1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 3090 3091 3092 3093 3094 3095 3096 3097 3098 3099 3100 3101 3102 3103 3104 3105 3106 3107 3108 3109 3110 3111 3112 3113 3114 3115 3116 3117 3118 3119 3120 3121 3122 3123 3124 3125 3126 3127 3128 3129 3130 3131 3132 3133 3134 3135 3136 3137 3138 3139 3140 3141 3142 3143 3144 3145 3146 3147 3148 3149 3150 3151 3152 3153 3154 3155 3156 3157 3158 3159 3160 3161 3162 3163 3164 3165 3166 3167 3168 3169 3170 3171 3172 3173 3174 3175 3176 3177 3178 3179 3180 3181 3182 3183 3184 3185 3186 3187 3188 3189 3190 3191 3192 3193 3194 3195 3196 3197 3198 3199 3200 3201 3202 3203 3204 3205 3206 3207 3208 3209 3210 3211 3212 3213 3214 3215 3216 3217 3218 3219 3220 3221 3222 3223 3224 3225 3226 3227 3228 3229 3230 3231 3232 3233 3234 3235 3236 3237 3238 3239 3240 3241 3242 3243 3244 3245 3246 3247 3248 3249 3250 3251 3252 3253 3254 3255 3256 3257 3258 3259 3260 3261 3262 3263 3264 3265 3266 3267 3268 3269 3270 3271 3272 3273 3274 3275 3276 3277 3278 3279 3280 3281 3282 3283 3284 3285 3286 3287 3288 3289 3290 3291 3292 3293 3294 3295 3296 3297 3298 3299 3300 3301 3302 3303 3304 3305 3306 3307 3308 3309 3310 3311 3312 3313 3314 3315 3316 3317 3318 3319 3320 3321 3322 3323 3324 3325 3326 3327 3328 3329 3330 3331 3332 3333 3334 3335 3336 3337 3338 3339 3340 3341 3342 3343 3344 3345 3346 3347 3348 3349 3350 3351 3352 3353 3354 3355 3356 3357 3358 3359 3360 3361 3362 3363 3364 3365 3366 3367 3368 3369 3370 3371 3372 3373 3374 3375 3376 3377 3378 3379 3380 3381 3382 3383 3384 3385 3386 3387 3388 3389 3390 3391 3392 3393 3394 3395 3396 3397 3398 3399 3400 3401 3402 3403 3404 3405 3406 3407 3408 3409 3410 3411 3412 3413 3414 3415 3416 3417 3418 3419 3420 3421 3422 3423 3424 3425 3426 3427 3428 3429 3430 3431 3432 3433 3434 3435 3436 3437 3438 3439 3440 3441 3442 3443 3444 3445 3446 3447 3448 3449 3450 3451 3452 3453 3454 3455 3456 3457 3458 3459 3460 3461 3462 3463 3464 3465 3466 3467 3468 3469 3470 3471 3472 3473 3474 3475 3476 3477 3478 3479 3480 3481 3482 3483 3484 3485 3486 3487 3488 3489 3490 3491 3492 3493 3494 3495 3496 3497 3498 3499 3500 3501 3502 3503 3504 3505 3506 3507 3508 3509 3510 3511 3512 3513 3514 3515 3516 3517 3518 3519 3520 3521 3522 3523 3524 3525 3526 3527 3528 3529 3530 3531 3532 3533 3534 3535 3536 3537 3538 3539 3540 3541 3542 3543 3544 3545 3546 3547 3548 3549 3550 3551 3552 3553 3554 3555 3556 3557 3558 3559 3560 3561 3562 3563 3564 3565 3566 3567 3568 3569 3570 3571 3572 3573 3574 3575 3576 3577 3578 3579 3580 3581 3582 3583 3584 3585 3586 3587 3588 3589 3590 3591 3592 3593 3594 3595 3596 3597 3598 3599 3600 3601 3602 3603 3604 3605 3606 3607 3608 3609 3610 3611 3612 3613 3614 3615 3616 3617 3618 3619 3620 3621 3622 3623 3624 3625 3626 3627 3628 3629 3630 3631 3632 3633 3634 3635 3636 3637 3638 3639 3640 3641 3642 3643 3644 3645 3646 3647 3648 3649 3650 3651 3652 3653 3654 3655 3656 3657 3658 3659 3660 3661 3662 3663 3664 3665 3666 3667 3668 3669 3670 3671 3672 3673 3674 3675 3676 3677 3678 3679 3680 3681 3682 3683 3684 3685 3686 3687 3688 3689 3690 3691 3692 3693 3694 3695 3696 3697 3698 3699 3700 3701 3702 3703 3704 3705 3706 3707 3708 3709 3710 3711 3712 3713 3714 3715 3716 3717 3718 3719 3720 3721 3722 3723 3724 3725 3726 3727 3728 3729 3730 3731 3732 3733 3734 3735 3736 3737 3738 3739 3740 3741 3742 3743 3744 3745 3746 3747 3748 3749 3750 3751 3752 3753 3754 3755 3756 3757 3758 3759 3760 3761 3762 3763 3764 3765 3766 3767 3768 3769 3770 3771 3772 3773 3774 3775 3776 3777 3778 3779 3780 3781 3782 3783 3784 3785 3786 3787 3788 3789 3790 3791 3792 3793 3794 3795 3796 3797 3798 3799 3800 3801 3802 3803 3804 3805 3806 3807 3808 3809 3810 3811 3812 3813 3814 3815 3816 3817 3818 3819 3820 3821 3822 3823 3824 3825 3826 3827 3828 3829 3830 3831 3832 3833 3834 3835 3836 3837 3838 3839 3840 3841 3842 3843 3844 3845 3846 3847 3848 3849 3850 3851 3852 3853 3854 3855 3856 3857 3858 3859 3860 3861 3862 3863 3864 3865 3866 3867 3868 3869 3870 3871 3872 3873 3874 3875 3876 3877 3878 3879 3880 3881 3882 3883 3884 3885 3886 3887 3888 3889 3890 3891 3892 3893 3894 3895 3896 3897 3898 3899 3900 3901 3902 3903 3904 3905 3906 3907 3908 3909 3910 3911 3912 3913 3914 3915 3916 3917 3918 3919 3920 3921 3922 3923 3924 3925 3926 3927 3928 3929 3930 3931 3932 3933 3934 3935 3936 3937 3938 3939 3940 3941 3942 3943 3944 3945 3946 3947 3948 3949 3950 3951 3952 3953 3954 3955 3956 3957 3958 3959 3960 3961 3962 3963 3964 3965 3966 3967 3968 3969 3970 3971 3972 3973 3974 3975 3976 3977 3978 3979 3980 3981 3982 3983 3984 3985 3986 3987 3988 3989 3990 3991 3992 3993 3994 3995 3996 3997 3998 3999 4000 4001 4002 4003 4004 4005 4006 4007 4008 4009 4010 4011 4012 4013 4014 4015 4016 4017 4018 4019 4020 4021 4022 4023 4024 4025 4026 4027 4028 4029 4030 4031 4032 4033 4034 4035 4036 4037 4038 4039 4040 4041 4042 4043 4044 4045 4046 4047 4048 4049 4050 4051 4052 4053 4054 4055 4056 4057 4058 4059 4060 4061 4062 4063 4064 4065 4066 4067 4068 4069 4070 4071 4072 4073 4074 4075 4076 4077 4078 4079 4080 4081 4082 4083 4084 4085 4086 4087 4088 4089 4090 4091 4092 4093 4094 4095 4096 4097 4098 4099 4100 4101 4102 4103 4104 4105 4106 4107 4108 4109 4110 4111 4112 4113 4114 4115 4116 4117 4118 4119 4120 4121 4122 4123 4124 4125 4126 4127 4128 4129 4130 4131 4132 4133 4134 4135 4136 4137 4138 4139 4140 4141 4142 4143 4144 4145 4146 4147 4148 4149 4150 4151 4152 4153 4154 4155 4156 4157 4158 4159 4160 4161 4162 4163 4164 4165 4166 4167 4168 4169 4170 4171 4172 4173 4174 4175 4176 4177 4178 4179 4180 4181 4182 4183 4184 4185 4186 4187 4188 4189 4190 4191 4192 4193 4194 4195 4196 4197 4198 4199 4200 4201 4202 4203 4204 4205 4206 4207 4208 4209 4210 4211 4212 4213 4214 4215 4216 4217 4218 4219 4220 4221 4222 4223 4224 4225 4226 4227 4228 4229 4230 4231 4232 4233 4234 4235 4236 4237 4238 4239 4240 4241 4242 4243 4244 4245 4246 4247 4248 4249 4250 4251 4252 4253 4254 4255 4256 4257 4258 4259 4260 4261 4262 4263 4264 4265 4266 4267 4268 4269 4270 4271 4272 4273 4274 4275 4276 4277 4278 4279 4280 4281 4282 4283 4284 4285 4286 4287 4288 4289 4290 4291 4292 4293 4294 4295 4296 4297 4298 4299 4300 4301 4302 4303 4304 4305 4306 4307 4308 4309 4310 4311 4312 4313 4314 4315 4316 4317 4318 4319 4320 4321 4322 4323 4324 4325 4326 4327 4328 4329 4330 4331 4332 4333 4334 4335 4336 4337 4338 4339 4340 4341 4342 4343 4344 4345 4346 4347 4348 4349 4350 4351 4352 4353 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4368 4369 4370 4371 4372 4373 4374 4375 4376 4377 4378 4379 4380 4381 4382 4383 4384 4385 4386 4387 4388 4389 4390 4391 4392 4393 4394 4395 4396 4397 4398 4399 4400 4401 4402 4403 4404 4405 4406 4407 4408 4409 4410 4411 4412 4413 4414 4415 4416 4417 4418 4419 4420 4421 4422 4423 4424 4425 4426 4427 4428 4429 4430 4431 4432 4433 4434 4435 4436 4437 4438 4439 4440 4441 4442 4443 4444 4445 4446 4447 4448 4449 4450 4451 4452 4453 4454 4455 4456 4457 4458 4459 4460 4461 4462 4463 4464 4465 4466 4467 4468 4469 4470 4471 4472 4473 4474 4475 4476 4477 4478 4479 4480 4481 4482 4483 4484 4485 4486 4487 4488 4489 4490 4491 4492 4493 4494 4495 4496 4497 4498 4499 4500 4501 4502 4503 4504 4505 4506 4507 4508 4509 4510 4511 4512 4513 4514 4515 4516 4517 4518 4519 4520 4521 4522 4523 4524 4525 4526 4527 4528 4529 4530 4531 4532 4533 4534 4535 4536 4537 4538 4539 4540 4541 4542 4543 4544 4545 4546 4547 4548 4549 4550 4551 4552 4553 4554 4555 4556 4557 4558 4559 4560 4561 4562 4563 4564 4565 4566 4567 4568 4569 4570 4571 4572 4573 4574 4575 4576 4577 4578 4579 4580 4581 4582 4583 4584 4585 4586 4587 4588 4589 4590 4591 4592 4593 4594 4595 4596 4597 4598 4599 4600 4601 4602 4603 4604 4605 4606 4607 4608 4609 4610 4611 4612 4613 4614 4615 4616 4617 4618 4619 4620 4621 4622 4623 4624 4625 4626 4627 4628 4629 4630 4631 4632 4633 4634 4635 4636 4637 4638 4639 4640 4641 4642 4643 4644 4645 4646 4647 4648 4649 4650 4651 4652 4653 4654 4655 4656 4657 4658 4659 4660 4661 4662 4663 4664 4665 4666 4667 4668 4669 4670 4671 4672 4673 4674 4675 4676 4677 4678 4679 4680 4681 4682 4683 4684 4685 4686 4687 4688 4689 4690 4691 4692 4693 4694 4695 4696 4697 4698 4699 4700 4701 4702 4703 4704 4705 4706 4707 4708 4709 4710 4711 4712 4713 4714 4715 4716 4717 4718 4719 4720 4721 4722 4723 4724 4725 4726 4727 4728 4729 4730 4731 4732 4733 4734 4735 4736 4737 4738 4739 4740 4741 4742 4743 4744 4745 4746 4747 4748 4749 4750 4751 4752 4753 4754 4755 4756 4757 4758 4759 4760 4761 4762 4763 4764 4765 4766 4767 4768 4769 4770 4771 4772 4773 4774 4775 4776 4777 4778 4779 4780 4781 4782 4783 4784 4785 4786 4787 4788 4789 4790 4791 4792 4793 4794 4795 4796 4797 4798 4799 4800 4801 4802 4803 4804 4805 4806 4807 4808 4809 4810 4811 4812 4813 4814 4815 4816 4817 4818 4819 4820 4821 4822 4823 4824 4825 4826 4827 4828 4829 4830 4831 4832 4833 4834 4835 4836 4837 4838 4839 4840 4841 4842 4843 4844 4845 4846 4847 4848 4849 4850 4851 4852 4853 4854 4855 4856 4857 4858 4859 4860 4861 4862 4863 4864 4865 4866 4867 4868 4869 4870 4871 4872 4873 4874 4875 4876 4877 4878 4879 4880 4881 4882 4883 4884 4885 4886 4887 4888 4889 4890 4891 4892 4893 4894 4895 4896 4897 4898 4899 4900 4901 4902 4903 4904 4905 4906 4907 4908 4909 4910 4911 4912 4913 4914 4915 4916 4917 4918 4919 4920 4921 4922 4923 4924 4925 4926 4927 4928 4929 4930 4931 4932 4933 4934 4935 4936 4937 4938 4939 4940 4941 4942 4943 4944 4945 4946 4947 4948 4949 4950 4951 4952 4953 4954 4955 4956 4957 4958 4959 4960 4961 4962 4963 4964 4965 4966 4967 4968 4969 4970 4971 4972 4973 4974 4975 4976 4977 4978 4979 4980 4981 4982 4983 4984 4985 4986 4987 4988 4989 4990 4991 4992 4993 4994 4995 4996 4997 4998 4999 5000 5001 5002 5003 5004 5005 5006 5007 5008 5009 5010 5011 5012 5013 5014 5015 5016 5017 5018 5019 5020 5021 5022 5023 5024 5025 5026 5027 5028 5029 5030 5031 5032 5033 5034 5035 5036 5037 5038 5039 5040 5041 5042 5043 5044 5045 5046 5047 5048 5049 5050 5051 5052 5053 5054 5055 5056 5057 5058 5059 5060 5061 5062 5063 5064 5065 5066 5067 5068 5069 5070 5071 5072 5073 5074 5075 5076 5077 5078 5079 5080 5081 5082 5083 5084 5085 5086 5087 5088 5089 5090 5091 5092 5093 5094 5095 5096 5097 5098 5099 5100 5101 5102 5103 5104 5105 5106 5107 5108 5109 5110 5111 5112 5113 5114 5115 5116 5117 5118 5119 5120 5121 5122 5123 5124 5125 5126 5127 5128 5129 5130 5131 5132 5133 5134 5135 5136 5137 5138 5139 5140 5141 5142 5143 5144 5145 5146 5147 5148 5149 5150 5151 5152 5153 5154 5155 5156 5157 5158 5159 5160 5161 5162 5163 5164 5165 5166 5167 5168 5169 5170 5171 5172 5173 5174 5175 5176 5177 5178 5179 5180 5181 5182 5183 5184 5185 5186 5187 5188 5189 5190 5191 5192 5193 5194 5195 5196 5197 5198 5199 5200 5201 5202 5203 5204 5205 5206 5207 5208 5209 5210 5211 5212 5213 5214 5215 5216 5217 5218 5219 5220 5221 5222 5223 5224 5225 5226 5227 5228 5229 5230 5231 5232 5233 5234 5235 5236 5237 5238 5239 5240 5241 5242 5243 5244 5245 5246 5247 5248 5249 5250 5251 5252 5253 5254 5255 5256 5257 5258 5259 5260 5261 5262 5263 5264 5265 5266 5267 5268 5269 5270 5271 5272 5273 5274 5275 5276 5277 5278 5279 5280 5281 5282 5283 5284 5285 5286 5287 5288 5289 5290 5291 5292 5293 5294 5295 5296 5297 5298 5299 5300 5301 5302 5303 5304 5305 5306 5307 5308 5309 5310 5311 5312 5313 5314 5315 5316 5317 5318 5319 5320 5321 5322 5323 5324 5325 5326 5327 5328 5329 5330 5331 5332 5333 5334 5335 5336 5337 5338 5339 5340 5341 5342 5343 5344 5345 5346 5347 5348 5349 5350 5351 5352 5353 5354 5355 5356 5357 5358 5359 5360 5361 5362 5363 5364 5365 5366 5367 5368 5369 5370 5371 5372 5373 5374 5375 5376 5377 5378 5379 5380 5381 5382 5383 5384 5385 5386 5387 5388 5389 5390 5391 5392 5393 5394 5395 5396 5397 5398 5399 5400 5401 5402 5403 5404 5405 5406 5407 5408 5409 5410 5411 5412 5413 5414 5415 5416 5417 5418 5419 5420 5421 5422 5423 5424 5425 5426 5427 5428 5429 5430 5431 5432 5433 5434 5435 5436 5437 5438 5439 5440 5441 5442 5443 5444 5445 5446 5447 5448 5449 5450 5451 5452 5453 5454 5455 5456 5457 5458 5459 5460 5461 5462 5463 5464 5465 5466 5467 5468 5469 5470 5471 5472 5473 5474 5475 5476 5477 5478 5479 5480 5481 5482 5483 5484 5485 5486 5487 5488 5489 5490 5491 5492 5493 5494 5495 5496 5497 5498 5499 5500 5501 5502 5503 5504 5505 5506 5507 5508 5509 5510 5511 5512 5513 5514 5515 5516 5517 5518 5519 5520 5521 5522 5523 5524 5525 5526 5527 5528 5529 5530 5531 5532 5533 5534 5535 5536 5537 5538 5539 5540 5541 5542 5543 5544 5545 5546 5547 5548 5549 5550 5551 5552 5553 5554 5555 5556 5557 5558 5559 5560 5561 5562 5563 5564 5565 5566 5567 5568 5569 5570 5571 5572 5573 5574 5575 5576 5577 5578 5579 5580 5581 5582 5583 5584 5585 5586 5587 5588 5589 5590 5591 5592 5593 5594 5595 5596 5597 5598 5599 5600 5601 5602 5603 5604 5605 5606 5607 5608 5609 5610 5611 5612 5613 5614 5615 5616 5617 5618 5619 5620 5621 5622 5623 5624 5625 5626 5627 5628 5629 5630 5631 5632 5633 5634 5635 5636 5637 5638 5639 5640 5641 5642 5643 5644 5645 5646 5647 5648 5649 5650 5651 5652 5653 5654 5655 5656 5657 5658 5659 5660 5661 5662 5663 5664 5665 5666 5667 5668 5669 5670 5671 5672 5673 5674 5675 5676 5677 5678 5679 5680 5681 5682 5683 5684 5685 5686 5687 5688 5689 5690 5691 5692 5693 5694 5695 5696 5697 5698 5699 5700 5701 5702 5703 5704 5705 5706 5707 5708 5709 5710 5711 5712 5713 5714 5715 5716 5717 5718 5719 5720 5721 5722 5723 5724 5725 5726 5727 5728 5729 5730 5731 5732 5733 5734 5735 5736 5737 5738 5739 5740 5741 5742 5743 5744 5745 5746 5747 5748 5749 5750 5751 5752 5753 5754 5755 5756 5757 5758 5759 5760 5761 5762 5763 5764 5765 5766 5767 5768 5769 5770 5771 5772 5773 5774 5775 5776 5777 5778 5779 5780 5781 5782 5783 5784 5785 5786 5787 5788 5789 5790 5791 5792 5793 5794 5795 5796 5797 5798 5799 5800 5801 5802 5803 5804 5805 5806 5807 5808 5809 5810 5811 5812 5813 5814 5815 5816 5817 5818 5819 5820 5821 5822 5823 5824 5825 5826 5827 5828 5829 5830 5831 5832 5833 5834 5835 5836 5837 5838 5839 5840 5841 5842 5843 5844 5845 5846 5847 5848 5849 5850 5851 5852 5853 5854 5855 5856 5857 5858 5859 5860 5861 5862 5863 5864 5865 5866 5867 5868 5869 5870 5871 5872 5873 5874 5875 5876 5877 5878 5879 5880 5881 5882 5883 5884 5885 5886 5887 5888 5889 5890 5891 5892 5893 5894 5895 5896 5897 5898 5899 5900 5901 5902 5903 5904 5905 5906 5907 5908 5909 5910 5911 5912 5913 5914 5915 5916 5917 5918 5919 5920 5921 5922 5923 5924 5925 5926 5927 5928 5929 5930 5931 5932 5933 5934 5935 5936 5937 5938 5939 5940 5941 5942 5943 5944 5945 5946 5947 5948 5949 5950 5951 5952 5953 5954 5955 5956 5957 5958 5959 5960 5961 5962 5963 5964 5965 5966 5967 5968 5969 5970 5971 5972 5973 5974 5975 5976 5977 5978 5979 5980 5981 5982 5983 5984 5985 5986 5987 5988 5989 5990 5991 5992 5993 5994 5995 5996 5997 5998 5999 6000 6001 6002 6003 6004 6005 6006 6007 6008 6009 6010 6011 6012 6013 6014 6015 6016 6017 6018 6019 6020 6021 6022 6023 6024 6025 6026 6027 6028 6029 6030 6031 6032 6033 6034 6035 6036 6037 6038 6039 6040 6041 6042 6043 6044 6045 6046 6047 6048 6049 6050 6051 6052 6053 6054 6055 6056 6057 6058 6059 6060 6061 6062 6063 6064 6065 6066 6067 6068 6069 6070 6071 6072 6073 6074 6075 6076 6077 6078 6079 6080 6081 6082 6083 6084 6085 6086 6087 6088 6089 6090 6091 6092 6093 6094 6095 6096 6097 6098 6099 6100 6101 6102 6103 6104 6105 6106 6107 6108 6109 6110 6111 6112 6113 6114 6115 6116 6117 6118 6119 6120 6121 6122 6123 6124 6125 6126 6127 6128 6129 6130 6131 6132 6133 6134 6135 6136 6137 6138 6139 6140 6141 6142 6143 6144 6145 6146 6147 6148 6149 6150 6151 6152 6153 6154 6155 6156 6157 6158 6159 6160 6161 6162 6163 6164 6165 6166 6167 6168 6169 6170 6171 6172 6173 6174 6175 6176 6177 6178 6179 6180 6181 6182 6183 6184 6185 6186 6187 6188 6189 6190 6191 6192 6193 6194 6195 6196 6197 6198 6199 6200 6201 6202 6203 6204 6205 6206 6207 6208 6209 6210 6211 6212 6213 6214 6215 6216 6217 6218 6219 6220 6221 6222 6223 6224 6225 6226 6227 6228 6229 6230 6231 6232 6233 6234 6235 6236 6237 6238 6239 6240 6241 6242 6243 6244 6245 6246 6247 6248 6249 6250 6251 6252 6253 6254 6255 6256 6257 6258 6259 6260 6261 6262 6263 6264 6265 6266 6267 6268 6269 6270 6271 6272 6273 6274 6275 6276 6277 6278 6279 6280 6281 6282 6283 6284 6285 6286 6287 6288 6289 6290 6291 6292 6293 6294 6295 6296 6297 6298 6299 6300 6301 6302 6303 6304 6305 6306 6307 6308 6309 6310 6311 6312 6313 6314 6315 6316 6317 6318 6319 6320 6321 6322 6323 6324 6325 6326 6327 6328 6329 6330 6331 6332 6333 6334 6335 6336 6337 6338 6339 6340 6341 6342 6343 6344 6345 6346 6347 6348 6349 6350 6351 6352 6353 6354 6355 6356 6357 6358 6359 6360 6361 6362 6363 6364 6365 6366 6367 6368 6369 6370 6371 6372 6373 6374 6375 6376 6377 6378 6379 6380 6381 6382 6383 6384 6385 6386 6387 6388 6389 6390 6391 6392 6393 6394 6395 6396 6397 6398 6399 6400 6401 6402 6403 6404 6405 6406 6407 6408 6409 6410 6411 6412 6413 6414 6415 6416 6417 6418 6419 6420 6421 6422 6423 6424 6425 6426 6427 6428 6429 6430 6431 6432 6433 6434 6435 6436 6437 6438 6439 6440 6441 6442 6443 6444 6445 6446 6447 6448 6449 6450 6451 6452 6453 6454 6455 6456 6457 6458 6459 6460 6461 6462 6463 6464 6465 6466 6467 6468 6469 6470 6471 6472 6473 6474 6475 6476 6477 6478 6479 6480 6481 6482 6483 6484 6485 6486 6487 6488 6489 6490 6491 6492 6493 6494 6495 6496 6497 6498 6499 6500 6501 6502 6503 6504 6505 6506 6507 6508 6509 6510 6511 6512 6513 6514 6515 6516 6517 6518 6519 6520 6521 6522 6523 6524 6525 6526 6527 6528 6529 6530 6531 6532 6533 6534 6535 6536 6537 6538 6539 6540 6541 6542 6543 6544 6545 6546 6547 6548 6549 6550 6551 6552 6553 6554 6555 6556 6557 6558 6559 6560 6561 6562 6563 6564 6565 6566 6567 6568 6569 6570 6571 6572 6573 6574 6575 6576 6577 6578 6579 6580 6581 6582 6583 6584 6585 6586 6587 6588 6589 6590 6591 6592 6593 6594 6595 6596 6597 6598 6599 6600 6601 6602 6603 6604 6605 6606 6607 6608 6609 6610 6611 6612 6613 6614 6615 6616 6617 6618 6619 6620 6621 6622 6623 6624 6625 6626 6627 6628 6629 6630 6631 6632 6633 6634 6635 6636 6637 6638 6639 6640 6641 6642 6643 6644 6645 6646 6647 6648 6649 6650 6651 6652 6653 6654 6655 6656 6657 6658 6659 6660 6661 6662 6663 6664 6665 6666 6667 6668 6669 6670 6671 6672 6673 6674 6675 6676 6677 6678 6679 6680 6681 6682 6683 6684 6685 6686 6687 6688 6689 6690 6691 6692 6693 6694 6695 6696 6697 6698 6699 6700 6701 6702 6703 6704 6705 6706 6707 6708 6709 6710 6711 6712 6713 6714 6715 6716 6717 6718 6719 6720 6721 6722 6723 6724 6725 6726 6727 6728 6729 6730 6731 6732 6733 6734 6735 6736 6737 6738 6739 6740 6741 6742 6743 6744 6745 6746 6747 6748 6749 6750 6751 6752 6753 6754 6755 6756 6757 6758 6759 6760 6761 6762 6763 6764 6765 6766 6767 6768 6769 6770 6771 6772 6773 6774 6775 6776 6777 6778 6779 6780 6781 6782 6783 6784 6785 6786 6787 6788 6789 6790 6791 6792 6793 6794 6795 6796 6797 6798 6799 6800 6801 6802 6803 6804 6805 6806 6807 6808 6809 6810 6811 6812 6813 6814 6815 6816 6817 6818 6819 6820 6821 6822 6823 6824 6825 6826 6827 6828 6829 6830 6831 6832 6833 6834 6835 6836 6837 6838 6839 6840 6841 6842 6843 6844 6845 6846 6847 6848 6849 6850 6851 6852 6853 6854 6855 6856 6857 6858 6859 6860 6861 6862 6863 6864 6865 6866 6867 6868 6869 6870 6871 6872 6873 6874 6875 6876 6877 6878 6879 6880 6881 6882 6883 6884 6885 6886 6887 6888 6889 6890 6891 6892 6893 6894 6895 6896 6897 6898 6899 6900 6901 6902 6903 6904 6905 6906 6907 6908 6909 6910 6911 6912 6913 6914 6915 6916 6917 6918 6919 6920 6921 6922 6923 6924 6925 6926 6927 6928 6929 6930 6931 6932 6933 6934 6935 6936 6937 6938 6939 6940 6941 6942 6943 6944 6945 6946 6947 6948 6949 6950 6951 6952 6953 6954 6955 6956 6957 6958 6959 6960 6961 6962 6963 6964 6965 6966 6967 6968 6969 6970 6971 6972 6973 6974 6975 6976 6977 6978 6979 6980 6981 6982 6983 6984 6985 6986 6987 6988 6989 6990 6991 6992 6993 6994 6995 6996 6997 6998 6999 7000 7001 7002 7003 7004 7005 7006 7007 7008 7009 7010 7011 7012 7013 7014 7015 7016 7017 7018 7019 7020 7021 7022 7023 7024 7025 7026 7027 7028 7029 7030 7031 7032 7033 7034 7035 7036 7037 7038 7039 7040 7041 7042 7043 7044 7045 7046 7047 7048 7049 7050 7051 7052 7053 7054 7055 7056 7057 7058 7059 7060 7061 7062 7063 7064 7065 7066 7067 7068 7069 7070 7071 7072 7073 7074 7075 7076 7077 7078 7079 7080 7081 7082 7083 7084 7085 7086 7087 7088 7089 7090 7091 7092 7093 7094 7095 7096 7097 7098 7099 7100 7101 7102 7103 7104 7105 7106 7107 7108 7109 7110 7111 7112 7113 7114 7115 7116 7117 7118 7119 7120 7121 7122 7123 7124 7125 7126 7127 7128 7129 7130 7131 7132 7133 7134 7135 7136 7137 7138 7139 7140 7141 7142 7143 7144 7145 7146 7147 7148 7149 7150 7151 7152 7153 7154 7155 7156 7157 7158 7159 7160 7161 7162 7163 7164 7165 7166 7167 7168 7169 7170 7171 7172 7173 7174 7175 7176 7177 7178 7179 7180 7181 7182 7183 7184 7185 7186 7187 7188 7189 7190 7191 7192 7193 7194 7195 7196 7197 7198 7199 7200 7201 7202 7203 7204 7205 7206 7207 7208 7209 7210 7211 7212 7213 7214 7215 7216 7217 7218 7219 7220 7221 7222 7223 7224 7225 7226 7227 7228 7229 7230 7231 7232 7233 7234 7235 7236 7237 7238 7239 7240 7241 7242 7243 7244 7245 7246 7247 7248 7249 7250 7251 7252 7253 7254 7255 7256 7257 7258 7259 7260 7261 7262 7263 7264 7265 7266 7267 7268 7269 7270 7271 7272 7273 7274 7275 7276 7277 7278 7279 7280 7281 7282 7283 7284 7285 7286 7287 7288 7289 7290 7291 7292 7293 7294 7295 7296 7297 7298 7299 7300 7301 7302 7303 7304 7305 7306 7307 7308 7309 7310 7311 7312 7313 7314 7315 7316 7317 7318 7319 7320 7321 7322 7323 7324 7325 7326 7327 7328 7329 7330 7331 7332 7333 7334 7335 7336 7337 7338 7339 7340 7341 7342 7343 7344 7345 7346 7347 7348 7349 7350 7351 7352 7353 7354 7355 7356 7357 7358 7359 7360 7361 7362 7363 7364 7365 7366 7367 7368 7369 7370 7371 7372 7373 7374 7375 7376 7377 7378 7379 7380 7381 7382 7383 7384 7385 7386 7387 7388 7389 7390 7391 7392 7393 7394 7395 7396 7397 7398 7399 7400 7401 7402 7403 7404 7405 7406 7407 7408 7409 7410 7411 7412 7413 7414 7415 7416 7417 7418 7419 7420 7421 7422 7423 7424 7425 7426 7427 7428 7429 7430 7431 7432 7433 7434 7435 7436 7437 7438 7439 7440 7441 7442 7443 7444 7445 7446 7447 7448 7449 7450 7451 7452 7453 7454 7455 7456 7457 7458 7459 7460 7461 7462 7463 7464 7465 7466 7467 7468 7469 7470 7471 7472 7473 7474 7475 7476 7477 7478 7479 7480 7481 7482 7483 7484 7485 7486 7487 7488 7489 7490 7491 7492 7493 7494 7495 7496 7497 7498 7499 7500 7501 7502 7503 7504 7505 7506 7507 7508 7509 7510 7511 7512 7513 7514 7515 7516 7517 7518 7519 7520 7521 7522 7523 7524 7525 7526 7527 7528 7529 7530 7531 7532 7533 7534 7535 7536 7537 7538 7539 7540 7541 7542 7543 7544 7545 7546 7547 7548 7549 7550 7551 7552 7553 7554 7555 7556 7557 7558 7559 7560 7561 7562 7563 7564 7565 7566 7567 7568 7569 7570 7571 7572 7573 7574 7575 7576 7577 7578 7579 7580 7581 7582 7583 7584 7585 7586 7587 7588 7589 7590 7591 7592 7593 7594 7595 7596 7597 7598 7599 7600 