"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Birim bağımlılıklarını görüntüle"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Birim bilgilerini görüntüle"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Birimleri görüntüle"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Kelime Tamamlama"

#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "İmleç kelimesi-bitiş sola taşı"

#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "İmleç kelime sonunu sağa taşı"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "İmleç kelimesini sola taşı"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "İmleci sağa taşır"

#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr "Yakınlaştır"

#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr "Uzaklaştır"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Komutların tuşlarını düzenle"

#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr "Bir sonraki fare yukarı hareketle devam et"

#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr "Katlama yorumları"

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Seçimdeki kat yorumları"

#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr "Katlamalı etkin değil Ifdef"

#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr "\" \"Katıştırılmış yok ifdef (mixed state hariç)"

#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr "Seçimde katıştırılmış ifdef yok"

#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr "Seçimde katıştırılmış ifdef yok (karışık durum hariç)"

#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Yorumları gizle"

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Seçimdeki yorumları gizle"

#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr "Fareyle eşleşen eylem düğmesi aşağı"

#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr "Fare hareket çizgisini aşağıya ile eşleştir"

#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr "Fareyle aşağı hareket eylemi değiştiricileri"

#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr "Farenin hareket pos'unu aşağıya ile eşleştir"

#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr "Farenin tüm hareketlerini aşağıya doğru ara"

#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr "Etkin Ifdef aç"

#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr "Aktif Ifdef'i seçime aç"

#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Hepsini aç"

#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr "Hepsini açın Ifdef"

#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr "Seçimdeki tüm Ifdef'yi açın"

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr "Seçimde hepsini aç"

#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr "Yorumları açın"

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr "Seçimdeki yorumları aç"

#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr "Etkin olmayan Ifdef aç"

#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr "Aktif olmayan aç ifdef seçimi"

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Dosya salt okunur"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Dosya \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" Yazılabilir değil. "

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Kilitli"

#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Kayıt"

#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Rec-pause"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "İmleç Ekleme ve İzleme"

#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "İmleçte İzle ve Nokta Ekle"

#: lazarusidestrconsts.uembookmarknset
msgid "Bookmark &%s: %s"
msgstr ""

#: lazarusidestrconsts.uembookmarknunset
msgid "Bookmark &%s"
msgstr ""

#: lazarusidestrconsts.uembookmarknunsetdisabled
msgid "Bookmark %s"
msgstr ""

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Tümünü Kapat & Diğer Sayfalar"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "& Kapat Sayfa"

#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Dosya Adını Kopyala"

#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Yeni Pencereye Klon"

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Diğer Pencereye Klon Yap"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Yeni Pencere"

#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Hata ayıklama"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Kodlama"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "& Değerlendir / Değiştir ..."

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "& Find Declaration"

#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Diğer Pencerede Bul"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "& Yer İmine Git"

#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr ""

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "İşaretleyici"

#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "Deneyin ..."

#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Ters Tepki"

#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Satır Sona Erme"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "& Kilit Sayfası"

#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Sayfa Sola Taşı"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Sayfa En Sola Taşı"

#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Sayfayı Doğru Taşı"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Sayfanın En Yakına Taşın"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Yeni Pencereye Taşı"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Diğer Pencereye Taşı"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Yeni Pencere"

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Goto Next Bookmark"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Değiştirilmiş"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "& İmleç Dosyasını Aç"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Goto Previous Bookmark"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Prosedür Atlama"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Sadece oku"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refactoring"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Ücretsiz Yer İşareti Oluşturun"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Satır Numaralarını Göster"

#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Kaynak"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Yer işaretine çevir"

#: lazarusidestrconsts.uemtogglebookmarknset
msgid "Toggle Bookmark &%s: %s"
msgstr ""

#: lazarusidestrconsts.uemtogglebookmarknunset
msgid "Toggle Bookmark &%s"
msgstr ""

#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr ""

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "Toggle &Breakpoint"

#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Çağrı Yığını Göster"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Henüz uygulanmadı"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Salt Okunur"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Versiyon bilgisi"