7601 7602 7603 7604 7605 7606 7607 7608 7609 7610 7611 7612 7613 7614 7615 7616 7617 7618 7619 7620 7621 7622 7623 7624 7625 7626 7627 7628 7629 7630 7631 7632 7633 7634 7635 7636 7637 7638 7639 7640 7641 7642 7643 7644 7645 7646 7647 7648 7649 7650 7651 7652 7653 7654 7655 7656 7657 7658 7659 7660 7661 7662 7663 7664 7665 7666 7667 7668 7669 7670 7671 7672 7673 7674 7675 7676 7677 7678 7679 7680 7681 7682 7683 7684 7685 7686 7687 7688 7689 7690 7691 7692 7693 7694 7695 7696 7697 7698 7699 7700 7701 7702 7703 7704 7705 7706 7707 7708 7709 7710 7711 7712 7713 7714 7715 7716 7717 7718 7719 7720 7721 7722 7723 7724 7725 7726 7727 7728 7729 7730 7731 7732 7733 7734 7735 7736 7737 7738 7739 7740 7741 7742 7743 7744 7745 7746 7747 7748 7749 7750 7751 7752 7753 7754 7755 7756 7757 7758 7759 7760 7761 7762 7763 7764 7765 7766 7767 7768 7769 7770 7771 7772 7773 7774 7775 7776 7777 7778 7779 7780 7781 7782 7783 7784 7785 7786 7787 7788 7789 7790 7791 7792 7793 7794 7795 7796 7797 7798 7799 7800 7801 7802 7803 7804 7805 7806 7807 7808 7809 7810 7811 7812 7813 7814 7815 7816 7817 7818 7819 7820 7821 7822 7823 7824 7825 7826 7827 7828 7829 7830 7831 7832 7833 7834 7835 7836 7837 7838 7839 7840 7841 7842 7843 7844 7845 7846 7847 7848 7849 7850 7851 7852 7853 7854 7855 7856 7857 7858 7859 7860 7861 7862 7863 7864 7865 7866 7867 7868 7869 7870 7871 7872 7873 7874 7875 7876 7877 7878 7879 7880 7881 7882 7883 7884 7885 7886 7887 7888 7889 7890 7891 7892 7893 7894 7895 7896 7897 7898 7899 7900 7901 7902 7903 7904 7905 7906 7907 7908 7909 7910 7911 7912 7913 7914 7915 7916 7917 7918 7919 7920 7921 7922 7923 7924 7925 7926 7927 7928 7929 7930 7931 7932 7933 7934 7935 7936 7937 7938 7939 7940 7941 7942 7943 7944 7945 7946 7947 7948 7949 7950 7951 7952 7953 7954 7955 7956 7957 7958 7959 7960 7961 7962 7963 7964 7965 7966 7967 7968 7969 7970 7971 7972 7973 7974 7975 7976 7977 7978 7979 7980 7981 7982 7983 7984 7985 7986 7987 7988 7989 7990 7991 7992 7993 7994 7995 7996 7997 7998 7999 8000 8001 8002 8003 8004 8005 8006 8007 8008 8009 8010 8011 8012 8013 8014 8015 8016 8017 8018 8019 8020 8021 8022 8023 8024 8025 8026 8027 8028 8029 8030 8031 8032 8033 8034 8035 8036 8037 8038 8039 8040 8041 8042 8043 8044 8045 8046 8047 8048 8049 8050 8051 8052 8053 8054 8055 8056 8057 8058 8059 8060 8061 8062 8063 8064 8065 8066 8067 8068 8069 8070 8071 8072 8073 8074 8075 8076 8077 8078 8079 8080 8081 8082 8083 8084 8085 8086 8087 8088 8089 8090 8091 8092 8093 8094 8095 8096 8097 8098 8099 8100 8101 8102 8103 8104 8105 8106 8107 8108 8109 8110 8111 8112 8113 8114 8115 8116 8117 8118 8119 8120 8121 8122 8123 8124 8125 8126 8127 8128 8129 8130 8131 8132 8133 8134 8135 8136 8137 8138 8139 8140 8141 8142 8143 8144 8145 8146 8147 8148 8149 8150 8151 8152 8153 8154 8155 8156 8157 8158 8159 8160 8161 8162 8163 8164 8165 8166 8167 8168 8169 8170 8171 8172 8173 8174 8175 8176 8177 8178 8179 8180 8181 8182 8183 8184 8185 8186 8187 8188 8189 8190 8191 8192 8193 8194 8195 8196 8197 8198 8199 8200 8201 8202 8203 8204 8205 8206 8207 8208 8209 8210 8211 8212 8213 8214 8215 8216 8217 8218 8219 8220 8221 8222 8223 8224 8225 8226 8227 8228 8229 8230 8231 8232 8233 8234 8235 8236 8237 8238 8239 8240 8241 8242 8243 8244 8245 8246 8247 8248 8249 8250 8251 8252 8253 8254 8255 8256 8257 8258 8259 8260 8261 8262 8263 8264 8265 8266 8267 8268 8269 8270 8271 8272 8273 8274 8275 8276 8277 8278 8279 8280 8281 8282 8283 8284 8285 8286 8287 8288 8289 8290 8291 8292 8293 8294 8295 8296 8297 8298 8299 8300 8301 8302 8303 8304 8305 8306 8307 8308 8309 8310 8311 8312 8313 8314 8315 8316 8317 8318 8319 8320 8321 8322 8323 8324 8325 8326 8327 8328 8329 8330 8331 8332 8333 8334 8335 8336 8337 8338 8339 8340 8341 8342 8343 8344 8345 8346 8347 8348 8349 8350 8351 8352 8353 8354 8355 8356 8357 8358 8359 8360 8361 8362 8363 8364 8365 8366 8367 8368 8369 8370 8371 8372 8373 8374 8375 8376 8377 8378 8379 8380 8381 8382 8383 8384 8385 8386 8387 8388 8389 8390 8391 8392 8393 8394 8395 8396 8397 8398 8399 8400 8401 8402 8403 8404 8405 8406 8407 8408 8409 8410 8411 8412 8413 8414 8415 8416 8417 8418 8419 8420 8421 8422 8423 8424 8425 8426 8427 8428 8429 8430 8431 8432 8433 8434 8435 8436 8437 8438 8439 8440 8441 8442 8443 8444 8445 8446 8447 8448 8449 8450 8451 8452 8453 8454 8455 8456 8457 8458 8459 8460 8461 8462 8463 8464 8465 8466 8467 8468 8469 8470 8471 8472 8473 8474 8475 8476 8477 8478 8479 8480 8481 8482 8483 8484 8485 8486 8487 8488 8489 8490 8491 8492 8493 8494 8495 8496 8497 8498 8499 8500 8501 8502 8503 8504 8505 8506 8507 8508 8509 8510 8511 8512 8513 8514 8515 8516 8517 8518 8519 8520 8521 8522 8523 8524 8525 8526 8527 8528 8529 8530 8531 8532 8533 8534 8535 8536 8537 8538 8539 8540 8541 8542 8543 8544 8545 8546 8547 8548 8549 8550 8551 8552 8553 8554 8555 8556 8557 8558 8559 8560 8561 8562 8563 8564 8565 8566 8567 8568 8569 8570 8571 8572 8573 8574 8575 8576 8577 8578 8579 8580 8581 8582 8583 8584 8585 8586 8587 8588 8589 8590 8591 8592 8593 8594 8595 8596 8597 8598 8599 8600 8601 8602 8603 8604 8605 8606 8607 8608 8609 8610 8611 8612 8613 8614 8615 8616 8617 8618 8619 8620 8621 8622 8623 8624 8625 8626 8627 8628 8629 8630 8631 8632 8633 8634 8635 8636 8637 8638 8639 8640 8641 8642 8643 8644 8645 8646 8647 8648 8649 8650 8651 8652 8653 8654 8655 8656 8657 8658 8659 8660 8661 8662 8663 8664 8665 8666 8667 8668 8669 8670 8671 8672 8673 8674 8675 8676 8677 8678 8679 8680 8681 8682 8683 8684 8685 8686 8687 8688 8689 8690 8691 8692 8693 8694 8695 8696 8697 8698 8699 8700 8701 8702 8703 8704 8705 8706 8707 8708 8709 8710 8711 8712 8713 8714 8715 8716 8717 8718 8719 8720 8721 8722 8723 8724 8725 8726 8727 8728 8729 8730 8731 8732 8733 8734 8735 8736 8737 8738 8739 8740 8741 8742 8743 8744 8745 8746 8747 8748 8749 8750 8751 8752 8753 8754 8755 8756 8757 8758 8759 8760 8761 8762 8763 8764 8765 8766 8767 8768 8769 8770 8771 8772 8773 8774 8775 8776 8777 8778 8779 8780 8781 8782 8783 8784 8785 8786 8787 8788 8789 8790 8791 8792 8793 8794 8795 8796 8797 8798 8799 8800 8801 8802 8803 8804 8805 8806 8807 8808 8809 8810 8811 8812 8813 8814 8815 8816 8817 8818 8819 8820 8821 8822 8823 8824 8825 8826 8827 8828 8829 8830 8831 8832 8833 8834 8835 8836 8837 8838 8839 8840 8841 8842 8843 8844 8845 8846 8847 8848 8849 8850 8851 8852 8853 8854 8855 8856 8857 8858 8859 8860 8861 8862 8863 8864 8865 8866 8867 8868 8869 8870 8871 8872 8873 8874 8875 8876 8877 8878 8879 8880 8881 8882 8883 8884 8885 8886 8887 8888 8889 8890 8891 8892 8893 8894 8895 8896 8897 8898 8899 8900 8901 8902 8903 8904 8905 8906 8907 8908 8909 8910 8911 8912 8913 8914 8915 8916 8917 8918 8919 8920 8921 8922 8923 8924 8925 8926 8927 8928 8929 8930 8931 8932 8933 8934 8935 8936 8937 8938 8939 8940 8941 8942 8943 8944 8945 8946 8947 8948 8949 8950 8951 8952 8953 8954 8955 8956 8957 8958 8959 8960 8961 8962 8963 8964 8965 8966 8967 8968 8969 8970 8971 8972 8973 8974 8975 8976 8977 8978 8979 8980 8981 8982 8983 8984 8985 8986 8987 8988 8989 8990 8991 8992 8993 8994 8995 8996 8997 8998 8999 9000 9001 9002 9003 9004 9005 9006 9007 9008 9009 9010 9011 9012 9013 9014 9015 9016 9017 9018 9019 9020 9021 9022 9023 9024 9025 9026 9027 9028 9029 9030 9031 9032 9033 9034 9035 9036 9037 9038 9039 9040 9041 9042 9043 9044 9045 9046 9047 9048 9049 9050 9051 9052 9053 9054 9055 9056 9057 9058 9059 9060 9061 9062 9063 9064 9065 9066 9067 9068 9069 9070 9071 9072 9073 9074 9075 9076 9077 9078 9079 9080 9081 9082 9083 9084 9085 9086 9087 9088 9089 9090 9091 9092 9093 9094 9095 9096 9097 9098 9099 9100 9101 9102 9103 9104 9105 9106 9107 9108 9109 9110 9111 9112 9113 9114 9115 9116 9117 9118 9119 9120 9121 9122 9123 9124 9125 9126 9127 9128 9129 9130 9131 9132 9133 9134 9135 9136 9137 9138 9139 9140 9141 9142 9143 9144 9145 9146 9147 9148 9149 9150 9151 9152 9153 9154 9155 9156 9157 9158 9159 9160 9161 9162 9163 9164 9165 9166 9167 9168 9169 9170 9171 9172 9173 9174 9175 9176 9177 9178 9179 9180 9181 9182 9183 9184 9185 9186 9187 9188 9189 9190 9191 9192 9193 9194 9195 9196 9197 9198 9199 9200 9201 9202 9203 9204 9205 9206 9207 9208 9209 9210 9211 9212 9213 9214 9215 9216 9217 9218 9219 9220 9221 9222 9223 9224 9225 9226 9227 9228 9229 9230 9231 9232 9233 9234 9235 9236 9237 9238 9239 9240 9241 9242 9243 9244 9245 9246 9247 9248 9249 9250 9251 9252 9253 9254 9255 9256 9257 9258 9259 9260 9261 9262 9263 9264 9265 9266 9267 9268 9269 9270 9271 9272 9273 9274 9275 9276 9277 9278 9279 9280 9281 9282 9283 9284 9285 9286 9287 9288 9289 9290 9291 9292 9293 9294 9295 9296 9297 9298 9299 9300 9301 9302 9303 9304 9305 9306 9307 9308 9309 9310 9311 9312 9313 9314 9315 9316 9317 9318 9319 9320 9321 9322 9323 9324 9325 9326 9327 9328 9329 9330 9331 9332 9333 9334 9335 9336 9337 9338 9339 9340 9341 9342 9343 9344 9345 9346 9347 9348 9349 9350 9351 9352 9353 9354 9355 9356 9357 9358 9359 9360 9361 9362 9363 9364 9365 9366 9367 9368 9369 9370 9371 9372 9373 9374 9375 9376 9377 9378 9379 9380 9381 9382 9383 9384 9385 9386 9387 9388 9389 9390 9391 9392 9393 9394 9395 9396 9397 9398 9399 9400 9401 9402 9403 9404 9405 9406 9407 9408 9409 9410 9411 9412 9413 9414 9415 9416 9417 9418 9419 9420 9421 9422 9423 9424 9425 9426 9427 9428 9429 9430 9431 9432 9433 9434 9435 9436 9437 9438 9439 9440 9441 9442 9443 9444 9445 9446 9447 9448 9449 9450 9451 9452 9453 9454 9455 9456 9457 9458 9459 9460 9461 9462 9463 9464 9465 9466 9467 9468 9469 9470 9471 9472 9473 9474 9475 9476 9477 9478 9479 9480 9481 9482 9483 9484 9485 9486 9487 9488 9489 9490 9491 9492 9493 9494 9495 9496 9497 9498 9499 9500 9501 9502 9503 9504 9505 9506 9507 9508 9509 9510 9511 9512 9513 9514 9515 9516 9517 9518 9519 9520 9521 9522 9523 9524 9525 9526 9527 9528 9529 9530 9531 9532 9533 9534 9535 9536 9537 9538 9539 9540 9541 9542 9543 9544 9545 9546 9547 9548 9549 9550 9551 9552 9553 9554 9555 9556 9557 9558 9559 9560 9561 9562 9563 9564 9565 9566 9567 9568 9569 9570 9571 9572 9573 9574 9575 9576 9577 9578 9579 9580 9581 9582 9583 9584 9585 9586 9587 9588 9589 9590 9591 9592 9593 9594 9595 9596 9597 9598 9599 9600 9601 9602 9603 9604 9605 9606 9607 9608 9609 9610 9611 9612 9613 9614 9615 9616 9617 9618 9619 9620 9621 9622 9623 9624 9625 9626 9627 9628 9629 9630 9631 9632 9633 9634 9635 9636 9637 9638 9639 9640 9641 9642 9643 9644 9645 9646 9647 9648 9649 9650 9651 9652 9653 9654 9655 9656 9657 9658 9659 9660 9661 9662 9663 9664 9665 9666 9667 9668 9669 9670 9671 9672 9673 9674 9675 9676 9677 9678 9679 9680 9681 9682 9683 9684 9685 9686 9687 9688 9689 9690 9691 9692 9693 9694 9695 9696 9697 9698 9699 9700 9701 9702 9703 9704 9705 9706 9707 9708 9709 9710 9711 9712 9713 9714 9715 9716 9717 9718 9719 9720 9721 9722 9723 9724 9725 9726 9727 9728 9729 9730 9731 9732 9733 9734 9735 9736 9737 9738 9739 9740 9741 9742 9743 9744 9745 9746 9747 9748 9749 9750 9751 9752 9753 9754 9755 9756 9757 9758 9759 9760 9761 9762 9763 9764 9765 9766 9767 9768 9769 9770 9771 9772 9773 9774 9775 9776 9777 9778 9779 9780 9781 9782 9783 9784 9785 9786 9787 9788 9789 9790 9791 9792 9793 9794 9795 9796 9797 9798 9799 9800 9801 9802 9803 9804 9805 9806 9807 9808 9809 9810 9811 9812 9813 9814 9815 9816 9817 9818 9819 9820 9821 9822 9823 9824 9825 9826 9827 9828 9829 9830 9831 9832 9833 9834 9835 9836 9837 9838 9839 9840 9841 9842 9843 9844 9845 9846 9847 9848 9849 9850 9851 9852 9853 9854 9855 9856 9857 9858 9859 9860 9861 9862 9863 9864 9865 9866 9867 9868 9869 9870 9871 9872 9873 9874 9875 9876 9877 9878 9879 9880 9881 9882 9883 9884 9885 9886 9887 9888 9889 9890 9891 9892 9893 9894 9895 9896 9897 9898 9899 9900 9901 9902 9903 9904 9905 9906 9907 9908 9909 9910 9911 9912 9913 9914 9915 9916 9917 9918 9919 9920 9921 9922 9923 9924 9925 9926 9927 9928 9929 9930 9931 9932 9933 9934 9935 9936 9937 9938 9939 9940 9941 9942 9943 9944 9945 9946 9947 9948 9949 9950 9951 9952 9953 9954 9955 9956 9957 9958 9959 9960 9961 9962 9963 9964 9965 9966 9967 9968 9969 9970 9971 9972 9973 9974 9975 9976 9977 9978 9979 9980 9981 9982 9983 9984 9985 9986 9987 9988 9989 9990 9991 9992 9993 9994 9995 9996 9997 9998 9999 10000 10001 10002 10003 10004 10005 10006 10007 10008 10009 10010 10011 10012 10013 10014 10015 10016 10017 10018 10019 10020 10021 10022 10023 10024 10025 10026 10027 10028 10029 10030 10031 10032 10033 10034 10035 10036 10037 10038 10039 10040 10041 10042 10043 10044 10045 10046 10047 10048 10049 10050 10051 10052 10053 10054 10055 10056 10057 10058 10059 10060 10061 10062 10063 10064 10065 10066 10067 10068 10069 10070 10071 10072 10073 10074 10075 10076 10077 10078 10079 10080 10081 10082 10083 10084 10085 10086 10087 10088 10089 10090 10091 10092 10093 10094 10095 10096 10097 10098 10099 10100 10101 10102 10103 10104 10105 10106 10107 10108 10109 10110 10111 10112 10113 10114 10115 10116 10117 10118 10119 10120 10121 10122 10123 10124 10125 10126 10127 10128 10129 10130 10131 10132 10133 10134 10135 10136 10137 10138 10139 10140 10141 10142 10143 10144 10145 10146 10147 10148 10149 10150 10151 10152 10153 10154 10155 10156 10157 10158 10159 10160 10161 10162 10163 10164 10165 10166 10167 10168 10169 10170 10171 10172 10173 10174 10175 10176 10177 10178 10179 10180 10181 10182 10183 10184 10185 10186 10187 10188 10189 10190 10191 10192 10193 10194 10195 10196 10197 10198 10199 10200 10201 10202 10203 10204 10205 10206 10207 10208 10209 10210 10211 10212 10213 10214 10215 10216 10217 10218 10219 10220 10221 10222 10223 10224 10225 10226 10227 10228 10229 10230 10231 10232 10233 10234 10235 10236 10237 10238 10239 10240 10241 10242 10243 10244 10245 10246 10247 10248 10249 10250 10251 10252 10253 10254 10255 10256 10257 10258 10259 10260 10261 10262 10263 10264 10265 10266 10267 10268 10269 10270 10271 10272 10273 10274 10275 10276 10277 10278 10279 10280 10281 10282 10283 10284 10285 10286 10287 10288 10289 10290 10291 10292 10293 10294 10295 10296 10297 10298 10299 10300 10301 10302 10303 10304 10305 10306 10307 10308 10309 10310 10311 10312 10313 10314 10315 10316 10317 10318 10319 10320 10321 10322 10323 10324 10325 10326 10327 10328 10329 10330 10331 10332 10333 10334 10335 10336 10337 10338 10339 10340 10341 10342 10343 10344 10345 10346 10347 10348 10349 10350 10351 10352 10353 10354 10355 10356 10357 10358 10359 10360 10361 10362 10363 10364 10365 10366 10367 10368 10369 10370 10371 10372 10373 10374 10375 10376 10377 10378 10379 10380 10381 10382 10383 10384 10385 10386 10387 10388 10389 10390 10391 10392 10393 10394 10395 10396 10397 10398 10399 10400 10401 10402 10403 10404 10405 10406 10407 10408 10409 10410 10411 10412 10413 10414 10415 10416 10417 10418 10419 10420 10421 10422 10423 10424 10425 10426 10427 10428 10429 10430 10431 10432 10433 10434 10435 10436 10437 10438 10439 10440 10441 10442 10443 10444 10445 10446 10447 10448 10449 10450 10451 10452 10453 10454 10455 10456 10457 10458 10459 10460 10461 10462 10463 10464 10465 10466 10467 10468 10469 10470 10471 10472 10473 10474 10475 10476 10477 10478 10479 10480 10481 10482 10483 10484 10485 10486 10487 10488 10489 10490 10491 10492 10493 10494 10495 10496 10497 10498 10499 10500 10501 10502 10503 10504 10505 10506 10507 10508 10509 10510 10511 10512 10513 10514 10515 10516 10517 10518 10519 10520 10521 10522 10523 10524 10525 10526 10527 10528 10529 10530 10531 10532 10533 10534 10535 10536 10537 10538 10539 10540 10541 10542 10543 10544 10545 10546 10547 10548 10549 10550 10551 10552 10553 10554 10555 10556 10557 10558 10559 10560 10561 10562 10563 10564 10565 10566 10567 10568 10569 10570 10571 10572 10573 10574 10575 10576 10577 10578 10579 10580 10581 10582 10583 10584 10585 10586 10587 10588 10589 10590 10591 10592 10593 10594 10595 10596 10597 10598 10599 10600 10601 10602 10603 10604 10605 10606 10607 10608 10609 10610 10611 10612 10613 10614 10615 10616 10617 10618 10619 10620 10621 10622 10623 10624 10625 10626 10627 10628 10629 10630 10631 10632 10633 10634 10635 10636 10637 10638 10639 10640 10641 10642 10643 10644 10645 10646 10647 10648 10649 10650 10651 10652 10653 10654 10655 10656 10657 10658 10659 10660 10661 10662 10663 10664 10665 10666 10667 10668 10669 10670 10671 10672 10673 10674 10675 10676 10677 10678 10679 10680 10681 10682 10683 10684 10685 10686 10687 10688 10689 10690 10691 10692 10693 10694 10695 10696 10697 10698 10699 10700 10701 10702 10703 10704 10705 10706 10707 10708 10709 10710 10711 10712 10713 10714 10715 10716 10717 10718 10719 10720 10721 10722 10723 10724 10725 10726 10727 10728 10729 10730 10731 10732 10733 10734 10735 10736 10737 10738 10739 10740 10741 10742 10743 10744 10745 10746 10747 10748 10749 10750 10751 10752 10753 10754 10755 10756 10757 10758 10759 10760 10761 10762 10763 10764 10765 10766 10767 10768 10769 10770 10771 10772 10773 10774 10775 10776 10777 10778 10779 10780 10781 10782 10783 10784 10785 10786 10787 10788 10789 10790 10791 10792 10793 10794 10795 10796 10797 10798 10799 10800 10801 10802 10803 10804 10805 10806 10807 10808 10809 10810 10811 10812 10813 10814 10815 10816 10817 10818 10819 10820 10821 10822 10823 10824 10825 10826 10827 10828 10829 10830 10831 10832 10833 10834 10835 10836 10837 10838 10839 10840 10841 10842 10843 10844 10845 10846 10847 10848 10849 10850 10851 10852 10853 10854 10855 10856 10857 10858 10859 10860 10861 10862 10863 10864 10865 10866 10867 10868 10869 10870 10871 10872 10873 10874 10875 10876 10877 10878 10879 10880 10881 10882 10883 10884 10885 10886 10887 10888 10889 10890 10891 10892 10893 10894 10895 10896 10897 10898 10899 10900 10901 10902 10903 10904 10905 10906 10907 10908 10909 10910 10911 10912 10913 10914 10915 10916 10917 10918 10919 10920 10921 10922 10923 10924 10925 10926 10927 10928 10929 10930 10931 10932 10933 10934 10935 10936 10937 10938 10939 10940 10941 10942 10943 10944 10945 10946 10947 10948 10949 10950 10951 10952 10953 10954 10955 10956 10957 10958 10959 10960 10961 10962 10963 10964 10965 10966 10967 10968 10969 10970 10971 10972 10973 10974 10975 10976 10977 10978 10979 10980 10981 10982 10983 10984 10985 10986 10987 10988 10989 10990 10991 10992 10993 10994 10995 10996 10997 10998 10999 11000 11001 11002 11003 11004 11005 11006 11007 11008 11009 11010 11011 11012 11013 11014 11015 11016 11017 11018 11019 11020 11021 11022 11023 11024 11025 11026 11027 11028 11029 11030 11031 11032 11033 11034 11035 11036 11037 11038 11039 11040 11041 11042 11043 11044 11045 11046 11047 11048 11049 11050 11051 11052 11053 11054 11055 11056 11057 11058 11059 11060 11061 11062 11063 11064 11065 11066 11067 11068 11069 11070 11071 11072 11073 11074 11075 11076 11077 11078 11079 11080 11081 11082 11083 11084 11085 11086 11087 11088 11089 11090 11091 11092 11093 11094 11095 11096 11097 11098 11099 11100 11101 11102 11103 11104 11105 11106 11107 11108 11109 11110 11111 11112 11113 11114 11115 11116 11117 11118 11119 11120 11121 11122 11123 11124 11125 11126 11127 11128 11129 11130 11131 11132 11133 11134 11135 11136 11137 11138 11139 11140 11141 11142 11143 11144 11145 11146 11147 11148 11149 11150 11151 11152 11153 11154 11155 11156 11157 11158 11159 11160 11161 11162 11163 11164 11165 11166 11167 11168 11169 11170 11171 11172 11173 11174 11175 11176 11177 11178 11179 11180 11181 11182 11183 11184 11185 11186 11187 11188 11189 11190 11191 11192 11193 11194 11195 11196 11197 11198 11199 11200 11201 11202 11203 11204 11205 11206 11207 11208 11209 11210 11211 11212 11213 11214 11215 11216 11217 11218 11219 11220 11221 11222 11223 11224 11225 11226 11227 11228 11229 11230 11231 11232 11233 11234 11235 11236 11237 11238 11239 11240 11241 11242 11243 11244 11245 11246 11247 11248 11249 11250 11251 11252 11253 11254 11255 11256 11257 11258 11259 11260 11261 11262 11263 11264 11265 11266 11267 11268 11269 11270 11271 11272 11273 11274 11275 11276 11277 11278 11279 11280 11281 11282 11283 11284 11285 11286 11287 11288 11289 11290 11291 11292 11293 11294 11295 11296 11297 11298 11299 11300 11301 11302 11303 11304 11305 11306 11307 11308 11309 11310 11311 11312 11313 11314 11315 11316 11317 11318 11319 11320 11321 11322 11323 11324 11325 11326 11327 11328 11329 11330 11331 11332 11333 11334 11335 11336 11337 11338 11339 11340 11341 11342 11343 11344 11345 11346 11347 11348 11349 11350 11351 11352 11353 11354 11355 11356 11357 11358 11359 11360 11361 11362 11363 11364 11365 11366 11367 11368 11369 11370 11371 11372 11373 11374 11375 11376 11377 11378 11379 11380 11381 11382 11383 11384 11385 11386 11387 11388 11389 11390 11391 11392 11393 11394 11395 11396 11397 11398 11399 11400 11401 11402 11403 11404 11405 11406 11407 11408 11409 11410 11411 11412 11413 11414 11415 11416 11417 11418 11419 11420 11421 11422 11423 11424 11425 11426 11427 11428 11429 11430 11431 11432 11433 11434 11435 11436 11437 11438 11439 11440 11441 11442 11443 11444 11445 11446 11447 11448 11449 11450 11451 11452 11453 11454 11455 11456 11457 11458 11459 11460 11461 11462 11463 11464 11465 11466 11467 11468 11469 11470 11471 11472 11473 11474 11475 11476 11477 11478 11479 11480 11481 11482 11483 11484 11485 11486 11487 11488 11489 11490 11491 11492 11493 11494 11495 11496 11497 11498 11499 11500 11501 11502 11503 11504 11505 11506 11507 11508 11509 11510 11511 11512 11513 11514 11515 11516 11517 11518 11519 11520 11521 11522 11523 11524 11525 11526 11527 11528 11529 11530 11531 11532 11533 11534 11535 11536 11537 11538 11539 11540 11541 11542 11543 11544 11545 11546 11547 11548 11549 11550 11551 11552 11553 11554 11555 11556 11557 11558 11559 11560 11561 11562 11563 11564 11565 11566 11567 11568 11569 11570 11571 11572 11573 11574 11575 11576 11577 11578 11579 11580 11581 11582 11583 11584 11585 11586 11587 11588 11589 11590 11591 11592 11593 11594 11595 11596 11597 11598 11599 11600 11601 11602 11603 11604 11605 11606 11607 11608 11609 11610 11611 11612 11613 11614 11615 11616 11617 11618 11619 11620 11621 11622 11623 11624 11625 11626 11627 11628 11629 11630 11631 11632 11633 11634 11635 11636 11637 11638 11639 11640 11641 11642 11643 11644 11645 11646 11647 11648 11649 11650 11651 11652 11653 11654 11655 11656 11657 11658 11659 11660 11661 11662 11663 11664 11665 11666 11667 11668 11669 11670 11671 11672 11673 11674 11675 11676 11677 11678 11679 11680 11681 11682 11683 11684 11685 11686 11687 11688 11689 11690 11691 11692 11693 11694 11695 11696 11697 11698 11699 11700 11701 11702 11703 11704 11705 11706 11707 11708 11709 11710 11711 11712 11713 11714 11715 11716 11717 11718 11719 11720 11721 11722 11723 11724 11725 11726 11727 11728 11729 11730 11731 11732 11733 11734 11735 11736 11737 11738 11739 11740 11741 11742 11743 11744 11745 11746 11747 11748 11749 11750 11751 11752 11753 11754 11755 11756 11757 11758 11759 11760 11761 11762 11763 11764 11765 11766 11767 11768 11769 11770 11771 11772 11773 11774 11775 11776 11777 11778 11779 11780 11781 11782 11783 11784 11785 11786 11787 11788 11789 11790 11791 11792 11793 11794 11795 11796 11797 11798 11799 11800 11801 11802 11803 11804 11805 11806 11807 11808 11809 11810 11811 11812 11813 11814 11815 11816 11817 11818 11819 11820 11821 11822 11823 11824 11825 11826 11827 11828 11829 11830 11831 11832 11833 11834 11835 11836 11837 11838 11839 11840 11841 11842 11843 11844 11845 11846 11847 11848 11849 11850 11851 11852 11853 11854 11855 11856 11857 11858 11859 11860 11861 11862 11863 11864 11865 11866 11867 11868 11869 11870 11871 11872 11873 11874 11875 11876 11877 11878 11879 11880 11881 11882 11883 11884 11885 11886 11887 11888 11889 11890 11891 11892 11893 11894 11895 11896 11897 11898 11899 11900 11901 11902 11903 11904 11905 11906 11907 11908 11909 11910 11911 11912 11913 11914 11915 11916 11917 11918 11919 11920 11921 11922 11923 11924 11925 11926 11927 11928 11929 11930 11931 11932 11933 11934 11935 11936 11937 11938 11939 11940 11941 11942 11943 11944 11945 11946 11947 11948 11949 11950 11951 11952 11953 11954 11955 11956 11957 11958 11959 11960 11961 11962 11963 11964 11965 11966 11967 11968 11969 11970 11971 11972 11973 11974 11975 11976 11977 11978 11979 11980 11981 11982 11983 11984 11985 11986 11987 11988 11989 11990 11991 11992 11993 11994 11995 11996 11997 11998 11999 12000 12001 12002 12003 12004 12005 12006 12007 12008 12009 12010 12011 12012 12013 12014 12015 12016 12017 12018 12019 12020 12021 12022 12023 12024 12025 12026 12027 12028 12029 12030 12031 12032 12033 12034 12035 12036 12037 12038 12039 12040 12041 12042 12043 12044 12045 12046 12047 12048 12049 12050 12051 12052 12053 12054 12055 12056 12057 12058 12059 12060 12061 12062 12063 12064 12065 12066 12067 12068 12069 12070 12071 12072 12073 12074 12075 12076 12077 12078 12079 12080 12081 12082 12083 12084 12085 12086 12087 12088 12089 12090 12091 12092 12093 12094 12095 12096 12097 12098 12099 12100 12101 12102 12103 12104 12105 12106 12107 12108 12109 12110 12111 12112 12113 12114 12115 12116 12117 12118 12119 12120 12121 12122 12123 12124 12125 12126 12127 12128 12129 12130 12131 12132 12133 12134 12135 12136 12137 12138 12139 12140 12141 12142 12143 12144 12145 12146 12147 12148 12149 12150 12151 12152 12153 12154 12155 12156 12157 12158 12159 12160 12161 12162 12163 12164 12165 12166 12167 12168 12169 12170 12171 12172 12173 12174 12175 12176 12177 12178 12179 12180 12181 12182 12183 12184 12185 12186 12187 12188 12189 12190 12191 12192 12193 12194 12195 12196 12197 12198 12199 12200 12201 12202 12203 12204 12205 12206 12207 12208 12209 12210 12211 12212 12213 12214 12215 12216 12217 12218 12219 12220 12221 12222 12223 12224 12225 12226 12227 12228 12229 12230 12231 12232 12233 12234 12235 12236 12237 12238 12239 12240 12241 12242 12243 12244 12245 12246 12247 12248 12249 12250 12251 12252 12253 12254 12255 12256 12257 12258 12259 12260 12261 12262 12263 12264 12265 12266 12267 12268 12269 12270 12271 12272 12273 12274 12275 12276 12277 12278 12279 12280 12281 12282 12283 12284 12285 12286 12287 12288 12289 12290 12291 12292 12293 12294 12295 12296 12297 12298 12299 12300 12301 12302 12303 12304 12305 12306 12307 12308 12309 12310 12311 12312 12313 12314 12315 12316 12317 12318 12319 12320 12321 12322 12323 12324 12325 12326 12327 12328 12329 12330 12331 12332 12333 12334 12335 12336 12337 12338 12339 12340 12341 12342 12343 12344 12345 12346 12347 12348 12349 12350 12351 12352 12353 12354 12355 12356 12357 12358 12359 12360 12361 12362 12363 12364 12365 12366 12367 12368 12369 12370 12371 12372 12373 12374 12375 12376 12377 12378 12379 12380 12381 12382 12383 12384 12385 12386 12387 12388 12389 12390 12391 12392 12393 12394 12395 12396 12397 12398 12399 12400 12401 12402 12403 12404 12405 12406 12407 12408 12409 12410 12411 12412 12413 12414 12415 12416 12417 12418 12419 12420 12421 12422 12423 12424 12425 12426 12427 12428 12429 12430 12431 12432 12433 12434 12435 12436 12437 12438 12439 12440 12441 12442 12443 12444 12445 12446 12447 12448 12449 12450 12451 12452 12453 12454 12455 12456 12457 12458 12459 12460 12461 12462 12463 12464 12465 12466 12467 12468 12469 12470 12471 12472 12473 12474 12475 12476 12477 12478 12479 12480 12481 12482 12483 12484 12485 12486 12487 12488 12489 12490 12491 12492 12493 12494 12495 12496 12497 12498 12499 12500 12501 12502 12503 12504 12505 12506 12507 12508 12509 12510 12511 12512 12513 12514 12515 12516 12517 12518 12519 12520 12521 12522 12523 12524 12525 12526 12527 12528 12529 12530 12531 12532 12533 12534 12535 12536 12537 12538 12539 12540 12541 12542 12543 12544 12545 12546 12547 12548 12549 12550 12551 12552 12553 12554 12555 12556 12557 12558 12559 12560 12561 12562 12563 12564 12565 12566 12567 12568 12569 12570 12571 12572 12573 12574 12575 12576 12577 12578 12579 12580 12581 12582 12583 12584 12585 12586 12587 12588 12589 12590 12591 12592 12593 12594 12595 12596 12597 12598 12599 12600 12601 12602 12603 12604 12605 12606 12607 12608 12609 12610 12611 12612 12613 12614 12615 12616 12617 12618 12619 12620 12621 12622 12623 12624 12625 12626 12627 12628 12629 12630 12631 12632 12633 12634 12635 12636 12637 12638 12639 12640 12641 12642 12643 12644 12645 12646 12647 12648 12649 12650 12651 12652 12653 12654 12655 12656 12657 12658 12659 12660 12661 12662 12663 12664 12665 12666 12667 12668 12669 12670 12671 12672 12673 12674 12675 12676 12677 12678 12679 12680 12681 12682 12683 12684 12685 12686 12687 12688 12689 12690 12691 12692 12693 12694 12695 12696 12697 12698 12699 12700 12701 12702 12703 12704 12705 12706 12707 12708 12709 12710 12711 12712 12713 12714 12715 12716 12717 12718 12719 12720 12721 12722 12723 12724 12725 12726 12727 12728 12729 12730 12731 12732 12733 12734 12735 12736 12737 12738 12739 12740 12741 12742 12743 12744 12745 12746 12747 12748 12749 12750 12751 12752 12753 12754 12755 12756 12757 12758 12759 12760 12761 12762 12763 12764 12765 12766 12767 12768 12769 12770 12771 12772 12773 12774 12775 12776 12777 12778 12779 12780 12781 12782 12783 12784 12785 12786 12787 12788 12789 12790 12791 12792 12793 12794 12795 12796 12797 12798 12799 12800 12801 12802 12803 12804 12805 12806 12807 12808 12809 12810 12811 12812 12813 12814 12815 12816 12817 12818 12819 12820 12821 12822 12823 12824 12825 12826 12827 12828 12829 12830 12831 12832 12833 12834 12835 12836 12837 12838 12839 12840 12841 12842 12843 12844 12845 12846 12847 12848 12849 12850 12851 12852 12853 12854 12855 12856 12857 12858 12859 12860 12861 12862 12863 12864 12865 12866 12867 12868 12869 12870 12871 12872 12873 12874 12875 12876 12877 12878 12879 12880 12881 12882 12883 12884 12885 12886 12887 12888 12889 12890 12891 12892 12893 12894 12895 12896 12897 12898 12899 12900 12901 12902 12903 12904 12905 12906 12907 12908 12909 12910 12911 12912 12913 12914 12915 12916 12917 12918 12919 12920 12921 12922 12923 12924 12925 12926 12927 12928 12929 12930 12931 12932 12933 12934 12935 12936 12937 12938 12939 12940 12941 12942 12943 12944 12945 12946 12947 12948 12949 12950 12951 12952 12953 12954 12955 12956 12957 12958 12959 12960 12961 12962 12963 12964 12965 12966 12967 12968 12969 12970 12971 12972 12973 12974 12975 12976 12977 12978 12979 12980 12981 12982 12983 12984 12985 12986 12987 12988 12989 12990 12991 12992 12993 12994 12995 12996 12997 12998 12999 13000 13001 13002 13003 13004 13005 13006 13007 13008 13009 13010 13011 13012 13013 13014 13015 13016 13017 13018 13019 13020 13021 13022 13023 13024 13025 13026 13027 13028 13029 13030 13031 13032 13033 13034 13035 13036 13037 13038 13039 13040 13041 13042 13043 13044 13045 13046 13047 13048 13049 13050 13051 13052 13053 13054 13055 13056 13057 13058 13059 13060 13061 13062 13063 13064 13065 13066 13067 13068 13069 13070 13071 13072 13073 13074 13075 13076 13077 13078 13079 13080 13081 13082 13083 13084 13085 13086 13087 13088 13089 13090 13091 13092 13093 13094 13095 13096 13097 13098 13099 13100 13101 13102 13103 13104 13105 13106 13107 13108 13109 13110 13111 13112 13113 13114 13115 13116 13117 13118 13119 13120 13121 13122 13123 13124 13125 13126 13127 13128 13129 13130 13131 13132 13133 13134 13135 13136 13137 13138 13139 13140 13141 13142 13143 13144 13145 13146 13147 13148 13149 13150 13151 13152 13153 13154 13155 13156 13157 13158 13159 13160 13161 13162 13163 13164 13165 13166 13167 13168 13169 13170 13171 13172 13173 13174 13175 13176 13177 13178 13179 13180 13181 13182 13183 13184 13185 13186 13187 13188 13189 13190 13191 13192 13193 13194 13195 13196 13197 13198 13199 13200 13201 13202 13203 13204 13205 13206 13207 13208 13209 13210 13211 13212 13213 13214 13215 13216 13217 13218 13219 13220 13221 13222 13223 13224 13225 13226 13227 13228 13229 13230 13231 13232 13233 13234 13235 13236 13237 13238 13239 13240 13241 13242 13243 13244 13245 13246 13247 13248 13249 13250 13251 13252 13253 13254 13255 13256 13257 13258 13259 13260 13261 13262 13263 13264 13265 13266 13267 13268 13269 13270 13271 13272 13273 13274 13275 13276 13277 13278 13279 13280 13281 13282 13283 13284 13285 13286 13287 13288 13289 13290 13291 13292 13293 13294 13295 13296 13297 13298 13299 13300 13301 13302 13303 13304 13305 13306 13307 13308 13309 13310 13311 13312 13313 13314 13315 13316 13317 13318 13319 13320 13321 13322 13323 13324 13325 13326 13327 13328 13329 13330 13331 13332 13333 13334 13335 13336 13337 13338 13339 13340 13341 13342 13343 13344 13345 13346 13347 13348 13349 13350 13351 13352 13353 13354 13355 13356 13357 13358 13359 13360 13361 13362 13363 13364 13365 13366 13367 13368 13369 13370 13371 13372 13373 13374 13375 13376 13377 13378 13379 13380 13381 13382 13383 13384 13385 13386 13387 13388 13389 13390 13391 13392 13393 13394 13395 13396 13397 13398 13399 13400 13401 13402 13403 13404 13405 13406 13407 13408 13409 13410 13411 13412 13413 13414 13415 13416 13417 13418 13419 13420 13421 13422 13423 13424 13425 13426 13427 13428 13429 13430 13431 13432 13433 13434 13435 13436 13437 13438 13439 13440 13441 13442 13443 13444 13445 13446 13447 13448 13449 13450 13451 13452 13453 13454 13455 13456 13457 13458 13459 13460 13461 13462 13463 13464 13465 13466 13467 13468 13469 13470 13471 13472 13473 13474 13475 13476 13477 13478 13479 13480 13481 13482 13483 13484 13485 13486 13487 13488 13489 13490 13491 13492 13493 13494 13495 13496 13497 13498 13499 13500 13501 13502 13503 13504 13505 13506 13507 13508 13509 13510 13511 13512 13513 13514 13515 13516 13517 13518 13519 13520 13521 13522 13523 13524 13525 13526 13527 13528 13529 13530 13531 13532 13533 13534 13535 13536 13537 13538 13539 13540 13541 13542 13543 13544 13545 13546 13547 13548 13549 13550 13551 13552 13553 13554 13555 13556 13557 13558 13559 13560 13561 13562 13563 13564 13565 13566 13567 13568 13569 13570 13571 13572 13573 13574 13575 13576 13577 13578 13579 13580 13581 13582 13583 13584 13585 13586 13587 13588 13589 13590 13591 13592 13593 13594 13595 13596 13597 13598 13599 13600 13601 13602 13603 13604 13605 13606 13607 13608 13609 13610 13611 13612 13613 13614 13615 13616 13617 13618 13619 13620 13621 13622 13623 13624 13625 13626 13627 13628 13629 13630 13631 13632 13633 13634 13635 13636 13637 13638 13639 13640 13641 13642 13643 13644 13645 13646 13647 13648 13649 13650 13651 13652 13653 13654 13655 13656 13657 13658 13659 13660 13661 13662 13663 13664 13665 13666 13667 13668 13669 13670 13671 13672 13673 13674 13675 13676 13677 13678 13679 13680 13681 13682 13683 13684 13685 13686 13687 13688 13689 13690 13691 13692 13693 13694 13695 13696 13697 13698 13699 13700 13701 13702 13703 13704 13705 13706 13707 13708 13709 13710 13711 13712 13713 13714 13715 13716 13717 13718 13719 13720 13721 13722 13723 13724 13725 13726 13727 13728 13729 13730 13731 13732 13733 13734 13735 13736 13737 13738 13739 13740 13741 13742 13743 13744 13745 13746 13747 13748 13749 13750 13751 13752 13753 13754 13755 13756 13757 13758 13759 13760 13761 13762 13763 13764 13765 13766 13767 13768 13769 13770 13771 13772 13773 13774 13775 13776 13777 13778 13779 13780 13781 13782 13783 13784 13785 13786 13787 13788 13789 13790 13791 13792 13793 13794 13795 13796 13797 13798 13799 13800 13801 13802 13803 13804 13805 13806 13807 13808 13809 13810 13811 13812 13813 13814 13815 13816 13817 13818 13819 13820 13821 13822 13823 13824 13825 13826 13827 13828 13829 13830 13831 13832 13833 13834 13835 13836 13837 13838 13839 13840 13841 13842 13843 13844 13845 13846 13847 13848 13849 13850 13851 13852 13853 13854 13855 13856 13857 13858 13859 13860 13861 13862 13863 13864 13865 13866 13867 13868 13869 13870 13871 13872 13873 13874 13875 13876 13877 13878 13879 13880 13881 13882 13883 13884 13885 13886 13887 13888 13889 13890 13891 13892 13893 13894 13895 13896 13897 13898 13899 13900 13901 13902 13903 13904 13905 13906 13907 13908 13909 13910 13911 13912 13913 13914 13915 13916 13917 13918 13919 13920 13921 13922 13923 13924 13925 13926 13927 13928 13929 13930 13931 13932 13933 13934 13935 13936 13937 13938 13939 13940 13941 13942 13943 13944 13945 13946 13947 13948 13949 13950 13951 13952 13953 13954 13955 13956 13957 13958 13959 13960 13961 13962 13963 13964 13965 13966 13967 13968 13969 13970 13971 13972 13973 13974 13975 13976 13977 13978 13979 13980 13981 13982 13983 13984 13985 13986 13987 13988 13989 13990 13991 13992 13993 13994 13995 13996 13997 13998 13999 14000 14001 14002 14003 14004 14005 14006 14007 14008 14009 14010 14011 14012 14013 14014 14015 14016 14017 14018 14019 14020 14021 14022 14023 14024 14025 14026 14027 14028 14029 14030 14031 14032 14033 14034 14035 14036 14037 14038 14039 14040 14041 14042 14043 14044 14045 14046 14047 14048 14049 14050 14051 14052 14053 14054 14055 14056 14057 14058 14059 14060 14061 14062 14063 14064 14065 14066 14067 14068 14069 14070 14071 14072 14073 14074 14075 14076 14077 14078 14079 14080 14081 14082 14083 14084 14085 14086 14087 14088 14089 14090 14091 14092 14093 14094 14095 14096 14097 14098 14099 14100 14101 14102 14103 14104 14105 14106 14107 14108 14109 14110 14111 14112 14113 14114 14115 14116 14117 14118 14119 14120 14121 14122 14123 14124 14125 14126 14127 14128 14129 14130 14131 14132 14133 14134 14135 14136 14137 14138 14139 14140 14141 14142 14143 14144 14145 14146 14147 14148 14149 14150 14151 14152 14153 14154 14155 14156 14157 14158 14159 14160 14161 14162 14163 14164 14165 14166 14167 14168 14169 14170 14171 14172 14173 14174 14175 14176 14177 14178 14179 14180 14181 14182 14183 14184 14185 14186 14187 14188 14189 14190 14191 14192 14193 14194 14195 14196 14197 14198 14199 14200 14201 14202 14203 14204 14205 14206 14207 14208 14209 14210 14211 14212 14213 14214 14215 14216 14217 14218 14219 14220 14221 14222 14223 14224 14225 14226 14227 14228 14229 14230 14231 14232 14233 14234 14235 14236 14237 14238 14239 14240 14241 14242 14243 14244 14245 14246 14247 14248 14249 14250 14251 14252 14253 14254 14255 14256 14257 14258 14259 14260 14261 14262 14263 14264 14265 14266 14267 14268 14269 14270 14271 14272 14273 14274 14275 14276 14277 14278 14279 14280 14281 14282 14283 14284 14285 14286 14287 14288 14289 14290 14291 14292 14293 14294 14295 14296 14297 14298 14299 14300 14301 14302 14303 14304 14305 14306 14307 14308 14309 14310 14311 14312 14313 14314 14315 14316 14317 14318 14319 14320 14321 14322 14323 14324 14325 14326 14327 14328 14329 14330 14331 14332 14333 14334 14335 14336 14337 14338 14339 14340 14341 14342 14343 14344 14345 14346 14347 14348 14349 14350 14351 14352 14353 14354 14355 14356 14357 14358 14359 14360 14361 14362 14363 14364 14365 14366 14367 14368 14369 14370 14371 14372 14373 14374 14375 14376 14377 14378 14379 14380 14381 14382 14383 14384 14385 14386 14387 14388 14389 14390 14391 14392 14393 14394 14395 14396 14397 14398 14399 14400 14401 14402 14403 14404 14405 14406 14407 14408 14409 14410 14411 14412 14413 14414 14415 14416 14417 14418 14419 14420 14421 14422 14423 14424 14425 14426 14427 14428 14429 14430 14431 14432 14433 14434 14435 14436 14437 14438 14439 14440 14441 14442 14443 14444 14445 14446 14447 14448 14449 14450 14451 14452 14453 14454 14455 14456 14457 14458 14459 14460 14461 14462 14463 14464 14465 14466 14467 14468 14469 14470 14471 14472 14473 14474 14475 14476 14477 14478 14479 14480 14481 14482 14483 14484 14485 14486 14487 14488 14489 14490 14491 14492 14493 14494 14495 14496 14497 14498 14499 14500 14501 14502 14503 14504 14505 14506 14507 14508 14509 14510 14511 14512 14513 14514 14515 14516 14517 14518 14519 14520 14521 14522 14523 14524 14525 14526 14527 14528 14529 14530 14531 14532 14533 14534 14535 14536 14537 14538 14539 14540 14541 14542 14543 14544 14545 14546 14547 14548 14549 14550 14551 14552 14553 14554 14555 14556 14557 14558 14559 14560 14561 14562 14563 14564 14565 14566 14567 14568 14569 14570 14571 14572 14573 14574 14575 14576 14577 14578 14579 14580 14581 14582 14583 14584 14585 14586 14587 14588 14589 14590 14591 14592 14593 14594 14595 14596 14597 14598 14599 14600 14601 14602 14603 14604 14605 14606 14607 14608 14609 14610 14611 14612 14613 14614 14615 14616 14617 14618 14619 14620 14621 14622 14623 14624 14625 14626 14627 14628 14629 14630 14631 14632 14633 14634 14635 14636 14637 14638 14639 14640 14641 14642 14643 14644 14645 14646 14647 14648 14649 14650 14651 14652 14653 14654 14655 14656 14657 14658 14659 14660 14661 14662 14663 14664 14665 14666 14667 14668 14669 14670 14671 14672 14673 14674 14675 14676 14677 14678 14679 14680 14681 14682 14683 14684 14685 14686 14687 14688 14689 14690 14691 14692 14693 14694 14695 14696 14697 14698 14699 14700 14701 14702 14703 14704 14705 14706 14707 14708 14709 14710 14711 14712 14713 14714 14715 14716 14717 14718 14719 14720 14721 14722 14723 14724 14725 14726 14727 14728 14729 14730 14731 14732 14733 14734 14735 14736 14737 14738 14739 14740 14741 14742 14743 14744 14745 14746 14747 14748 14749 14750 14751 14752 14753 14754 14755 14756 14757 14758 14759 14760 14761 14762 14763 14764 14765 14766 14767 14768 14769 14770 14771 14772 14773 14774 14775 14776 14777 14778 14779 14780 14781 14782 14783 14784 14785 14786 14787 14788 14789 14790 14791 14792 14793 14794 14795 14796 14797 14798 14799 14800 14801 14802 14803 14804 14805 14806 14807 14808 14809 14810 14811 14812 14813 14814 14815 14816 14817 14818 14819 14820 14821 14822 14823 14824 14825 14826 14827 14828 14829 14830 14831 14832 14833 14834 14835 14836 14837 14838 14839 14840 14841 14842 14843 14844 14845 14846 14847 14848 14849 14850 14851 14852 14853 14854 14855 14856 14857 14858 14859 14860 14861 14862 14863 14864 14865 14866 14867 14868 14869 14870 14871 14872 14873 14874 14875 14876 14877 14878 14879 14880 14881 14882 14883 14884 14885 14886 14887 14888 14889 14890 14891 14892 14893 14894 14895 14896 14897 14898 14899 14900 14901 14902 14903 14904 14905 14906 14907 14908 14909 14910 14911 14912 14913 14914 14915 14916 14917 14918 14919 14920 14921 14922 14923 14924 14925 14926 14927 14928 14929 14930 14931 14932 14933 14934 14935 14936 14937 14938 14939 14940 14941 14942 14943 14944 14945 14946 14947 14948 14949 14950 14951 14952 14953 14954 14955 14956 14957 14958 14959 14960 14961 14962 14963 14964 14965 14966 14967 14968 14969 14970 14971 14972 14973 14974 14975 14976 14977 14978 14979 14980 14981 14982 14983 14984 14985 14986 14987 14988 14989 14990 14991 14992 14993 14994 14995 14996 14997 14998 14999 15000 15001 15002 15003 15004 15005 15006 15007 15008 15009 15010 15011 15012 15013 15014 15015 15016 15017 15018 15019 15020 15021 15022 15023 15024 15025 15026 15027 15028 15029 15030 15031 15032 15033 15034 15035 15036 15037 15038 15039 15040 15041 15042 15043 15044 15045 15046 15047 15048 15049 15050 15051 15052 15053 15054 15055 15056 15057 15058 15059 15060 15061 15062 15063 15064 15065 15066 15067 15068 15069 15070 15071 15072 15073 15074 15075 15076 15077 15078 15079 15080 15081 15082 15083 15084 15085 15086 15087 15088 15089 15090 15091 15092 15093 15094 15095 15096 15097 15098 15099 15100 15101 15102 15103 15104 15105 15106 15107 15108 15109 15110 15111 15112 15113 15114 15115 15116 15117 15118 15119 15120 15121 15122 15123 15124 15125 15126 15127 15128 15129 15130 15131 15132 15133 15134 15135 15136 15137 15138 15139 15140 15141 15142 15143 15144 15145 15146 15147 15148 15149 15150 15151 15152 15153 15154 15155 15156 15157 15158 15159 15160 15161 15162 15163 15164 15165 15166 15167 15168 15169 15170 15171 15172 15173 15174 15175 15176 15177 15178 15179 15180 15181 15182 15183 15184 15185 15186 15187 15188 15189 15190 15191 15192 15193 15194 15195 15196 15197 15198 15199 15200 15201 15202 15203 15204 15205 15206 15207 15208 15209 15210 15211 15212 15213 15214 15215 15216 15217 15218 15219 15220 15221 15222 15223 15224 15225 15226 15227 15228 15229 15230 15231 15232 15233 15234 15235 15236 15237 15238 15239 15240 15241 15242 15243 15244 15245 15246 15247 15248 15249 15250 15251 15252 15253 15254 15255 15256 15257 15258 15259 15260 15261 15262 15263 15264 15265 15266 15267 15268 15269 15270 15271 15272 15273 15274 15275 15276 15277 15278 15279 15280 15281 15282 15283 15284 15285 15286 15287 15288 15289 15290 15291 15292 15293 15294 15295 15296 15297 15298 15299 15300 15301 15302 15303 15304 15305 15306 15307 15308 15309 15310 15311 15312 15313 15314 15315 15316 15317 15318 15319 15320 15321 15322 15323 15324 15325 15326 15327 15328 15329 15330 15331 15332 15333 15334 15335 15336 15337 15338 15339 15340 15341 15342 15343 15344 15345 15346 15347 15348 15349 15350 15351 15352 15353 15354 15355 15356 15357 15358 15359 15360 15361 15362 15363 15364 15365 15366 15367 15368 15369 15370 15371 15372 15373 15374 15375 15376 15377 15378 15379 15380 15381 15382 15383 15384 15385 15386 15387 15388 15389 15390 15391 15392 15393 15394 15395 15396 15397 15398 15399 15400 15401 15402 15403 15404 15405 15406 15407 15408 15409 15410 15411 15412 15413 15414 15415 15416 15417 15418 15419 15420 15421 15422 15423 15424 15425 15426 15427 15428 15429 15430 15431 15432 15433 15434 15435 15436 15437 15438 15439 15440 15441 15442 15443 15444 15445 15446 15447 15448 15449 15450 15451 15452 15453 15454 15455 15456 15457 15458 15459 15460 15461 15462 15463 15464 15465 15466 15467 15468 15469 15470 15471 15472 15473 15474 15475 15476 15477 15478 15479 15480 15481 15482 15483 15484 15485 15486 15487 15488 15489 15490 15491 15492 15493 15494 15495 15496 15497 15498 15499 15500 15501 15502 15503 15504 15505 15506 15507 15508 15509 15510 15511 15512 15513 15514 15515 15516 15517 15518 15519 15520 15521 15522 15523 15524 15525 15526 15527 15528 15529 15530 15531 15532 15533 15534 15535 15536 15537 15538 15539 15540 15541 15542 15543 15544 15545 15546 15547 15548 15549 15550 15551 15552 15553 15554 15555 15556 15557 15558 15559 15560 15561 15562 15563 15564 15565 15566 15567 15568 15569 15570 15571 15572 15573 15574 15575 15576 15577 15578 15579 15580 15581 15582 15583 15584 15585 15586 15587 15588 15589 15590 15591 15592 15593 15594 15595 15596 15597 15598 15599 15600 15601 15602 15603 15604 15605 15606 15607 15608 15609 15610 15611 15612 15613 15614 15615 15616 15617 15618 15619 15620 15621 15622 15623 15624 15625 15626 15627 15628 15629 15630 15631 15632 15633 15634 15635 15636 15637 15638 15639 15640 15641 15642 15643 15644 15645 15646 15647 15648 15649 15650 15651 15652 15653 15654 15655 15656 15657 15658 15659 15660 15661 15662 15663 15664 15665 15666 15667 15668 15669 15670 15671 15672 15673 15674 15675 15676 15677 15678 15679 15680 15681 15682 15683 15684 15685 15686 15687 15688 15689 15690 15691 15692 15693 15694 15695 15696 15697 15698 15699 15700 15701 15702 15703 15704 15705 15706 15707 15708 15709 15710 15711 15712 15713 15714 15715 15716 15717 15718 15719 15720 15721 15722 15723 15724 15725 15726 15727 15728 15729 15730 15731 15732 15733 15734 15735 15736 15737 15738 15739 15740 15741 15742 15743 15744 15745 15746 15747 15748 15749 15750 15751 15752 15753 15754 15755 15756 15757 15758 15759 15760 15761 15762 15763 15764 15765 15766 15767 15768 15769 15770 15771 15772 15773 15774 15775 15776 15777 15778 15779 15780 15781 15782 15783 15784 15785 15786 15787 15788 15789 15790 15791 15792 15793 15794 15795 15796 15797 15798 15799 15800 15801 15802 15803 15804 15805 15806 15807 15808 15809 15810 15811 15812 15813 15814 15815 15816 15817 15818 15819 15820 15821 15822 15823 15824 15825 15826 15827 15828 15829 15830 15831 15832 15833 15834 15835 15836 15837 15838 15839 15840 15841 15842 15843 15844 15845 15846 15847 15848 15849 15850 15851 15852 15853 15854 15855 15856 15857 15858 15859 15860 15861 15862 15863 15864 15865 15866 15867 15868 15869 15870 15871 15872 15873 15874 15875 15876 15877 15878 15879 15880 15881 15882 15883 15884 15885 15886 15887 15888 15889 15890 15891 15892 15893 15894 15895 15896 15897 15898 15899 15900 15901 15902 15903 15904 15905 15906 15907 15908 15909 15910 15911 15912 15913 15914 15915 15916 15917 15918 15919 15920 15921 15922 15923 15924 15925 15926 15927 15928 15929 15930 15931 15932 15933 15934 15935 15936 15937 15938 15939 15940 15941 15942 15943 15944 15945 15946 15947 15948 15949 15950 15951 15952 15953 15954 15955 15956 15957 15958 15959 15960 15961 15962 15963 15964 15965 15966 15967 15968 15969 15970 15971 15972 15973 15974 15975 15976 15977 15978 15979 15980 15981 15982 15983 15984 15985 15986 15987 15988 15989 15990 15991 15992 15993 15994 15995 15996 15997 15998 15999 16000 16001 16002 16003 16004 16005 16006 16007 16008 16009 16010 16011 16012 16013 16014 16015 16016 16017 16018 16019 16020 16021 16022 16023 16024 16025 16026 16027 16028 16029 16030 16031 16032 16033 16034 16035 16036 16037 16038 16039 16040 16041 16042 16043 16044 16045 16046 16047 16048 16049 16050 16051 16052 16053 16054 16055 16056 16057 16058 16059 16060 16061 16062 16063 16064 16065 16066 16067 16068 16069 16070 16071 16072 16073 16074 16075 16076 16077 16078 16079 16080 16081 16082 16083 16084 16085 16086 16087 16088 16089 16090 16091 16092 16093 16094 16095 16096 16097 16098 16099 16100 16101 16102 16103 16104 16105 16106 16107 16108 16109 16110 16111 16112 16113 16114 16115 16116 16117 16118 16119 16120 16121 16122 16123 16124 16125 16126 16127 16128 16129 16130 16131 16132 16133 16134 16135 16136 16137 16138 16139 16140 16141 16142 16143 16144 16145 16146 16147 16148 16149 16150 16151 16152 16153 16154 16155 16156 16157 16158 16159 16160 16161 16162 16163 16164 16165 16166 16167 16168 16169 16170 16171 16172 16173 16174 16175 16176 16177 16178 16179 16180 16181 16182 16183 16184 16185 16186 16187 16188 16189 16190 16191 16192 16193 16194 16195 16196 16197 16198 16199 16200 16201 16202 16203 16204 16205 16206 16207 16208 16209 16210 16211 16212 16213 16214 16215 16216 16217 16218 16219 16220 16221 16222 16223 16224 16225 16226 16227 16228 16229 16230 16231 16232 16233 16234 16235 16236 16237 16238 16239 16240 16241 16242 16243 16244 16245 16246 16247 16248 16249 16250 16251 16252 16253 16254 16255 16256 16257 16258 16259 16260 16261 16262 16263 16264 16265 16266 16267 16268 16269 16270 16271 16272 16273 16274 16275 16276 16277 16278 16279 16280 16281 16282 16283 16284 16285 16286 16287 16288 16289 16290 16291 16292 16293 16294 16295 16296 16297 16298 16299 16300 16301 16302 16303 16304 16305 16306 16307 16308 16309 16310 16311 16312 16313 16314 16315 16316 16317 16318 16319 16320 16321 16322 16323 16324 16325 16326 16327 16328 16329 16330 16331 16332 16333 16334 16335 16336 16337 16338 16339 16340 16341 16342 16343 16344 16345 16346 16347 16348 16349 16350 16351 16352 16353 16354 16355 16356 16357 16358 16359 16360 16361 16362 16363 16364 16365 16366 16367 16368 16369 16370 16371 16372 16373 16374 16375 16376 16377 16378 16379 16380 16381 16382 16383 16384 16385 16386 16387 16388 16389 16390 16391 16392 16393 16394 16395 16396 16397 16398 16399 16400 16401 16402 16403 16404 16405 16406 16407 16408 16409 16410 16411 16412 16413 16414 16415 16416 16417 16418 16419 16420 16421 16422 16423 16424 16425 16426 16427 16428 16429 16430 16431 16432 16433 16434 16435 16436 16437 16438 16439 16440 16441 16442 16443 16444 16445 16446 16447 16448 16449 16450 16451 16452 16453 16454 16455 16456 16457 16458 16459 16460 16461 16462 16463 16464 16465 16466 16467 16468 16469 16470 16471 16472 16473 16474 16475 16476 16477 16478 16479 16480 16481 16482 16483 16484 16485 16486 16487 16488 16489 16490 16491 16492 16493 16494 16495 16496 16497 16498 16499 16500 16501 16502 16503 16504 16505 16506 16507 16508 16509 16510 16511 16512 16513 16514 16515 16516 16517 16518 16519 16520 16521 16522 16523 16524 16525 16526 16527 16528 16529 16530 16531 16532 16533 16534 16535 16536 16537 16538 16539 16540 16541 16542 16543 16544 16545 16546 16547 16548 16549 16550 16551 16552 16553 16554 16555 16556 16557 16558 16559 16560 16561 16562 16563 16564 16565 16566 16567 16568 16569 16570 16571 16572 16573 16574 16575 16576 16577 16578 16579 16580 16581 16582 16583 16584 16585 16586 16587 16588 16589 16590 16591 16592 16593 16594 16595 16596 16597 16598 16599 16600 16601 16602 16603 16604 16605 16606 16607 16608 16609 16610 16611 16612 16613 16614 16615 16616 16617 16618 16619 16620 16621 16622 16623 16624 16625 16626 16627 16628 16629 16630 16631 16632 16633 16634 16635 16636 16637 16638 16639 16640 16641 16642 16643 16644 16645 16646 16647 16648 16649 16650 16651 16652 16653 16654 16655 16656 16657 16658 16659 16660 16661 16662 16663 16664 16665 16666 16667 16668 16669 16670 16671 16672 16673 16674 16675 16676 16677 16678 16679 16680 16681 16682 16683 16684 16685 16686 16687 16688 16689 16690 16691 16692 16693 16694 16695 16696 16697 16698 16699 16700 16701 16702 16703 16704 16705 16706 16707 16708 16709 16710 16711 16712 16713 16714 16715 16716 16717 16718 16719 16720 16721 16722 16723 16724 16725 16726 16727 16728 16729 16730 16731 16732 16733 16734 16735 16736 16737 16738 16739 16740 16741 16742 16743 16744 16745 16746 16747 16748 16749 16750 16751 16752 16753 16754 16755 16756 16757 16758 16759 16760 16761 16762 16763 16764 16765 16766 16767 16768 16769 16770 16771 16772 16773 16774 16775 16776 16777 16778 16779 16780 16781 16782 16783 16784 16785 16786 16787 16788 16789 16790 16791 16792 16793 16794 16795 16796 16797 16798 16799 16800 16801 16802 16803 16804 16805 16806 16807 16808 16809 16810 16811 16812 16813 16814 16815 16816 16817 16818 16819 16820 16821 16822 16823 16824 16825 16826 16827 16828 16829 16830 16831 16832 16833 16834 16835 16836 16837 16838 16839 16840 16841 16842 16843 16844 16845 16846 16847 16848 16849 16850 16851 16852 16853 16854 16855 16856 16857 16858 16859 16860 16861 16862 16863 16864 16865 16866 16867 16868 16869 16870 16871 16872 16873 16874 16875 16876 16877 16878 16879 16880 16881 16882 16883 16884 16885 16886 16887 16888 16889 16890 16891 16892 16893 16894 16895 16896 16897 16898 16899 16900 16901 16902 16903 16904 16905 16906 16907 16908 16909 16910 16911 16912 16913 16914 16915 16916 16917 16918 16919 16920 16921 16922 16923 16924 16925 16926 16927 16928 16929 16930 16931 16932 16933 16934 16935 16936 16937 16938 16939 16940 16941 16942 16943 16944 16945 16946 16947 16948 16949 16950 16951 16952 16953 16954 16955 16956 16957 16958 16959 16960 16961 16962 16963 16964 16965 16966 16967 16968 16969 16970 16971 16972 16973 16974 16975 16976 16977 16978 16979 16980 16981 16982 16983 16984 16985 16986 16987 16988 16989 16990 16991 16992 16993 16994 16995 16996 16997 16998 16999 17000 17001 17002 17003 17004 17005 17006 17007 17008 17009 17010 17011 17012 17013 17014 17015 17016 17017 17018 17019 17020 17021 17022 17023 17024 17025 17026 17027 17028 17029 17030 17031 17032 17033 17034 17035 17036 17037 17038 17039 17040 17041 17042 17043 17044 17045 17046 17047 17048 17049 17050 17051 17052 17053 17054 17055 17056 17057 17058 17059 17060 17061 17062 17063 17064 17065 17066 17067 17068 17069 17070 17071 17072 17073 17074 17075 17076 17077 17078 17079 17080 17081 17082 17083 17084 17085 17086 17087 17088 17089 17090 17091 17092 17093 17094 17095 17096 17097 17098 17099 17100 17101 17102 17103 17104 17105 17106 17107 17108 17109 17110 17111 17112 17113 17114 17115 17116 17117 17118 17119 17120 17121 17122 17123 17124 17125 17126 17127 17128 17129 17130 17131 17132 17133 17134 17135 17136 17137 17138 17139 17140 17141 17142 17143 17144 17145 17146 17147 17148 17149 17150 17151 17152 17153 17154 17155 17156 17157 17158 17159 17160 17161 17162 17163 17164 17165 17166 17167 17168 17169 17170 17171 17172 17173 17174 17175 17176 17177 17178 17179 17180 17181 17182 17183 17184 17185 17186 17187 17188 17189 17190 17191 17192 17193 17194 17195 17196 17197 17198 17199 17200 17201 17202 17203 17204 17205 17206 17207 17208 17209 17210 17211 17212 17213 17214 17215 17216 17217 17218 17219 17220 17221 17222 17223 17224 17225 17226 17227 17228 17229 17230 17231 17232 17233 17234 17235 17236 17237 17238 17239 17240 17241 17242 17243 17244 17245 17246 17247 17248 17249 17250 17251 17252 17253 17254 17255 17256 17257 17258 17259 17260 17261 17262 17263 17264 17265 17266 17267 17268 17269 17270 17271 17272 17273 17274 17275 17276 17277 17278 17279 17280 17281 17282 17283 17284 17285 17286 17287 17288 17289 17290 17291 17292 17293 17294 17295 17296 17297 17298 17299 17300 17301 17302 17303 17304 17305 17306 17307 17308 17309 17310 17311 17312 17313 17314 17315 17316 17317 17318 17319 17320 17321 17322 17323 17324 17325 17326 17327 17328 17329 17330 17331 17332 17333 17334 17335 17336 17337 17338 17339 17340 17341 17342 17343 17344 17345 17346 17347 17348 17349 17350 17351 17352 17353 17354 17355 17356 17357 17358 17359 17360 17361 17362 17363 17364 17365 17366 17367 17368 17369 17370 17371 17372 17373 17374 17375 17376 17377 17378 17379 17380 17381 17382 17383 17384 17385 17386 17387 17388 17389 17390 17391 17392 17393 17394 17395 17396 17397 17398 17399 17400 17401 17402 17403 17404 17405 17406 17407 17408 17409 17410 17411 17412 17413 17414 17415 17416 17417 17418 17419 17420 17421 17422 17423 17424 17425 17426 17427 17428 17429 17430 17431 17432 17433 17434 17435 17436 17437 17438 17439 17440 17441 17442 17443 17444 17445 17446 17447 17448 17449 17450 17451 17452 17453 17454 17455 17456 17457 17458 17459 17460 17461 17462 17463 17464 17465 17466 17467 17468 17469 17470 17471 17472 17473 17474 17475 17476 17477 17478 17479 17480 17481 17482 17483 17484 17485 17486 17487 17488 17489 17490 17491 17492 17493 17494 17495 17496 17497 17498 17499 17500 17501 17502 17503 17504 17505 17506 17507 17508 17509 17510 17511 17512 17513 17514 17515 17516 17517 17518 17519 17520 17521 17522 17523 17524 17525 17526 17527 17528 17529 17530 17531 17532 17533 17534 17535 17536 17537 17538 17539 17540 17541 17542 17543 17544 17545 17546 17547 17548 17549 17550 17551 17552 17553 17554 17555 17556 17557 17558 17559 17560 17561 17562 17563 17564 17565 17566 17567 17568 17569 17570 17571 17572 17573 17574 17575 17576 17577 17578 17579 17580 17581 17582 17583 17584 17585 17586 17587 17588 17589 17590 17591 17592 17593 17594 17595 17596 17597 17598 17599 17600 17601 17602 17603 17604 17605 17606 17607 17608 17609 17610 17611 17612 17613 17614 17615 17616 17617 17618 17619 17620 17621 17622 17623 17624 17625 17626 17627 17628 17629 17630 17631 17632 17633 17634 17635 17636 17637 17638 17639 17640 17641 17642 17643 17644 17645 17646 17647 17648 17649 17650 17651 17652 17653 17654 17655 17656 17657 17658 17659 17660 17661 17662 17663 17664 17665 17666 17667 17668 17669 17670 17671 17672 17673 17674 17675 17676 17677 17678 17679 17680 17681 17682 17683 17684 17685 17686 17687 17688 17689 17690 17691 17692 17693 17694 17695 17696 17697 17698 17699 17700 17701 17702 17703 17704 17705 17706 17707 17708 17709 17710 17711 17712 17713 17714 17715 17716 17717 17718 17719 17720 17721 17722 17723 17724 17725 17726 17727 17728 17729 17730 17731 17732 17733 17734 17735 17736 17737 17738 17739 17740 17741 17742 17743 17744 17745 17746 17747 17748 17749 17750 17751 17752 17753 17754 17755 17756 17757 17758 17759 17760 17761 17762 17763 17764 17765 17766 17767 17768 17769 17770 17771 17772 17773 17774 17775 17776 17777 17778 17779 17780 17781 17782 17783 17784 17785 17786 17787 17788 17789 17790 17791 17792 17793 17794 17795 17796 17797 17798 17799 17800 17801 17802 17803 17804 17805 17806 17807 17808 17809 17810 17811 17812 17813 17814 17815 17816 17817 17818 17819 17820 17821 17822 17823 17824 17825 17826 17827 17828 17829 17830 17831 17832 17833 17834 17835 17836 17837 17838 17839 17840 17841 17842 17843 17844 17845 17846 17847 17848 17849 17850 17851 17852 17853 17854 17855 17856 17857 17858 17859 17860 17861 17862 17863 17864 17865 17866 17867 17868 17869 17870 17871 17872 17873 17874 17875 17876 17877 17878 17879 17880 17881 17882 17883 17884 17885 17886 17887 17888 17889 17890 17891 17892 17893 17894 17895 17896 17897 17898 17899 17900 17901 17902 17903 17904 17905 17906 17907 17908 17909 17910 17911 17912 17913 17914 17915 17916 17917 17918 17919 17920 17921 17922 17923 17924 17925 17926 17927 17928 17929 17930 17931 17932 17933 17934 17935 17936 17937 17938 17939 17940 17941 17942 17943 17944 17945 17946 17947 17948 17949 17950 17951 17952 17953 17954 17955 17956 17957 17958 17959 17960 17961 17962 17963 17964 17965 17966 17967 17968 17969 17970 17971 17972 17973 17974 17975 17976 17977 17978 17979 17980 17981 17982 17983 17984 17985 17986 17987 17988 17989 17990 17991 17992 17993 17994 17995 17996 17997 17998 17999 18000 18001 18002 18003 18004 18005 18006 18007 18008 18009 18010 18011 18012 18013 18014 18015 18016 18017 18018 18019 18020 18021 18022 18023 18024 18025 18026 18027 18028 18029 18030 18031 18032 18033 18034 18035 18036 18037 18038 18039 18040 18041 18042 18043 18044 18045 18046 18047 18048 18049 18050 18051 18052 18053 18054 18055 18056 18057 18058 18059 18060 18061 18062 18063 18064 18065 18066 18067 18068 18069 18070 18071 18072 18073 18074 18075 18076 18077 18078 18079 18080 18081 18082 18083 18084 18085 18086 18087 18088 18089 18090 18091 18092 18093 18094 18095 18096 18097 18098 18099 18100 18101 18102 18103 18104 18105 18106 18107 18108 18109 18110 18111 18112 18113 18114 18115 18116 18117 18118 18119 18120 18121 18122 18123 18124 18125 18126 18127 18128 18129 18130 18131 18132 18133 18134 18135 18136 18137 18138 18139 18140 18141 18142 18143 18144 18145 18146 18147 18148 18149 18150 18151 18152 18153 18154 18155 18156 18157 18158 18159 18160 18161 18162 18163 18164 18165 18166 18167 18168 18169 18170 18171 18172 18173 18174 18175 18176 18177 18178 18179 18180 18181 18182 18183 18184 18185 18186 18187 18188 18189 18190 18191 18192 18193 18194 18195 18196 18197 18198 18199 18200 18201 18202 18203 18204 18205 18206 18207 18208 18209 18210 18211 18212 18213 18214 18215 18216 18217 18218 18219 18220 18221 18222 18223 18224 18225 18226 18227 18228 18229 18230 18231 18232 18233 18234 18235 18236 18237 18238 18239 18240 18241 18242 18243 18244 18245 18246 18247 18248 18249 18250 18251 18252 18253 18254 18255 18256 18257 18258 18259 18260 18261 18262 18263 18264 18265 18266 18267 18268 18269 18270 18271 18272 18273 18274 18275 18276 18277 18278 18279 18280 18281 18282 18283 18284 18285 18286 18287 18288 18289 18290 18291 18292 18293 18294 18295 18296 18297 18298 18299 18300 18301 18302 18303 18304 18305 18306 18307 18308 18309 18310 18311 18312 18313 18314 18315 18316 18317 18318 18319 18320 18321 18322 18323 18324 18325 18326 18327 18328 18329 18330 18331 18332 18333 18334 18335 18336 18337 18338 18339 18340 18341 18342 18343 18344 18345 18346 18347 18348 18349 18350 18351 18352 18353 18354 18355 18356 18357 18358 18359 18360 18361 18362 18363 18364 18365 18366 18367 18368 18369 18370 18371 18372 18373 18374 18375 18376 18377 18378 18379 18380 18381 18382 18383 18384 18385 18386 18387 18388 18389 18390 18391 18392 18393 18394 18395 18396 18397 18398 18399 18400 18401 18402 18403 18404 18405 18406 18407 18408 18409 18410 18411 18412 18413 18414 18415 18416 18417 18418 18419 18420 18421 18422 18423 18424 18425 18426 18427 18428 18429 18430 18431 18432 18433 18434 18435 18436 18437 18438 18439 18440 18441 18442 18443 18444 18445 18446 18447 18448 18449 18450 18451 18452 18453 18454 18455 18456 18457 18458 18459 18460 18461 18462 18463 18464 18465 18466 18467 18468 18469 18470 18471 18472 18473 18474 18475 18476 18477 18478 18479 18480 18481 18482 18483 18484 18485 18486 18487 18488 18489 18490 18491 18492 18493 18494 18495 18496 18497 18498 18499 18500 18501 18502 18503 18504 18505 18506 18507 18508 18509 18510 18511 18512 18513 18514 18515 18516 18517 18518 18519 18520 18521 18522 18523 18524 18525 18526 18527 18528 18529 18530 18531 18532 18533 18534 18535 18536 18537 18538 18539 18540 18541 18542 18543 18544 18545 18546 18547 18548 18549 18550 18551 18552 18553 18554 18555 18556 18557 18558 18559 18560 18561 18562 18563 18564 18565 18566 18567 18568 18569 18570 18571 18572 18573 18574 18575 18576 18577 18578 18579 18580 18581 18582 18583 18584 18585 18586 18587 18588 18589 18590 18591 18592 18593 18594 18595 18596 18597 18598 18599 18600 18601 18602 18603 18604 18605 18606 18607 18608 18609 18610 18611 18612 18613 18614 18615 18616 18617 18618 18619 18620 18621 18622 18623 18624 18625 18626 18627 18628 18629 18630 18631 18632 18633 18634 18635 18636 18637 18638 18639 18640 18641 18642 18643 18644 18645 18646 18647 18648 18649 18650 18651 18652 18653 18654 18655 18656 18657 18658 18659 18660 18661 18662 18663 18664 18665 18666 18667 18668 18669 18670 18671 18672 18673 18674 18675 18676 18677 18678 18679 18680 18681 18682 18683 18684 18685 18686 18687 18688 18689 18690 18691 18692 18693 18694 18695 18696 18697 18698 18699 18700 18701 18702 18703 18704 18705 18706 18707 18708 18709 18710 18711 18712 18713 18714 18715 18716 18717 18718 18719 18720 18721 18722 18723 18724 18725 18726 18727 18728 18729 18730 18731 18732 18733 18734 18735 18736 18737 18738 18739 18740 18741 18742 18743 18744 18745 18746 18747 18748 18749 18750 18751 18752 18753 18754 18755 18756 18757 18758 18759 18760 18761 18762 18763 18764 18765 18766 18767 18768 18769 18770 18771 18772 18773 18774 18775 18776 18777 18778 18779 18780 18781 18782 18783 18784 18785 18786 18787 18788 18789 18790 18791 18792 18793 18794 18795 18796 18797 18798 18799 18800 18801 18802 18803 18804 18805 18806 18807 18808 18809 18810 18811 18812 18813 18814 18815 18816 18817 18818 18819 18820 18821 18822 18823 18824 18825 18826 18827 18828 18829 18830 18831 18832 18833 18834 18835 18836 18837 18838 18839 18840 18841 18842 18843 18844 18845 18846 18847 18848 18849 18850 18851 18852 18853 18854 18855 18856 18857 18858 18859 18860 18861 18862 18863 18864 18865 18866 18867 18868 18869 18870 18871 18872 18873 18874 18875 18876 18877 18878 18879 18880 18881 18882 18883 18884 18885 18886 18887 18888 18889 18890 18891 18892 18893 18894 18895 18896 18897 18898 18899 18900 18901 18902 18903 18904 18905 18906 18907 18908 18909 18910 18911 18912 18913 18914 18915 18916 18917 18918 18919 18920 18921 18922 18923 18924 18925 18926 18927 18928 18929 18930 18931 18932 18933 18934 18935 18936 18937 18938 18939 18940 18941 18942 18943 18944 18945 18946 18947 18948 18949 18950 18951 18952 18953 18954 18955 18956 18957 18958 18959 18960 18961 18962 18963 18964 18965 18966 18967 18968 18969 18970 18971 18972 18973 18974 18975 18976 18977 18978 18979 18980 18981 18982 18983 18984 18985 18986 18987 18988 18989 18990 18991 18992 18993 18994 18995 18996 18997 18998 18999 19000 19001 19002 19003 19004 19005 19006 19007 19008 19009 19010 19011 19012 19013 19014 19015 19016 19017 19018 19019 19020 19021 19022 19023 19024 19025 19026 19027 19028 19029 19030 19031 19032 19033 19034 19035 19036 19037 19038 19039 19040 19041 19042 19043 19044 19045 19046 19047 19048 19049 19050 19051 19052 19053 19054 19055 19056 19057 19058 19059 19060 19061 19062 19063 19064 19065 19066 19067 19068 19069 19070 19071 19072 19073 19074 19075 19076 19077 19078 19079 19080 19081 19082 19083 19084 19085 19086 19087 19088 19089 19090 19091 19092 19093 19094 19095 19096 19097 19098 19099 19100 19101 19102 19103 19104 19105 19106 19107 19108 19109 19110 19111 19112 19113 19114 19115 19116 19117 19118 19119 19120 19121 19122 19123 19124 19125 19126 19127 19128 19129 19130 19131 19132 19133 19134 19135 19136 19137 19138 19139 19140 19141 19142 19143 19144 19145 19146 19147 19148 19149 19150 19151 19152 19153 19154 19155 19156 19157 19158 19159 19160 19161 19162 19163 19164 19165 19166 19167 19168 19169 19170 19171 19172 19173 19174 19175 19176 19177 19178 19179 19180 19181 19182 19183 19184 19185 19186 19187 19188 19189 19190 19191 19192 19193 19194 19195 19196 19197 19198 19199 19200 19201 19202 19203 19204 19205 19206 19207 19208 19209 19210 19211 19212 19213 19214 19215 19216 19217 19218 19219 19220 19221 19222 19223 19224 19225 19226 19227 19228 19229 19230 19231 19232 19233 19234 19235 19236 19237 19238 19239 19240 19241 19242 19243 19244 19245 19246 19247 19248 19249 19250 19251 19252 19253 19254 19255 19256 19257 19258 19259 19260 19261 19262 19263 19264 19265 19266 19267 19268 19269 19270 19271 19272 19273 19274 19275 19276 19277 19278 19279 19280 19281 19282 19283 19284 19285 19286 19287 19288 19289 19290 19291 19292 19293 19294 19295 19296 19297 19298 19299 19300 19301 19302 19303 19304 19305 19306 19307 19308 19309 19310 19311 19312 19313 19314 19315 19316 19317 19318 19319 19320 19321 19322 19323 19324 19325 19326 19327 19328 19329 19330 19331 19332 19333 19334 19335 19336 19337 19338 19339 19340 19341 19342 19343 19344 19345 19346 19347 19348 19349 19350 19351 19352 19353 19354 19355 19356 19357 19358 19359 19360 19361 19362 19363 19364 19365 19366 19367 19368 19369 19370 19371 19372 19373 19374 19375 19376 19377 19378 19379 19380 19381 19382 19383 19384 19385 19386 19387 19388 19389 19390 19391 19392 19393 19394 19395 19396 19397 19398 19399 19400 19401 19402 19403 19404 19405 19406 19407 19408 19409 19410 19411 19412 19413 19414 19415 19416 19417 19418 19419 19420 19421 19422 19423 19424 19425 19426 19427 19428 19429 19430 19431 19432 19433 19434 19435 19436 19437 19438 19439 19440 19441 19442 19443 19444 19445 19446 19447 19448 19449 19450 19451 19452 19453 19454 19455 19456 19457 19458 19459 19460 19461 19462 19463 19464 19465 19466 19467 19468 19469 19470 19471 19472 19473 19474 19475 19476 19477 19478 19479 19480 19481 19482 19483 19484 19485 19486 19487 19488 19489 19490 19491 19492 19493 19494 19495 19496 19497 19498 19499 19500 19501 19502 19503 19504 19505 19506 19507 19508 19509 19510 19511 19512 19513 19514 19515 19516 19517 19518 19519 19520 19521 19522 19523 19524 19525 19526 19527 19528 19529 19530 19531 19532 19533 19534 19535 19536 19537 19538 19539 19540 19541 19542 19543 19544 19545 19546 19547 19548 19549 19550 19551 19552 19553 19554 19555 19556 19557 19558 19559 19560 19561 19562 19563 19564 19565 19566 19567 19568 19569 19570 19571 19572 19573 19574 19575 19576 19577 19578 19579 19580 19581 19582 19583 19584 19585 19586 19587 19588 19589 19590 19591 19592 19593 19594 19595 19596 19597 19598 19599 19600 19601 19602 19603 19604 19605 19606 19607 19608 19609 19610 19611 19612 19613 19614 19615 19616 19617 19618 19619 19620 19621 19622 19623 19624 19625 19626 19627 19628 19629 19630 19631 19632 19633 19634 19635 19636 19637 19638 19639 19640 19641 19642 19643 19644 19645 19646 19647 19648 19649 19650 19651 19652 19653 19654 19655 19656 19657 19658 19659 19660 19661 19662 19663 19664 19665 19666 19667 19668 19669 19670 19671 19672 19673 19674 19675 19676 19677 19678 19679 19680 19681 19682 19683 19684 19685 19686 19687 19688 19689 19690 19691 19692 19693 19694 19695 19696 19697 19698 19699 19700 19701 19702 19703 19704 19705 19706 19707 19708 19709 19710 19711 19712 19713 19714 19715 19716 19717 19718 19719 19720 19721 19722 19723 19724 19725 19726 19727 19728 19729 19730 19731 19732 19733 19734 19735 19736 19737 19738 19739 19740 19741 19742 19743 19744 19745 19746 19747 19748 19749 19750 19751 19752 19753 19754 19755 19756 19757 19758 19759 19760 19761 19762 19763 19764 19765 19766 19767 19768 19769 19770 19771 19772 19773 19774 19775 19776 19777 19778 19779 19780 19781 19782 19783 19784 19785 19786 19787 19788 19789 19790 19791 19792 19793 19794 19795 19796 19797 19798 19799 19800 19801 19802 19803 19804 19805 19806 19807 19808 19809 19810 19811 19812 19813 19814 19815 19816 19817 19818 19819 19820 19821 19822 19823 19824 19825 19826 19827 19828 19829 19830 19831 19832 19833 19834 19835 19836 19837 19838 19839 19840 19841 19842 19843 19844 19845 19846 19847 19848 19849 19850 19851 19852 19853 19854 19855 19856 19857 19858 19859 19860 19861 19862 19863 19864 19865 19866 19867 19868 19869 19870 19871 19872 19873 19874 19875 19876 19877 19878 19879 19880 19881 19882 19883 19884 19885 19886 19887 19888 19889 19890 19891 19892 19893 19894 19895 19896 19897 19898 19899 19900 19901 19902 19903 19904 19905 19906 19907 19908 19909 19910 19911 19912 19913 19914 19915 19916 19917 19918 19919 19920 19921 19922 19923 19924 19925 19926 19927 19928 19929 19930 19931 19932 19933 19934 19935 19936 19937 19938 19939 19940 19941 19942 19943 19944 19945 19946 19947 19948 19949 19950 19951 19952 19953 19954 19955 19956 19957 19958 19959 19960 19961 19962 19963 19964 19965 19966 19967 19968 19969 19970 19971 19972 19973 19974 19975 19976 19977 19978 19979 19980 19981 19982 19983 19984 19985 19986 19987 19988 19989 19990 19991 19992 19993 19994 19995 19996 19997 19998 19999 20000 20001 20002 20003 20004 20005 20006 20007 20008 20009 20010 20011 20012 20013 20014 20015 20016 20017 20018 20019 20020 20021 20022 20023 20024 20025 20026 20027 20028 20029 20030 20031 20032 20033 20034 20035 20036 20037 20038 20039 20040 20041 20042 20043 20044 20045 20046 20047 20048 20049 20050 20051 20052 20053 20054 20055 20056 20057 20058 20059 20060 20061 20062 20063 20064 20065 20066 20067 20068 20069 20070 20071 20072 20073 20074 20075 20076 20077 20078 20079 20080 20081 20082 20083 20084 20085 20086 20087 20088 20089 20090 20091 20092 20093 20094 20095 20096 20097 20098 20099 20100 20101 20102 20103 20104 20105 20106 20107 20108 20109 20110 20111 20112 20113 20114 20115 20116 20117 20118 20119 20120 20121 20122 20123 20124 20125 20126 20127 20128 20129 20130 20131 20132 20133 20134 20135 20136 20137 20138 20139 20140 20141 20142 20143 20144 20145 20146 20147 20148 20149 20150 20151 20152 20153 20154 20155 20156 20157 20158 20159 20160 20161 20162 20163 20164 20165 20166 20167 20168 20169 20170 20171 20172 20173 20174 20175 20176 20177 20178 20179 20180 20181 20182 20183 20184 20185 20186 20187 20188 20189 20190 20191 20192 20193 20194 20195 20196 20197 20198 20199 20200 20201 20202 20203 20204 20205 20206 20207 20208 20209 20210 20211 20212 20213 20214 20215 20216 20217 20218 20219 20220 20221 20222 20223 20224 20225 20226 20227 20228 20229 20230 20231 20232 20233 20234 20235 20236 20237 20238 20239 20240 20241 20242 20243 20244 20245 20246 20247 20248 20249 20250 20251 20252 20253 20254 20255 20256 20257 20258 20259 20260 20261 20262 20263 20264 20265 20266 20267 20268 20269 20270 20271 20272 20273 20274 20275 20276 20277 20278 20279 20280 20281 20282 20283 20284 20285 20286 20287 20288 20289 20290 20291 20292 20293 20294 20295 20296 20297 20298 20299 20300 20301 20302 20303 20304 20305 20306 20307 20308 20309 20310 20311 20312 20313 20314 20315 20316 20317 20318 20319 20320 20321 20322 20323 20324 20325 20326 20327 20328 20329 20330 20331 20332 20333 20334 20335 20336 20337 20338 20339 20340 20341 20342 20343 20344 20345 20346 20347 20348 20349 20350 20351 20352 20353 20354 20355 20356 20357 20358 20359 20360 20361 20362 20363 20364 20365 20366 20367 20368 20369 20370 20371 20372 20373 20374 20375 20376 20377 20378 20379 20380 20381 20382 20383 20384 20385 20386 20387 20388 20389 20390 20391 20392 20393 20394 20395 20396 20397 20398 20399 20400 20401 20402 20403 20404 20405 20406 20407 20408 20409 20410 20411 20412 20413 20414 20415 20416 20417 20418 20419 20420 20421 20422 20423 20424 20425 20426 20427 20428 20429 20430 20431 20432 20433 20434 20435 20436 20437 20438 20439 20440 20441 20442 20443 20444 20445 20446 20447 20448 20449 20450 20451 20452 20453 20454 20455 20456 20457 20458 20459 20460 20461 20462 20463 20464 20465 20466 20467 20468 20469 20470 20471 20472 20473 20474 20475 20476 20477 20478 20479 20480 20481 20482 20483 20484 20485 20486 20487 20488 20489 20490 20491 20492 20493 20494 20495 20496 20497 20498 20499 20500 20501 20502 20503 20504 20505 20506 20507 20508 20509 20510 20511 20512 20513 20514 20515 20516 20517 20518 20519 20520 20521 20522 20523 20524 20525 20526 20527 20528 20529 20530 20531 20532 20533 20534 20535 20536 20537 20538 20539 20540 20541 20542 20543 20544 20545 20546 20547 20548 20549 20550 20551 20552 20553 20554 20555 20556 20557 20558 20559 20560 20561 20562 20563 20564 20565 20566 20567 20568 20569 20570 20571 20572 20573 20574 20575 20576 20577 20578 20579 20580 20581 20582 20583 20584 20585 20586 20587 20588 20589 20590 20591 20592 20593 20594 20595 20596 20597 20598 20599 20600 20601 20602 20603 20604 20605 20606 20607 20608 20609 20610 20611 20612 20613 20614 20615 20616 20617 20618 20619 20620 20621 20622 20623 20624 20625 20626 20627 20628 20629 20630 20631 20632 20633 20634 20635 20636 20637 20638 20639 20640 20641 20642 20643 20644 20645 20646 20647 20648 20649 20650 20651 20652 20653 20654 20655 20656 20657 20658 20659 20660 20661 20662 20663 20664 20665 20666 20667 20668 20669 20670 20671 20672 20673 20674 20675 20676 20677 20678 20679 20680 20681 20682 20683 20684 20685 20686 20687 20688 20689 20690 20691 20692 20693 20694 20695 20696 20697 20698 20699 20700 20701 20702 20703 20704 20705 20706 20707 20708 20709 20710 20711 20712 20713 20714 20715 20716 20717 20718 20719 20720 20721 20722 20723 20724 20725 20726 20727 20728 20729 20730 20731 20732 20733 20734 20735 20736 20737 20738 20739 20740 20741 20742 20743 20744 20745 20746 20747 20748 20749 20750 20751 20752 20753 20754 20755 20756 20757 20758 20759 20760 20761 20762 20763 20764 20765 20766 20767 20768 20769 20770 20771 20772 20773 20774 20775 20776 20777 20778 20779 20780 20781 20782 20783 20784 20785 20786 20787 20788 20789 20790 20791 20792 20793 20794 20795 20796 20797 20798 20799 20800 20801 20802 20803 20804 20805 20806 20807 20808 20809 20810 20811 20812 20813 20814 20815 20816 20817 20818 20819 20820 20821 20822 20823 20824 20825 20826 20827 20828 20829 20830 20831 20832 20833 20834 20835 20836 20837 20838 20839 20840 20841 20842 20843 20844 20845 20846 20847 20848 20849 20850 20851 20852 20853 20854 20855 20856 20857 20858 20859 20860 20861 20862 20863 20864 20865 20866 20867 20868 20869 20870 20871 20872 20873 20874 20875 20876 20877 20878 20879 20880 20881 20882 20883 20884 20885 20886 20887 20888 20889 20890 20891 20892 20893 20894 20895 20896 20897 20898 20899 20900 20901 20902 20903 20904 20905 20906 20907 20908 20909 20910 20911 20912 20913 20914 20915 20916 20917 20918 20919 20920 20921 20922 20923 20924 20925 20926 20927 20928 20929 20930 20931 20932 20933 20934 20935 20936 20937 20938 20939 20940 20941 20942 20943 20944 20945 20946 20947 20948 20949 20950 20951 20952 20953 20954 20955 20956 20957 20958 20959 20960 20961 20962 20963 20964 20965 20966 20967 20968 20969 20970 20971 20972 20973 20974 20975 20976 20977 20978 20979 20980 20981 20982 20983 20984 20985 20986 20987 20988 20989 20990 20991 20992 20993 20994 20995 20996 20997 20998 20999 21000 21001 21002 21003 21004 21005 21006 21007 21008 21009 21010 21011 21012 21013 21014 21015 21016 21017 21018 21019 21020 21021 21022 21023 21024 21025 21026 21027 21028 21029 21030 21031 21032 21033 21034 21035 21036 21037 21038 21039 21040 21041 21042 21043 21044 21045 21046 21047 21048 21049 21050 21051 21052 21053 21054 21055 21056 21057 21058 21059 21060 21061 21062 21063 21064 21065 21066 21067 21068 21069 21070 21071 21072 21073 21074 21075 21076 21077 21078 21079 21080 21081 21082 21083 21084 21085 21086 21087 21088 21089 21090 21091 21092 21093 21094 21095 21096 21097 21098 21099 21100 21101 21102 21103 21104 21105 21106 21107 21108 21109 21110 21111 21112 21113 21114 21115 21116 21117 21118 21119 21120 21121 21122 21123 21124 21125 21126 21127 21128 21129 21130 21131 21132 21133 21134 21135 21136 21137 21138 21139 21140 21141 21142 21143 21144 21145 21146 21147 21148 21149 21150 21151 21152 21153 21154 21155 21156 21157 21158 21159 21160 21161 21162 21163 21164 21165 21166 21167 21168 21169 21170 21171 21172 21173 21174 21175 21176 21177 21178 21179 21180 21181 21182 21183 21184 21185 21186 21187 21188 21189 21190 21191 21192 21193 21194 21195 21196 21197 21198 21199 21200 21201 21202 21203 21204 21205 21206 21207 21208 21209 21210 21211 21212 21213 21214 21215 21216 21217 21218 21219 21220 21221 21222 21223 21224 21225 21226 21227 21228 21229 21230 21231 21232 21233 21234 21235 21236 21237 21238 21239 21240 21241 21242 21243 21244 21245 21246 21247 21248 21249 21250 21251 21252 21253 21254 21255 21256 21257 21258 21259 21260 21261 21262 21263 21264 21265 21266 21267 21268 21269 21270 21271 21272 21273 21274 21275 21276 21277 21278 21279 21280 21281 21282 21283 21284 21285 21286 21287 21288 21289 21290 21291 21292 21293 21294 21295 21296 21297 21298 21299 21300 21301 21302 21303 21304 21305 21306 21307 21308 21309 21310 21311 21312 21313 21314 21315 21316 21317 21318 21319 21320 21321 21322 21323 21324 21325 21326 21327 21328 21329 21330 21331 21332 21333 21334 21335 21336 21337 21338 21339 21340 21341 21342 21343 21344 21345 21346 21347 21348 21349 21350 21351 21352 21353 21354 21355 21356 21357 21358 21359 21360 21361 21362 21363 21364 21365 21366 21367 21368 21369 21370 21371 21372 21373 21374 21375 21376 21377 21378 21379 21380 21381 21382 21383 21384 21385 21386 21387 21388 21389 21390 21391 21392 21393 21394 21395 21396 21397 21398 21399 21400 21401 21402 21403 21404 21405 21406 21407 21408 21409 21410 21411 21412 21413 21414 21415 21416 21417 21418 21419 21420 21421 21422 21423 21424 21425 21426 21427 21428 21429 21430 21431 21432 21433 21434 21435 21436 21437 21438 21439 21440 21441 21442 21443 21444 21445 21446 21447 21448 21449 21450 21451 21452
|
# Olexandr Pylypchuk <pilipchukap@rambler.ru>, 2016, 2017.
# admin <lxlalexlxl@ukr.net>, 2017, 2018, 2019.
msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2018-11-14 21:51+0200\n"
"Last-Translator: Olexandr Pylypchuk <lxlalexlxl@ukr.net>\n"
"Language-Team: Ukrainian <trans-uk@lists.fedoraproject.org>\n"
"Language: uk\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Generator: Lokalize 2.0\n"
"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n"
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr "Виберіть групи"
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr "Виберіть групи для вимкнення при задіянні точки зупинки"
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr "Виберіть групи для ввімкнення при задіянні точки зупинки"
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr "Деякі групи в списку ввімкнення/вимкнення не існують.%0:sСтворити їх?%0:s%0:s%1:s"
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
msgid "Address Breakpoint %s"
msgstr "Точка зупинки за адресою %s"
#: lazarusidestrconsts.dbgeventbreakataddress
msgid "at $%s"
msgstr "в $%s"
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
msgid "at $%s: from origin %s line %d"
msgstr "в $%s: від початку %s рядок %d"
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
msgid "at $%s: %s line %d"
msgstr "в $%s: %s рядок %d"
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
msgid "Source Breakpoint %s"
msgstr "Точка зупинки в коді %s"
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
msgid "Unknown Breakpoint %s"
msgstr "Невідома точка зупинки %s"
#: lazarusidestrconsts.dbgeventbreakwatchpoint
msgid "Watchpoint %s"
msgstr "Точка спостереження %s"
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
msgid "Unknown Watchpoint out of scope %s"
msgstr "Невідома точка спостереження поза областю дії %s"
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Невідому точку спостереження перемкнуто %s. Старе значення \"%s\", нове значення \"%s\""
#: lazarusidestrconsts.dbgeventwatchscopeended
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr "Точка спостереження для \"%s\" поза областю дії %s"
#: lazarusidestrconsts.dbgeventwatchtriggered
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Точку спостереження для \"%s\" перемкнуто %s. Старе значення \"%s\", нове значення \"%s\""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Попередньо визначена схема"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Скинути всі налашування"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Скинути всі налаштування смужки"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Скинути всі текстові налашування"
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Додати точку історії"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Контекстне меню"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Контекстне меню (зневадження)"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Контекстне меню (вкладка)"
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Стрибає до реалізації"
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Стрибає до кінця блока реалізації/іншого"
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Назад по історії"
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Вперед по історії"
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr "Перемкнути додатковий курсор"
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Нічого/Типово"
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Вставити"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Продовжити %0:s (Пов'язано з: %1:s)"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr "Продовжити %0:s"
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Вибрати текст"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Вибрати текст (рядки)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Вибрати текст (елементи)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Вибрати текст (слова)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Вибрати текст (стовпці)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Вибрати текст (рядки)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Встановити вільну закладку"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Вибрати поточний Рядок (увесь)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Вибрати поточний Рядок (текст)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Вибрати поточний абзац"
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Вибрати поточне слово"
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Скинути масштаб"
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Ця сторінка не показує ваші поточні налаштування. Див. сторінку з додатковими параметрами. Використовуйте цю сторінку для скидання будь-яких змін"
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Загальне"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Стандартне, всі дії (точка зупинки, згортання) при натисканні кнопки миші"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Розширене, дії - при відпуск. кнопки миші. Вибирання - при натиск. і переміщ."
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr "Розширене, дії - праворуч від смужки"
#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr "Використати номери рядків для вибору рядків"
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Смужка"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right button click includes caret move"
msgstr "Переміщувати курсор клацанням правою кнопкою миші"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Текст"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl Колесо"
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt Колесо"
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Ctrl Колесо"
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Копіювати/Вставляти перетягуванням"
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Extra-1 Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Extra-2 Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt Подвійне"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl Подвійне"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Подвійний"
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Shift Подвійне"
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Почетвірний"
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Потрійний"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Середня кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Середня"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Екстра 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Екстра 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Ліва 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Ліва 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Справа"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Колесо"
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Права Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Shift-Alt-Ctrl Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Shift-Alt-Ctrl"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Shift-Alt Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Shift-Alt Колесо"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Shift-Ctrl Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Shift-Ctrl Колесо"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Shift Кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Колесо"
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Shift Колесо"
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Ви маєте незбережені зміни. Використання цієї сторінки скине зміни на сторінці розширених параметрів"
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Прокрутка горизонтально (Системна швидкість)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Прокрутка горизонтально (Один рядок)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Прокрутка горизонтально (Сторінка)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Прокрутка горизонтально (півсторінки)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Прокрутка горизонтально (Сторінка, менше рядка)"
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Нічого/Типово"
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Прокрутка (Системна швидкість)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Прокрутка (Один рядок)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Прокрутка (Сторінка)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Прокрутка (півсторінки)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Прокрутка (Сторінка, менше рядка)"
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Масштаб"
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Немає >"
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Лише для читання"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Нижній регістр, з великої букви"
#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr "активний"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Додавати оператор присвоєння :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Підсвічування дужок"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Дерево згортань коду"
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Текст за замовчуванням"
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr "Типовий текст / вікно"
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Вимкнена точка зупинки"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Ввімкнена точка зупинки"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Рядок з помилкою"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Точка виконання"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Маркер згорнутого коду"
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr "Рядок початку згорнутого блока"
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Глобально"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Смужка"
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Рядок"
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr "Кольори структури"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Синхронне редагування"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Редагування шаблона"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Текст"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Роздільна смужка"
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr "Рядок початку прихованого блока"
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Інкрементальні інші"
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr "Підсвітити префікс"
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Підсвічувати поточне слово"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Інкрементальний пошук"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Неправильна точка зупинки"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Підсвітка поточного рядка"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Номер рядка"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Змінений рядок"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Посилання при наведенні мишки"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
msgid "Level 10"
msgstr "Рівень 10"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
msgid "Level 1"
msgstr "Рівень 1"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
msgid "Level 2"
msgstr "Рівень 2"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
msgid "Level 3"
msgstr "Рівень 3"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
msgid "Level 4"
msgstr "Рівень 4"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
msgid "Level 5"
msgstr "Рівень 5"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
msgid "Level 6"
msgstr "Рівень 6"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
msgid "Level 7"
msgstr "Рівень 7"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
msgid "Level 8"
msgstr "Рівень 8"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
msgid "Level 9"
msgstr "Рівень 9"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Вибрана ділянка"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Активна комірка"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Інші комірки"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Синхронізовані комірки"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Активна комірка"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Інші комірки"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Синхронізовані комірки"
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Текстовий блок"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Невідома точка зупинки"
#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr "Межа вікна"
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Квадратні дужки"
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Візуалізація спеціальних символів"
#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr "Додати новий режим"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Додавати символ 'крапка з комою'"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Вирівняти верхній рядок за рахунок коментаря попереду"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "За алфавітом"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always keep caret in visible area of editor"
msgstr "Завжди тримати курсор у видимій ділянці редактора"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Двозначна дія з файлом:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Попередж. при компіляції"
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr "Перед повідомленням про помилку/попередженням/підказкою є значок. Такий самий значок з'являється на смужці у Редакторі коду."
#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr "Ansi (* *)"
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Параметри застосунку"
#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Включити assert-код"
#: lazarusidestrconsts.dlgassociateddebugdesktop
msgid "Associated debug desktop"
msgstr "Пов'язана стільниця зневадження"
#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr "Якщо вибрати стільницю, пов'язана стільниця зневадження також буде вибрана."
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Автостворювані форми:"
#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr "Кожна форма створюється у головному модулі .lpr викликом Application.CreateForm(). Вивільняють пам'ять вони теж автоматично."
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "Auto-create new forms"
msgstr "Створювати нові форми автоматично"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Автом. видалити файл"
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Автоматично показувати прототипи функцій"
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse pointer when typing"
msgstr "Сховати вказівник миші при наборі тексту"
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Автоматичний відступ"
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Задати розумні відступи)"
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Автоматичний відступ"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Автом. видаляти порожні методи"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Автоперейменування у нижній регістр"
#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr "Автоматично зберігати активну стільницю"
#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end\n"
msgstr ""
"Зберегти активну стільницю при закриванні ІСР\n"
"Зберегти стільницю зневадження при закриванні ІСР і при завершенні зневадження\n"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Доступні форми:"
#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr "Ці форми мають створюватись і вивільняти пам'ять програмним шляхом."
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr "Уникати зайвих переходів"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Тло"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(немає підтеки)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Та ж сама назва (в підтеці)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Після методів"
#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Вибране"
#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr "Відступ блока (пробіли)"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Відступ блока"
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(змінити клавіші)"
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Пробіл/Таб як у попередньому рядку"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Лише позиція"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Пробіли"
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "Таби, обрізати"
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Таби, потім пробіли"
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Відступ блока (таби)"
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgstr "Зазор можна встановити у редакторі прив'язок. Якщо зазор > 0, виводиться червона лінія."
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Підсвічування дужок"
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket and quote pairs"
msgstr "Підбір пар дужок і лапок"
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr "Неможливо використати стільницю зі стикуванням в оточенні без стикування, і навпаки."
#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Multi/2nd (NotXor)"
msgstr "Декілька/2-й (NotXor)"
#: lazarusidestrconsts.dlgcaretcolor
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret"
msgstr "Курсор"
#: lazarusidestrconsts.dlgcaretforecolor
msgid "Color (NotXor)"
msgstr "Колір (NotXor)"
#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr "Каретка (текстовий курсор)"
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Враховувати регістр"
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Перевіряю параметри компілятора"
#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr "знайдено втрачений файл: %s"
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Результати"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Тест"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Тест: перевіряю компілятор ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Тест: перевіряю конфігурацію компілятора ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Тест: перевіряю дату компілятора ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Тест: компілюю порожній файл ..."
#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr "Тест: перевіряю модулі RTL ..."
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Тест: перевіряю сирці за шляхами пошуку fpc ppu ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Тест: компілюю порожній файл"
#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr "використовую файл конфігурації %s"
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Порядок класів"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Остання"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "нижній регістр"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Попередній перегляд (max довжина=1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Префікс READ"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Постфікс STORED"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "ВЕРХНІЙ РЕГІСТР"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Префікс змінної"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Префікс WRITE"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Зберегти як - автоперейменування Pascal-файлів у нижній регістр"
#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Перевірка і автозапис файлів"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Перевірити пакунки при створенні форми"
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr "Формі для роботи може знадобитись пакунок. Встановити такий пакунок автоматично."
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Виберіть файл шаблонів коду (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Кнопки закриття в записнику"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Кольорова схема"
#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "Макроси стилю C (глобально)"
#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Використовувати рядки ansistring"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Стиль асемблера"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Повідомлення"
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Перевірки і умови"
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Команди компілятора"
#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Оператори стилю C (*=, +=, /= and -=)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Створити Makefile"
#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Зневадження"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Додавання до шляхів зневаджувача (немає):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Створення коду"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Обидва"
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Згорнути"
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Сховати"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Зворотний порядок згортання в спливному меню"
#: lazarusidestrconsts.dlgcogdb
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "Створити інформацію для GDB (повільніше / збільшує розмір exe)"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Використати модуль Heaptrc (перевіряє витоки пам'яті)"
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Включені файли (-Fi):"
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr "Інформація для GDB"
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Бібліотеки (-Fl)"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Компонування"
#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Параметри компілятора можна зберегти до файлу XML."
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Колір"
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Змінити колір)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Не змінено"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Кольори"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Параметри командного рядка (без назви застосунку)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr "Найбільший відступ нового рядка, якщо префікс прив'язаний до початку першого рядка коментаря:"
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Обмежити відступ"
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Додавати префікс у новий рядок коментаря"
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Відповідність поточному рядку"
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "Відповідність тексту включно з \"*\" з позначки \"(*\""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "Відповідність цілому рядку"
#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr "Відповідність тексту після елемента \"%s\""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr "Відповідність тексту включно з елементом \"%s\""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Префікс нового рядка"
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Вирівняти префікс за відступом попереднього рядка"
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "Вирівняти префікс за початком коментаря у першому рядку"
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "Не робити відступ префікса"
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments and Strings"
msgstr "Коментарі і рядки"
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend if matched or not matched"
msgstr "Розширювати у будь-якому разі"
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend if matched or not matched (not at EOL)"
msgstr "Розширювати, якщо курсор не в кінці рядка"
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend if matched"
msgstr "Розширювати за відповідності"
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr "Розширювати, якщо є відповідність і курсор не в кінці рядка"
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Компіляція і компонування"
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Повідомлення компілятора"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "Мовний файл повідомлень компілятора (*.msg)"
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Параметри компілятора"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Завершити властивості"
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr "Спочатку компонент під вказівником вибирається, і лише потім на ньому діють команди контекстного меню."
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Конфігурація і ціль"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Файли налаштувань"
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Інша зневаджувальна інформація"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Переповнення"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Обробка"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Копіювати/Вставляти зі згорненням"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy current word when no selection exists"
msgstr "Копіювати поточне слово якщо нічого не вибрано"
#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Діапазон"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Переміщуваний"
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Зробити параметри компілятора типовими"
#: lazarusidestrconsts.dlgcoshowerr
msgid "Show errors"
msgstr "Показувати помилки"
#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "По&казати параметри"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Розумне компонування"
#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Інші сирці (.pp/.pas-файли, що використовуються ІСР, але не компілятором)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Стек"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Вирізати символи з виконуваного файлу"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Тип даних зневадження"
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Автоматично"
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr "Dwarf2"
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr "Dwarf з наборами"
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr "Dwarf3 (бета)"
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Удари"
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Засмітити змінні"
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Стиль модуля"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Створити код для valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Подробиці виводу"
#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "INLINE стилю C++"
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr "Створити новий набір параметрів запуску"
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "Натискання Ctrl-Середня кнопка на вкладці закриває інші"
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Фігурні { }"
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr "Наразі впливає на вікно повідомлень, історію переходів і результатів пошуку."
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Курсор за межею рядка"
#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr "Курсор вліво/вправо знімає вибір (без зміщення)"
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Caret skips selection"
msgstr "Курсор пропускає вибране"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Caret skips tabs"
msgstr "Курсор пропускає Таби"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Розширення користувача (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr "зневадити"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Редактор шляху"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Тип зневаджувача і шлях"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Типовий шрифт редактора"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Типове значення"
#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr "Видалити режим"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Видалити шаблон "
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Кнопки - "
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Підказки"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Меню - "
#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr "Назва стільниці"
#: lazarusidestrconsts.dlgdesktopsexported
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr "%d стільниця(ь) успішно експортовано до \"%s\""
#: lazarusidestrconsts.dlgdesktopsimported
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr "%d стільниця(ь) успішно імпортовано з \"%s\""
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr "Тло відмінних значень"
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Напрямок"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Вимкнути згладжування"
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr "Відстань між точками сітки - це найменший крок при переміщенні елемента керування."
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Використовувати колір правої межі"
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Малювати рівень роздільника"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Колір вкладеного рядка"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Колір лінії"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Початок/Кінець"
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Процедура/Функція"
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (локальні)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Секції модуля"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Вираз Uses"
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (локальні)"
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr "Писати під компонентом його назву."
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Назад"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Жирний"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Підтека"
#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Кодові шаблони"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Додавати до блоків Pascal завершення інструкцій"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Розшир. користувача"
#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(%s сек затримка)"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Показати"
#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Файли редактора"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Завершення ідентифікаторів"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Інвертувати"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Знехтувати фіксуванням, використати найдавніше використовуваний редактор"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Знехтувати фіксуванням, якщо редактор є поточним"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Знехтувати фіксуванням якщо редактор у поточному вікні"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Заблоковано, якщо тест в області перегляду"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Розблоковано"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Розблоковано, якщо текст в центрі області перегляду"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Нова вкладка, наявне або нове вікно"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Нова вкладка в новому вікні"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Нова вкладка в наявному вікні"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Опція вибирає найдовше не використовуваний редактор для файлу, навіть якщо він заблокований і/або потребує прокрутки. При цьому не враховується порядок переведення фокусу у вікна, навіть якщо вибрано параметр \"той самий порядок критеріїв\". Ця опція завжди працює, наступні за нею не аналізуються."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Опція перевіряє чи поточний активний редактор має цільовий файл. Якщо так то він використає поточний редактор, навіть якщо той заблокований і/або потребує прокрутки."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Опція перевіряє чи існує редактор для цільового файлу в поточному вікні. Якщо так то він використає цей редактор, навіть якщо той заблокований і/або потребує прокрутки."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Опція вибирає заблокований (і лише заблокований) редактор, який не потребує прокрутки для показу цільової точки переходу (вона вже знаходиться в видимій ділянці)."
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Опція вибирає будь-який не заблокований редактор."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Опція вибирає незаблокований редактор, якому не потрібна прокрутка для показу цільової точки переходу (вона вже знаходиться в центрі ділянки перегляду, виключаючи 2-5 рядків зверху і знизу)."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Опція відкриває нову вкладку в наявному або новому вікні, якщо не знайдено незаблокованої вкладки. Опція завжди спрацює, наступні за нею не перевіряються."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Якщо не знайдено незаблокованої вкладки, використання цієї опції призводить до відкриття нової вкладки в новому вікні (навіть якщо для цього можуть бути використані наявні вікна). Опція завжди спрацює, наступні за нею не перевіряються."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr "Якщо не знайдено незаблокованої вкладки, використання цієї опції призводить до відкриття нової вкладки в наявному (і лише в наявному) вікні. Вкладка відкривається лише за наявності вікна, що не має редактора для цільового файлу."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Курсив"
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Розмір шрифту редактора"
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Налаштування редактора"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Глобальні параметри схеми"
#: lazarusidestrconsts.dlgedmisc
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Різне"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Вимкн."
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Увімкн."
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Таби і відступи"
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Підкреслений"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Атрибути елемента"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "End переводить до найближчого кінця"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Запитати"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Зауваження: Файлами проекту є всі файли у теці проекту"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Резервування"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Файли"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Сітка"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Мова"
#: lazarusidestrconsts.dlgenvlanguagehint
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
msgstr "Мова всіх рядків ІСР. Краще після зміни перезапустити ІСР."
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Лінійки допомоги"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Різне"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Відсутнє"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Інші Файли"
#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Вкладки для проекту"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Тип"
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr "Фокусувати при компіляції на вікні повідомлень"
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra character spacing"
msgstr "Додатковий міжсимвольний інтервал"
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Міжрядковий інтервал"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Використати зовнішній файл зневаджувальних символів gdb"
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Файлові розширення"
#: lazarusidestrconsts.dlgfiles
msgid "%s files"
msgstr "%s файлів"
#: lazarusidestrconsts.dlgfilterall
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Всі файли"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr "Файл шаблона CodeTools"
#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr "Файл DCI"
#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr "Форма Delphi"
#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Пакунок Delphi"
#: lazarusidestrconsts.dlgfilterdelphiproject
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Проект Delphi"
#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Модуль Delphi"
#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr "Виконуваний"
#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr "Файл повідомлень FPC"
#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr "Файли HTML"
#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr "Зображення Bitmap"
#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr "Зображення Pixmap"
#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr "Зображення PNG"
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Налаштування стільниці Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "Типи файлів Редактора"
#: lazarusidestrconsts.dlgfilterlazarusfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Файл Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusform
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Форма Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusinclude
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Lazarus-файли для включення"
#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Інші файли Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruspackage
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Пакунок Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusproject
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Проект Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Сирець проекту Lazarus"
#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr "Сеанс Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusunit
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Модуль Lazarus"
#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "Файл Pascal"
#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Програми"
#: lazarusidestrconsts.dlgfilterxml
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "Файли XML"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Знайти текст під курсором"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Шматок"
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Вибір шматка"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Коментар"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Вузол"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Елемент"
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Список <>"
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Об'єкт (успадкований, вбудований)"
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (локальні)"
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Коментар (* *)"
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (вкладені)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Коментар { }"
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"
#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr "For/Do"
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "If/Then/Else"
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Вкладений Коментар"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (процедура)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Процедура"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Програма"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Повторити"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Коментар //"
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Модуль"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Секції модуля"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (глобальні)"
#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr "While/Do"
#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr "With/Do"
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Коментар"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Вузол"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Інструкція Обробки"
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr "Примусове масштабування ТНД в режимі розробки"
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr "Якщо позначено, параметри масштабування проекту будуть знехтувані - братимуться до уваги тільки властивості Scaled форми/рамки/модуля даних"
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr "Запущений примірник Lazarus не має доступу до жодних файлів."
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Колір переднього плану"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr "Змінювати вміст Інспектора об'єктів при клацанні заголовка форми"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr "Показувати в Інспекторі об'єктів властивості форми при клацанні її заголовка."
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Політика вставки процедур"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Залишати порядок процедур"
#: lazarusidestrconsts.dlgfpcexecutable
msgid "Compiler executable (e.g. %s)"
msgstr "Виконуваний файл компілятора (наприклад, %s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Тека сирців FPC"
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Відмітка"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Редактор форм"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "З по&чатку"
#: lazarusidestrconsts.dlgfromcursor
msgid "&From cursor"
msgstr "&Від курсору"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Глобально"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Створити код для gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Маркери вибірки"
#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr "Сірим позначено стільниці для оточення зі стикуванням."
#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr "Сірим позначено стільниці для оточення без стикування."
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Колір сітки"
#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr "Сітка складається з крапочок, які допомагають вирівнювати елементи керування."
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Розмір сітки за X"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Крок сітки по горизонталі"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Розмір сітки за Y"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Вертикальний крок сітки"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Дослідник коду"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Codetools"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Зневаджувач"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Редактор"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Середовище"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Груповий відкот"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Показувати лінійки"
#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr "Коли елемент керування вирівняно по горизонталі чи по вертикалі з іншим, з'являється синя напрямна лінія."
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Смужка"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Згорнуто"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Колір смужки"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Колір краю смужки"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Номер роздільника на смужці"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Прокрутка на півсторінки"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Розміри купи і стеку"
#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Розмір купи"
#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr "Висота однієї властивості на сітці."
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Висота:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Приховати вікна ІСР при пуску"
#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr "Зовсім не показувати ІСР при запущеній програмі."
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Ховати заголовок одиничної вкладки"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Підсвічувати Колір"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Підсвічувати Колір Шрифту"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Caret"
msgstr "Ліворуч від курсора"
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Caret"
msgstr "Праворуч від курсора"
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Показ порад до параметру \"Відправник\" не використаний"
#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Підказки для непотрібних модулів в головному коді"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home переводить до найближчого старту"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Основний застосунок"
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Завершення ідентифікаторів"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Політика ідентифікаторів"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Параметри ІСР"
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "Активний код $IFDEF"
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "Неактивний код $IFDEF"
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "Умовно активний код, що підключається в $IFDEF"
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Активний вузол $IFDEF"
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Неактивний вузол $IFDEF"
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "Включений умовно активний вузол $IFDEF"
#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:\n"
msgstr ""
"Стільниця з такою назвою вже існує.\n"
"Підтвердьте назву стільниці:\n"
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr "Включити ідентифікатори, що містять префікс"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Включити системні змінні"
#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr "Включити слова"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr "не включати"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr "зі всіх модулів"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr "з поточного модуля"
#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr "Відступ"
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr "Таби"
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Перед методами"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Конструктор має бути 'init' (деструктор має бути 'done')"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Вставити частини класу"
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Implementation"
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Interface"
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr "Вставити реалізацію методів"
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Вставити в секцію Uses в"
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Вставляти пробіл після"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Вставляти пробіл перед"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Інтервал у сек"
#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr "Вертикальна позиція для переходу на блок коду в % (0=вгорі, 100=внизу)"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Перехід (наприклад, перехід на метод)"
#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr "Вертикальна позиція для переходу на один рядок у % (0=вгорі, 100=внизу)"
#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr "Переходити прямо до тіла методу"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep caret X position when navigating up/down"
msgstr "Зберігати позицію курсора по осі X при навігації вгору/вниз"
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Змінити клавіші)"
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Клавіші"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Помилки комбінацій клавіш"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Політика ключових слів"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Дозволити LABEL і GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Мова"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Останній (напр. в кінці коду)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Тека Lazarus (за замовчуванням для всіх проектів)"
#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Напрямні: ліва, верхня"
#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly)"
msgstr "1 (швидко та дружньо до зневаджувача)"
#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (Рівень 1 + швидкі оптимізації)"
#: lazarusidestrconsts.dlglevel3opt
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (Рівень 2 + повільні оптимізації)"
#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr "4 (Рівень 3 + агресивні оптимізації, обережно)"
#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization)"
msgstr " 0 (без оптимізації)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Розривання рядків"
#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Розумне компонування"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Вивести номери рядків у помилках часу виконання"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Головне меню"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Показати форми проекту"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Показати фрейми проекту"
#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Показувати Модулі Проекту"
#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "Виконуваний файл \"Make\""
#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr "Керування стільницями"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Межі і смужка"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Маркери"
#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr "Вертикальна позначка"
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight all occurrences of Word under Caret"
msgstr "Підсвітка всіх входжень слова під курсором"
#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr "Контур (глобально)"
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr "Попередження: кольори для вибраної мови не налаштовано"
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Користувацька розмітка"
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Вилучити"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr "Вилучити список \"%s\"?"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr "Додати слово або термін"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr "Вилучити слово або термін"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr "Перемкнути слово або термін"
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Дублювати термін"
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "Термін %s вже існує. При збереженні списку дублі буде вилучено."
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Додати/вилучити у всіх редакторах"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Видалити список"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Назва"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Додати список"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Враховувати регістр"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Встановити межу в кінці терму"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Встановити межу на початку терму"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Нехтувати межі термів довших, ніж"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "вибране"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "поточне слово"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Параметри термів, доданих клавішами"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "Розумні межі вибору відповідності"
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Новий список"
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "Немає списків"
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Виберіть ..."
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr "Параметри клавіш"
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Головні параметри"
#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr "Операторні дужки біля курсора (глобально)"
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match whole words, if length is less or equal to:"
msgstr "Відповідність цілого слова для слів не довших, ніж:"
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Знехтувати ключові слова"
#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable timer for markup current word"
msgstr "Вимкнути таймер для підсвітки поточного слова"
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Обрізати пробіли (при підсвічуванні поточного вибору)"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Максимум лічильника"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Найбільша довжина рядка:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Максимум останніх файлів"
#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr "Значення 0 означає необмежено."
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Максимум останніх файлів проектів"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Змішування методів і властивостей"
#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr "Режим"
#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Дія мишею"
#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Одинарний"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Подвійний"
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Потрійний"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Почетвірний"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Будь-який"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Екстра 1"
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Екстра 2"
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Ліворуч"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Середина"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Зробити відкот"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Справа"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Колесо вниз"
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Колесо вверх"
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Захоплення"
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Перемістити курсор (додатково)"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "При відпусканні кнопки"
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Дія"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Клацання"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Параметри Мишки"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Дублювати Запис"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Цей елемент суперечить вже наявному"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Кнопка"
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr "Каретка"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Контекст"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Клацання"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Дія"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Вверх/Вниз"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Параметр"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Порядок"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Пріоритет"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Мишка"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Розширені"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Команда ІСР"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Всі"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Смужка"
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr "Маркери змін"
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Згорнути дерево"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Згорнуто [+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Розгорнуто [-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr "Огляд"
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr "Мітка огляду"
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Номери Рядів"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Текст"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Вибране"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Опц"
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Інші дії з використанням тієї ж кнопки"
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Вони можуть бути виконані в залежності від натискання клавіш-модифікаторів, параметрів провалювання, Один/Два натискання, Вверх/Вниз ..."
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Фільтрувати клавіші-модифікатори"
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Пріоритет"
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Повідомлення"
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Зневадження"
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Помилка"
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr "Фатальна помилка"
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "Підказка"
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr "Важливо"
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr "Звичайне"
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr "Зауваження"
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr "Паніка"
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr "Час і статистика"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr "Детально"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr "Детально 2"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr "Детально 3"
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Попередження"
#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr "Клавіші навігації рухають всі курсори (при виборі стовпця)"
#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr "Пропускати клавішу Delete в кінці рядка (не об'єднувати рядків)"
#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr "Декілька курсорів"
#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr "Клавіші навігації рухають всі курсори"
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr "Увімкнути декілька курсорів для вибору стовпців"
#: lazarusidestrconsts.dlgmultipleinstances
msgid "Multiple Lazarus instances"
msgstr "Декілька примірників Lazarus"
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr "завжди запускати новий примірник"
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr "не допускати декількох примірників"
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr "відкривати файли у запущеному примірнику"
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Множинний вибір"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Jump target priority between multiple editors"
msgstr "Пріоритет цілей переходу між декількома редакторами"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Порядок використання редакторів, що відповідають однаковим критеріям"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Останній вибраний редактор для даного файлу"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Редактор (для файлу) в останньому вибраному вікні"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Список критеріїв вибору редактора за пріоритетом:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Сторінки та вікна"
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Вкладки Блокноту"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Надання назви"
#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr "Нова стільниця ..."
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Без автоперейменування"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Немає наявних модулів щоб додати."
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Без підсвічування"
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Початкове положення вкладок блокноту"
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Не розривати рядок після"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Не розривати рядок перед"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Інспектор об'єктів"
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height (0 = auto)"
msgstr "Висота елемента (0 = автоматично)"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Різне"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Параметри Швидкості"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Викор. типові параметри Delphi"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Викор. типові параметри Lazarus"
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Рівні оптимізації"
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Інші оптимізації"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Інші файли модулів (-Fu):"
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Переписати блок"
#: lazarusidestrconsts.dlgoverwritedesktop
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?\n"
msgstr ""
"Знайдено стільницю з назвою \"%s\".\n"
"Перезаписати стару стільницю?\n"
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Підказки до палітри компонентів"
#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Стандартне розширення Pascal"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Підсвічувати оператори управління як ключові слова"
#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr "Розширені Параметри Ключових слів Паскаля"
#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr "Підсвічувати (біля курсору)"
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Відповідні ключові слова"
#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr "Контур"
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Передати параметри компонувальнику з \"-k\", розділивши пробілами"
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr "Підсвічувати ключові слова \"String\""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Типово"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Відсутнє"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Лише \"String\""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Постійний блок"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Visible caret in unfocused editor"
msgstr "Показувати курсор, якщо редактор не у фокусі"
#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr "Курсор, якщо редактор не у фокусі, не блимає"
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Застосунок"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "як викликач (asInvoker)"
#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "&Очистити значок"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Створити пакет застосунків"
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Завантажити &типові"
#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr "Підтримка ТНД"
#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr "вимкнути"
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr "Vista-8: вимкн., 8.1+: на монітор"
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr "Vista-8: увімкн., 8.1+: на монітор"
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr "Vista-8: увімкн., 8.1/10+: на монітор/V2"
#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr "увімкнути"
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Рівень виконання"
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Форми"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "найвищий доступний (highestAvailable)"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Значок:"
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(розмір: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(немає)"
#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "&Завантажити значок"
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Різне"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "потрібен адміністратор (requireAdministrator)"
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Ресурси"
#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "&Зберегти значок"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Сесія"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Заголовок:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "Доступ UI (uiAccess)"
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr "Використовувати пакет застосунків для запуску і зневадження"
#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr "Використати масштабування LCL (Hi-DPI)"
#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest resource (and enable themes)"
msgstr "Використати manifest-ресурс (і увімкнути теми)"
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Перевага подвійного клацання над одинарним"
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Пріоритети"
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Проект"
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Параметри проекту"
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Параметри для Проекту: %s"
#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Файли проекту"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "Пи&тати при заміні"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Розширення властивості"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Назва властивості"
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project and packages at start"
msgstr "При старті відкрити останній проект і пакунки"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Показувати ширину бордюру"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Показувати сітку"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Прилипання до сітки"
#: lazarusidestrconsts.dlgreallydeletedesktop
msgid "Really delete desktop \"%s\"?"
msgstr "Справді видалити стільницю \"%s\"?"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Посилання"
#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "&Регулярні вирази"
#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr "Перейменувати стільницю"
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Замінити &всі"
#: lazarusidestrconsts.dlgreplacewith
msgid "Replace wit&h"
msgstr "&Замінити на"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Звіт"
#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Напрямні: права, нижня"
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Вибір правим клацанням"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Праве поле"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Робоча тека"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Вибрати онуків"
#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Створення гумки"
#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Вибір гумки"
#: lazarusidestrconsts.dlgrunninginstancemodalerror
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s\n"
msgstr ""
"Запущений примірник Lazarus немає доступу до файлів.\n"
"Відкрити їх у новому примірнику ІСР?\n"
"\n"
"%s\n"
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr "Примірник Lazarus працює, але не відповідає."
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Дисплей (не для win32, напр., 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Середовище"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Локальні"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Системні змінні"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Використовувати дисплей"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Користувацькі перекриття"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Параметри виконання"
#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr "Зберегти поточну стільницю як"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Збережений рядок"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Зберігати відомості про закриті файли"
#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr "Файли доступні у списку історії \"Відкрити недавні\"."
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Зберігати відомості тільки про файли проекту"
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr "Лише файли, що належать до цього проекту."
#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr "Зберегти в"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Прокрутити на один вниз"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Прокрутка"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Показ підказки при прокрутці"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Прокрутити до кінця файлу"
#: lazarusidestrconsts.dlgscrollpastendline
msgid "Allow caret to move past end of line"
msgstr "Дозволити курсору рухатися після кінця рядка"
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Тека пошуку \"%s\" не знайдена."
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Пошук перервано користувачем."
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Пошук ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Шляхи"
#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr "Область пошуку"
#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr "Вибирати дочірні елементи керування разом з предком"
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "&Вибраний текст"
#: lazarusidestrconsts.dlgsetactivedesktop
msgid "Set active"
msgstr "Зробити активним"
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Встановити всі елементи за замовчуванням"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Встановити елемент за замовчуванням"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Встановити змінну властивості"
#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr "Назва параметра для типової процедури встановлення значення властивості."
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr "є префіксом"
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr "Якщо позначено, \"Set property Variable\" є префіксом. Інакше - це фіксована назва."
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr "використати const"
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr "Якщо позначено, параметри процедури встановлення значення властивості позначаються \"const\"."
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Показати всі модулі"
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of nonvisual components"
msgstr "Показувати підписи невізуальних компонентів"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Показувати скомпільовані процедури"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Показувати номери рядків"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Показувати умови"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Показувати зневаджувальну інф-ю"
#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Показувати підказки дизайнера"
#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr "Підказка показує позицію або розміри елемента керування при його переміщенні чи зміненні розмірів."
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Показувати всі"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Показувати відомості про exe (для Win32)"
#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr "Показувати назву файлу у заголовку"
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Показувати загальні відомості"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Показувати підказки для смужки"
#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Показувати підказки"
#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr "Показ вікон"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Показувати номери рядків"
#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr "Показувати значки повідомлень"
#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Показувати зауваження"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Показувати підсумкове"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Показувати випробувальні файли"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Показувати використані файли"
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Показувати попередження"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Показувати одну кнопку на панелі завдань"
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Пропускати попередні оголошення класів"
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Коса риска //"
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Розумна табуляція"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Символ позаду (.~pp)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Лічильник (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Символ попереду (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Прилипання до напрямних"
#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr "Коли елемент керування майже порівнявся з іншим, він прилипає до позиції вирівнювання."
#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr "Багаторядковий список вкладок"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Пробіл"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Підказки до командних кнопок (відкрити, зберегти тощо)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Редактор коду"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Походження"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Розмір стеку"
#: lazarusidestrconsts.dlgstatickeyword
msgid "Static keyword in objects"
msgstr "Ключове слово Static в об'єктах"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Завершити після стількох помилок:"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Додати текст для закриття рядка"
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Префікс нового рядка"
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "Рядок ''"
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Додавати новий рядок при розриві поточного"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Вкладені Властивості"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Параметри синтаксису"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "ТАБ зсуває блоки вправо"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Показувати номери вкладок у блокноті"
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "ТАБ у пробіли"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Ширина ТАБа"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Сімейство цільового ЦП"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Цільова ОС"
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Платформа"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Цільовий процесор"
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Параметри для цілі"
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Тека для збирання пробних проектів"
#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr "Стиль тексту"
#: lazarusidestrconsts.dlgtexttofind
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "&Текст для пошуку"
#: lazarusidestrconsts.dlgtoggledebugdesktop
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
msgid "Toggle as debug desktop"
msgstr "Перемкнути як стільницю зневадження"
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Підказка поточного класу/процесу"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Стиль обрізання пробілів"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Курсор або редагування"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Змінений рядок"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Залишити рядок"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Лише позиція"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Обрізати кінцеві пробіли"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Скасування після збереження"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Скасувати / Повернути"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Межа скасувань:"
#: lazarusidestrconsts.dlgunitdepcaption
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "Залежності модуля"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Оновити"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Вихідна тека модулів (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Незбережений рядок"
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Згортання коду"
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Використати додатковий файл налаштувань компілятора"
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Показ роздільника"
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Використати стандартний файл налаштувань (fpc.cfg)"
#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr "Піктограми у вікні завершення коду"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Використовувати застосунок для запуску"
#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr "Системний редактор методу введення"
#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Не вдалося завантажити файл користувацької схеми %s"
#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr "Використовувати (і змінювати) параметри глобальної схеми"
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Використовувати параметри локальної схеми"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Підсвітка синтаксису"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Врахов. історію вкладок при їх закритті"
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Додати модуль у секцію Uses"
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Значення"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Подробиці при компіляції:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Видима смужка"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Видима права межа"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "&Лише цілі слова"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Ширина:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Графічний застосунок Win32"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Вікно"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Винятки"
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Слова"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Попередній перегляд"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "Писати логотип FPC"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Вибрані компоненти мають належати одній формі"
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Вирівняти ..."
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Стерти вибране"
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Віддзеркалити горизонтально"
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Віддзеркалити вертикально"
#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "На один назад"
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "На один вперед"
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Перемістити назад"
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Перемістити наперед"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Скинути ..."
#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Зберегти форму як XML"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Масштабувати ..."
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Масштаб"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Вибрати все"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Розмір ..."
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Розмір"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Параметр: Прилипання до сітки"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Параметр: Прилипання до напрямних"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-порядок"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "На обох сторонах"
#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr "Очистити всі знімки"
#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr "Перемкнути перегляд між знімком та поточним"
#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr "Зробити знімок"
#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr "Ввімкнути/Вимкнути автоматичні знімки"
#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr "Видалити вибраний елемент"
#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr "Переглянути історію"
#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr "Переглянути знімки"
#: lazarusidestrconsts.histdlgcolumnloc
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
msgid "Location"
msgstr "Розміщення"
#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr "Час"
#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr "Історія"
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = немає, 1 = малювати лінії роздільника лише для верхнього рівня, 2 = малювати лінії для перших двох рівнів, ..."
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Додати файли"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Двозначний тип предка"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Двозначна назва класу"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Двозначна назва модуля"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor type"
msgstr "Тип предка"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Модуль Pascal повинен мати розширення .pp або .pas"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Порушення залежностей"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Назва класу вже існує"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Створити новий компонент"
#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create New File"
msgstr "Створити новий файл"
#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr "Створити нову вимогу"
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Залежність"
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr "Тека для файлу модуля:"
#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: \"%s\""
msgstr "Наявний файл: \"%s\""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Файл вже існує"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File \"%s\" already exists in the package."
msgstr "Файл \"%s\" вже є у пакунку."
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Файл вже використовується"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename/URL"
msgstr "Назва файлу/URL"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Файл не є модулем"
#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr "Піктограма 24x24:"
#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr "Піктограма 36x36:"
#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr "Піктограма 48x48:"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Неправильний тип предка"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Неправильна кільцева залежність"
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Неправильна назва класу"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Неправильний файл"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Неправильна назва файлу"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Неправильна назва модуля"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" не є правильною назвою модуля."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Нова назва класу"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Новий файл"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Не знайдено пакунка для залежності \"%s\".%sВиберіть наявний пакунок."
#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr "Пакунок/проект"
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Задовга назва сторінки"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette page:"
msgstr "Сторінка палітри:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Модулі паскаля повинні мати розширення .pp або .pas"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Скоротити або розширити назву файлу"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Показувати всі"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Назва типу предка \"%s\" збігається з%sназвою модуля \"%s\"."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Тип предка \"%s\" є неправильним ідентифікатором Pascal"
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "Назва класу \"%s\" і його предка \"%s\" збігаються."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "Назва класу \"%s\" вже є у%sПакунок %s%sФайл: \"%s\""
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Назва класу \"%s\" збігається з %s назвою модуля \"%s\"."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "Назва класу \"%s\" не є припустимим ідентифікатором Pascal"
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Файл \"%s\" є частиною поточного проекту.%sНе краща ідея ділити файли між проектами і пакунками."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Файл \"%s\" виглядає невизначеним, тому що пакунок не має типової теки.%sВкажіть будь ласка назву файлу з повним шляхом."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Найвища версія \"%s\" некоректна.%sВикористовуйте формат основна.другорядна.реліз.збірка%sНаприклад: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Найвища версія є меншою за найнижчу версію."
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Найнижча версія \"%s\" некоректна.%sВикористовуйте формат основна.другорядна.реліз.збірка%sНаприклад: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Пакунок вже має залежність від пакунка \"%s\""
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "Назва пакунка \"%s\" занадто довга (до 100 симв.)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "Така назва модуля \"%s\" вже є у цьому пакунку:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname \"%s\" already exists in this package."
msgstr "Така назва модуля \"%s\" вже є у цьому пакунку."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "Назва модуля \"%s\"%sі назва файлу \"%s\" різні."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Назва модуля \"%s\" збігається із зареєстрованим компонентом.%sЦе може призвести до непередбачуваних повідомлень про помилки."
#: lazarusidestrconsts.lisa2punitname
msgid "Unit name:"
msgstr "Назва модуля:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Назва модуля вже існує"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Скасувати зміни?"
#: lazarusidestrconsts.lisabort
msgctxt "lazarusidestrconsts.lisabort"
msgid "Abort"
msgstr "Перервати"
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Перервати все"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Перервати всі завантаження"
#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Перервано"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Перервати завантаження проекту"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Повністю перервати завантаження"
#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "Про"
#: lazarusidestrconsts.lisabout2
msgid "About %s"
msgstr "Про %s"
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Документація:"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Про ІСР"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Про проект Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Ліцензія: GPL/LGPL. Див. сирцеві коди Lazarus та Free Pascal для деталей ліцензії.%sLazarus це ІСР для створення графічних та консольних застосунків, написаних на Free Pascal. Free Pascal це компілятор Pascal та Object Pascal, що працює на Windows, Linux, Mac OS X, FreeBSD та інших.%sLazarus є шматком пазлу, якого бракувало, щоб розробляти програми для всіх перелічених платформ у Delphi-подібному оточенні. ІСР - це RAD-інструмент що включає в себе дизайнер форм.%sОскільки Lazarus росте, нам потрібно більше розробників."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Неможливо знайти список авторів"
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Офіційний сайт:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "%s не може містити компоненти TControl.%sУ ньому можна розміщувати тільки невізуальні компоненти."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Подяки"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Дія:"
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Дії:"
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Активувати"
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Активувати синтаксис регулярних виразів для тексту і заміни (майже як в perl)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Активувати вибране"
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Активний"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Активний фільтр"
#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Додати"
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr "Додати роздільник над вибраним елементом"
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr "Додати роздільник під вибраним елементом"
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Додати визначення, що імітують Delphi7"
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Корисно, якщо код містить перевірки підтримуваних версій компілятора"
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr "До pascal-тексту додано відсутній об'єкт \"%s\"."
#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr "Додано властивість \"%s\" для %s."
#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr "Додати -FcUTF8"
#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr "Може знадобитись, якщо сирцеві файли містять не-ansistring літерали."
#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Додати фільтр ..."
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr "Додаток не відповідає поточному повідомленню"
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr "Додаток відповідає поточному повідомленню"
#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr "Додатки"
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "Додати ключове слово \"do\""
#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr "Додати модифікатор \"overload\""
#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr "Додати модифікатор \"override\""
#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr "Додати модифікатор \"reintroduce\""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Додати новий режим збирання, скопіювавши налаштування з \"%s\""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Додати новий макрос"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Додати новий набір"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Додати залежності пакунка?"
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "додати пакунки до списку встановлених пакунків (комбінуйте з --build-ide для перезбирання ІСР)."
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Додати пакунок до проекту"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Додати параметричні дужки"
#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr "Адреса:"
#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr "&Точка зупинки за адресою ..."
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Додати до шляхів пошуку файлів для включення?"
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Додати %s до проекту?"
#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr "Додати до компонентів запуску?"
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Додати до шляхів пошуку модулів?"
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Додати інтерфейси модулів"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Додати модуль (не рекомендовано)"
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Додати значення в макрос %s"
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Додати файл до пакунка"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Пакунок призначення"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Тип файлу"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Неправильний пакунок"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: \"%s\""
msgstr "Неправильний ідентифікатор пакунка: \"%s\""
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Пакунок тільки для читання"
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package \"%s\" not found."
msgstr "Пакунок \"%s\" не знайдено."
#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Показувати всі"
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "Пакунок %s тільки для читання."
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file \"%s\" already exists.%sReplace it?"
msgstr "Файл \"%s\" вже існує.%s Замінити?"
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
msgid "A filter with the name \"%s\" already exists."
msgstr "Фільтр з назвою \"%s\" вже існує."
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Після очищення (очищення всіх або загальних файлів), перейти до чистої автоматично"
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Вирівнювання"
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Всі блоки виглядають правильно."
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Всі режими збирання>"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Всі успадковані параметри"
#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr "Всі параметри"
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Дозволити виклики функцій"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Дозволити пошук для декількох рядків"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Всі параметри у виклику даної функції вже визначені. Додавати нічого."
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "Всі ваші зміни у \"%s\"%sбудуть втрачені і файл відкриється повторно."
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Альфа"
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Альтернативна кнопка"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Альтернативна клавіша (або двоклавішна комбінація)"
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Завжди"
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Завжди конвертувати пропоновану назву файлу в нижній регістр"
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "Завжди зображати вибраний елемент у фокусі"
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Завжди нехтувати"
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Макрос із такою назвою вже існує."
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Знайдено двозначний файл"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Знайдено двозначний файл: \"%s\"%sЙого можна сплутати з \"%s\"%sВидалити цей файл?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Знайдено двозначні файли"
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous unit found"
msgstr "Знайдено двозначний модуль"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Якорити нижній край до нижнього краю брата. Використовуйте BorderSpacing, щоб задати відстань. BorderSpacing брата нехтується."
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Якорити нижній край до верхнього краю брата. Відстань задається властивостями BorderSpacing цього елемента і брата."
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Редактор якорів - не вибрано елемент керування"
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Ввімкнено = Включити %s в якорі"
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Якорити лівий край до лівого краю брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата нехтується."
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Якорити лівий край до правого краю брата. Відстань задається властивостями BorderSpacing цього елемента і брата."
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Якорити правий край до лівого краю брата. Відстань задається властивостями BorderSpacing цього елемента і брата."
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Якорити правий край до правого краю брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата нехтується."
#: lazarusidestrconsts.lisanchorsof
msgid "Anchors of %s"
msgstr "Якорі %s"
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Якорі вибраних елементів керування"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Якорити верхній край до нижнього краю брата. Відстань задається властивостями BorderSpacing цього елемента і брата."
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Якорити верхній край до верхнього краю брата. Використовуйте BorderSpacing щоб задати відстань. BorderSpacing брата нехтується."
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "При останньому запуску виникла помилка при завантаженні %s!%sЗавантажити цей проект знову?"
#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr "Вигляд"
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "&Назва класу застосунку"
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Графічний застосунок Free Pascal, що використовує кросплатформову бібліотеку LCL для свого ГІК."
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Застосувати"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "застосовувати прапорці збирання (-B) також до залежностей"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Застосувати умови"
#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr "Скоригувати розширення назв і регістр символів для платформ і типів файлів."
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Модуль проекту не може бути використаний іншими пакунками/проектами"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Ширина бордюру навколо елемента керування. Інші чотири бордюри додаються до цієї величини."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Запитати перед заміною кожного фрагменту"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Запитати перед збереженням сеансу проекту"
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr "Запитати назву компонента після встановлення його на формі дизайнера"
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Питати назву файлу для нового файлу"
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Спитати назву при створенні"
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr "Для систем Windows зручно встановити: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr "Автоматично коригувати висоту головного вікна ІСР"
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr "Показати повну палітру компонентів"
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr "Якщо палітра компонентів ділиться на декілька рядків, показувати їх всі, а не лише один."
#: lazarusidestrconsts.lisautocheckmodifiedfiles
msgid "Automatically check (select) modified files"
msgstr "Автоматично перевіряти (вибирати) змінені файли"
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Автозавершення: вимкн."
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Автозавершення: увімкн."
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Автопродовження після:"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Розмітка і збіги"
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Автоматично"
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Автоматично"
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr "Автоматично перетворювати файли .lfm на файли ресурсів .lrs"
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "не завершувати вибір"
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Автовиклик після крапки"
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "розрив рядка"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "пробіл"
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "табуляція"
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "кінець слова"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "не додавати символ"
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr "Автоматично використовувати один можливий ідентифікатор"
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Завершення і підказки"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Автоматичний показ"
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Доступний для встановлення"
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr "Доступні режими збирання проекту:"
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Зробити резервну копію змінених файлів"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Резервування не вдалося"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Створює резервний каталог в каталозі проекту"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Зміна назви пакунка або версії порушить залежності. Змінити ці залежності як правило?%sВиберіть Так для заміни всіх перерахованих залежностей.%sВиберіть Знехтувати для розриву залежностей і продовження."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "починається"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Після пов'язаних"
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "be less verbose, can be given multiple times"
msgstr "виводити менше подробиць, може задаватися декілька разів"
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "be more verbose, can be given multiple times"
msgstr "виводити більше подробиць, може задаватися декілька разів"
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "Переглядатиметься найкраще, якщо встановити елемент керування HTML, як напр. turbopoweriprodsgn"
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Завжди збирати перед виконанням"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Команда збирання"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Замість виконання після збирання проекту використати команду Зібрати файл"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Замість виконання проекту використати команду Виконати файл"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Виконати команду"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Коли цей файл активний в редакторі коду"
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Робоча тека (залишити порожньою для файлового шляху)"
#: lazarusidestrconsts.lisbinary
msgctxt "lazarusidestrconsts.lisbinary"
msgid "Binary"
msgstr "Двійковий"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Нестандартні значення жирним"
#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Простір межі"
#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Нижній"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Нижній бордюр. Ця величина додається до базового бордюру і використовується для відступу під контролем."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Зафіксувати кнопку"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Нижні"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Це елемент керування одного рівня, за яким фіксується нижня сторона. Залишити порожнім для фіксації за батьківським,як у Delphi (BorderSpacing і ReferenceSide не враховуються)."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Рівномірно нижні краї"
#: lazarusidestrconsts.lisbpsdisabled
msgctxt "lazarusidestrconsts.lisbpsdisabled"
msgid "Disabled"
msgstr "Вимкнено"
#: lazarusidestrconsts.lisbpsenabled
msgctxt "lazarusidestrconsts.lisbpsenabled"
msgid "Enabled"
msgstr "Увімкнено"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Перервати"
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Властивості точки зупинки"
#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr "Відшукайте і виберітиь компілятор (наприклад, ppcx64)"
#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Додати"
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Закрити"
#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Видалити"
#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr "&Додати ..."
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "За&мінити ..."
#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "&Доступний"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Знайти"
#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "Ви&хід"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Видалити"
#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr "&Перейменувати"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "За&мінити"
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Зібрати"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "зібрати всі файли проекту/пакунка/ІСР"
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Зібрати"
#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "Зібрати ІСР"
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "зібрати ІСР з пакунками"
#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr "Збирання"
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Не вдалось зібрати Lazarus"
#: lazarusidestrconsts.lisbuildmode
msgid "Build Mode: %s"
msgstr "Режим збирання: %s"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Відмінності між режимами збирання"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Відмінності від інших режимів збирання"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Режим:"
#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr "Назва на панелі завдань, наприклад: project1.lpi - Release - Lazarus"
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Режими збирання"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Зібрати новий проект"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Номер збірки"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Зібрати"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Зайнятий"
#: lazarusidestrconsts.lisbyte
msgid "%s byte"
msgstr "%s байт"
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Виклик %s для створення Makefile з %s не вдався."
#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr "Стек не оцінений"
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Скасувати"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Скасувати завантаження цього компонента"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Скасувати завантаження модуля"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Скасувати зміну назви"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Неможливо скомпілювати проект"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Неможливо скопіювати компонент верхнього рівня."
#: lazarusidestrconsts.liscannotcreatefile
msgid "Cannot create file \"%s\""
msgstr "Неможливо створити файл \"%s\""
#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr "Неможливо видалити останній режим."
#: lazarusidestrconsts.liscannotexecute
msgid "cannot execute \"%s\""
msgstr "неможливо виконати \"%s\""
#: lazarusidestrconsts.liscannotfind
msgid "Cannot find %s"
msgstr "Не вдалось знайти %s"
#: lazarusidestrconsts.liscannotfindexecutable
msgid "cannot find executable \"%s\""
msgstr "не вдалось знайти виконуваний файл \"%s\""
#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Неможливо знайти пускач Lazarus:%s%s"
#: lazarusidestrconsts.liscannotfindunit
msgid "Cannot find unit %s"
msgstr "Не вдалось знайти модуль %s"
#: lazarusidestrconsts.liscannotopenform
msgid "Cannot open form \"%s\"."
msgstr "Не вдалось відкрити форму \"%s\"."
#: lazarusidestrconsts.liscannotsaveform
msgid "Cannot save form \"%s\"."
msgstr "Не вдалось зберегти форму \"%s\"."
#: lazarusidestrconsts.liscannotsubstitutemacros
msgid "Cannot substitute macro \"%s\"."
msgstr "Неможливо підставити макрос \"%s\"."
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "Неможливо тестувати компілятор при зневаджуванні чи компілюванні."
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Можу змінити тільки клас TComponetns"
#: lazarusidestrconsts.liscantfindavalidppu
msgid "Can't find a valid %s.ppu"
msgstr "Неможливо знайти правильний %s.ppu"
#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "Порівняти файли (не для створення латок)"
#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr "%s (%s файлів)"
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr "Справді видалити %s файлів з вих. кодом%s%s"
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Змінити клас для %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "немає класу"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Неоднозначний компілятор"
#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Перевірте випробувальну теку в %sІнструменти -> Параметри -> Файли -> Тека для збирання пробних проектів"
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Компілятор \"%s\" не є виконуваним файлом.%sДетально: %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "містить "
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Копіювати вивід в буфер"
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Дати файлів .ppu FPC відрізняються більше ніж на годину.%sЦе може означати, що вони з двох різних встановлень.%sФайл1: %s%sФайл2: %s"
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Помилка"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ПОМИЛКА: "
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Шлях модуля FPC містить джерело: "
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "символи нового рядка"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "ПІДКАЗКА:"
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Неправильний компілятор"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Неправильний шлях пошуку"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Неправильна тестова тека"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Втрачений модуль"
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
msgid "RTL unit not found: %s"
msgstr "Модуль RTL не знайдено: %s"
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "знайдено кілька конфігурацій компілятора: "
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "Не знайдено fpc.cfg"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "не ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu наявний двічі: %s, %s"
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Існує .ppu файл старший самого компілятора:%s%s"
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr "Модуль RTL %s не знайдено.%sЗазвичай це означає, що %s має хибні шляхи модулів. Або встановлену систему пошкоджено."
#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "За вашим шляхом є кілька компіляторів Free Pascal.%s%s%sМожливо ви забули видалити старий компілятор?"
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Пропустити"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "спеціальні символи"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Всі тести виконано успішно."
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Неможливо створити тестовий файл"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Неможливо створити тестовий файл Pascal \"%s\"."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "незвичайні символи"
#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Попередження"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ПОПЕРЕДЖЕННЯ: "
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "неправильний роздільник шляху"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Категорії"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Складність"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Константи"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Порожні блоки"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Порожні класові секції"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Порожні конструктори"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Порожні процедури"
#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(фільтр)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Слідувати за курсором"
#: lazarusidestrconsts.liscein
msgctxt "lazarusidestrconsts.liscein"
msgid "%s in %s"
msgstr "%s в %s"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Є кореневим елементом керування"
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "\"Багато\" параметрів означає"
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Довгі процедури"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "\"Багато\" рядків процедури означає"
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Багато вкладених процедур"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Багато параметрів"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Показувати Категорії"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Показати вузли сирців"
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "\"Багато\" вкладених процедур означає"
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Центрувати загублене вікно"
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Відцентрувати елемент керування по горизонталі відносно заданого рівня. BorderSpacing нехтується."
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Відцентрувати елемент керування по вертикалі відносно заданого рівня. BorderSpacing нехтується."
#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Центрувати форму"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Центр вікна"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Центри"
#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Переважний режим показу"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Категорія"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Джерело"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Ніколи, тільки вручну"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Використовується лише в режимі категорій"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "В паузах"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Оновлювати автоматично"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Інше"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Оновлення"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Коли перемикається файл у редакторі коду"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Процедури"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Властивості"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Опубліковані властивості без типових"
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Показати зауваження з приводу"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Стиль"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Навколишні"
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Записи ToDo"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Типи"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Неіменовані константи"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Несортовані члени"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Видимість несортованих"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Змінні"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Неправильні відступи"
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "Стався виняток під час видалення%s\"%s:%s\"%s%s"
#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr "Скасувати завантаження цього ресурсу"
#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr "%s%sКлас \"%s\" не знайдено."
#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr "%s%sКомпонент: %s:%s"
#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr "%s%sКлас компонента: %s"
#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr "Продовжити завантаження"
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Не знаю, як скопіювати цей вибір форми редагування"
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Не знаю, як вирізати цей вибір форми редагування"
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Не знаю, як видалити цей вибір форми редагування"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Помилка створення компонента"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr "Помилка створення компонента: %s%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Помилка знищення компонента"
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Помилка знищення компонента типу %s модуля %s:%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Помилка знищення посередника"
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Помилка знищення посередника %s модуля %s:%s%s"
#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr "Помилка читання %s"
#: lazarusidestrconsts.liscfeinfile
msgid "In file %s"
msgstr "У файлі %s"
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Неприпустимий власник компонента"
#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr "%sКореневий=%s:%s"
#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr "Зупинити всі завантаження"
#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr "%sПотік=%s"
#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr "%s%sПозиція потоку: %s"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm вже існує"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Невідомий тип %s"
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent Де знаходиться TCustomNonFormDesignerForm? %s"
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator вже зареєстрований: %s"
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "Редактор компонента класу \"%s\"створив помилку:%s\"%s\""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "Компонент типу %s не зміг встановити свого власника на %s:%s"
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr "Не вдалося очистити вибір форми редагування%s%s"
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Змінити"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Змінити режим збирання"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Змінити клас"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "Змінено координату %s %s з \"%d\" на \"%d\" у %s."
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Змінити кодування"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Змінити файл"
#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Змінити предка"
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Зміни не були збережені"
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Змінити на Unix /"
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Змінити на Windows \\"
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Символ"
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Таблиця символів"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Відмітити все"
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Перевіряти зміни файлу на диску за вмістом, а не за міткою часу"
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ". Перевірте, що пакунок %s створює %s.ppu і цей файл ніщо не видаляє. Також переконайтесь, що два пакунки одночасно не мають доступу до сирців модуля."
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ". Перевірте, чи є пакунок %s у списку залежностей"
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "Перевіряти, чи наступний елемент у джерелі є \"end\" і, якщо ні, то повернути \"КінецьРядка + end; + КінецьРядка\"."
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Перевірити параметри"
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ". Перевірте список шляхів пошуку пакунка %s, спробуйте перезібрати з очищенням, перевірте вирази Uses у секціях Implementation."
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr "Перевірити наступний елемент у джерелі і, за потреби, додати крапку з комою."
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Перевірити ціль (ОС, ЦП, тип віджету LCL). Можливо вам треба перекомпілювати пакунок для цієї цілі або встановити іншу ціль для проекту."
#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr "Позначити/зняти всі"
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Виберіть іншу назву"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "Виберіть файл з шаблонами CodeTools"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Виберіть посилання FPDoc"
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Виберіть клавішу ..."
#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr "Виберіть назву для компонента"
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Виберіть файл прикладу"
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Виберіть файл повідомлень FPC"
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Виберіть Pascal-файл з прикладами відступів"
#: lazarusidestrconsts.lischoosecompilerexecutable
msgid "Choose compiler executable (%s)"
msgstr "Виберіть виконуваний файл компілятора (%s)"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Виберіть файл повідомлень компілятора"
#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Виберіть виконуваний файл зневаджувача"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Виберіть пакунок Delphi (*.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Виберіть проект Delphi (*.dpr)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Виберіть модуль Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Виберіть теку"
#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr "Виберіть виконуваний файл"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Виберіть теку коду FPC"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Виберіть теку Lazarus"
#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "Виберіть виконуваний файл \"make\""
#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr "Вибрати назву і текст"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Виберіть один із цих пунктів для створення нового файлу"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Виберіть один із цих пунктів для створення нового пакунка"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Виберіть один із цих пунктів для створення нового проекту"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Виберіть один із цих елементів для його успадкування "
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Виберіть код програми (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Виберіть структуру для вміщення у неї вибраного"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Виберіть теку для тестів"
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Виявлена кільцева залежність"
#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr "&Клас"
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Завершення класу"
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Класи та властивості існують. Значення не були перевірені."
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "Клас \"%s\" не є зареєстрованим класом компонента.%sНеможливо вставити."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Клас не знайдено"
#: lazarusidestrconsts.lisclassnotfoundat
msgid "Class %s not found at %s(%s,%s)"
msgstr "Клас %s не знайдено у %s(%s,%s)"
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "Клас \"%s\" методу \"%s\" не знайдено."
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Очистити"
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Очистити теку"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Очистити підтеки"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Залишати всі текстові файли"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Залишати файли, що відповідають фільтру"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Видалити файли за фільтром"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Простий синтаксис (напр., * замість .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Очистити все"
#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr "Очистити загальні файли"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Очистити коди Lazarus"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Перейти після збирання на автоматично"
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Очистка"
#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Очистити і зібрати"
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Очистити і зібрати проект"
#: lazarusidestrconsts.liscleanuppackage
msgid "Clean up package \"%s\"."
msgstr "Очистити пакунок \"%s\"."
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Очистити шлях до модулів?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Очистити"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Очистити теку?"
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Очистити фільтр параметрів"
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Клацніть тут для вибору файлу"
#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr "Клацніть, щоб побачити вибір"
#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr "Клацніть для вибору сторінки палітри"
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Клонувати"
#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Закрити"
#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Очистити все"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Закрити всі позначені"
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Закрити файли"
#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Сховати вікно"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Закриття вікна Редактора вихідного коду. Ви хочете закрити всі файли чи сховати вікно?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Закрити вікно Редактора Коду"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Параметри LCL, що залежать від інтерфейсу:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Параметр"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Компоненти"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Успадкування"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Список"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Палітра"
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Сторінки"
#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr "Палітра &видима"
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "&Відновити типові"
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Знайдено двозначний файл налаштування компілятора"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Виклик:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sКлацніть ОК, якщо справді впевнені."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Команда:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Код"
#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Оглядач коду"
#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr "Параметри створення коду"
#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr "Розділ класу"
#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Розміщення"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Параметри генерування коду"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Додати шлях"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Огляд"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Підтвердити заміну"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Створити елемент довідки"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Видалити шлях"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Опис"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Помилки"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Приклад"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "Параметри FPDoc"
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Вставити тег жирності тексту"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Вставити тег форматування тексту програми"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Вставити тег форматування курсивом"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Вставити тег ремарок"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Вставити тег форматування підкресленням"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Вставити тег форматування для змінних"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Наслідуваний"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Вставити посилання ..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Вставити тег абзацу"
#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(не знайдено успадкованого опису)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<НІЧОГО>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Дивись також"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Короткий опис для"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Короткий"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Нехтувати константи в таких функціях"
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Шукати неіменовані константи-символи"
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Оглядач коду"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Знехтувати такі неіменовані константи"
#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Додати шаблон"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Додати шаблон коду"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token \"%s\" already exists! "
msgstr "Елемент \"%s\" вже існує! "
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Автозавершення при"
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Змінити"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Коментар:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Редагувати шаблони коду"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Помилка"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Елемент:"
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Дія: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Автостворені елементи не можуть ані редагуватись,%s ані містити не автостворені дочірні елементи"
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, автоматично створене"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "Автостворені вузли не можуть редагуватись."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Заблокувати"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Редактор визначень CodeTools"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Шлях до компілятора"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Перетворити вузол"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Створити означення для %s Теки"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Створити визначення для компілятора Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Створити визначення для текстів програми Free Pascal SVN"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Створити означення для Проекту %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Створити макроси FPC і шляхи до тек проекту FPC"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Визначення"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Визначає рекурсивно"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Видалити вузол"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Головна тека %s, %sде Borland встановив всі коди %s. %sНаприклад: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Головна тека %s,%sде Borland встановив всі сирці %s,%sвикористані проектом %s.%sНаприклад: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Опис:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "тека %s"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Інакше"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Вихід без збереження"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Тека програм FPC SVN"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Тека"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Вставити шаблон компілятора Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Вставити шаблон з теки Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Вставити шаблон проекту Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Вставити шаблон компілятора Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Вставити шаблон з теки Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Вставити шаблон проекту Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Вставити шаблон компілятора Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Вставити шаблон з теки Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Вставити шаблон проекту Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Вставити шаблон компілятора Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Вставити шаблон проекту Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Вставте шаблон Free Pascal SVN"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Вставити шаблон компілятора Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Вставити шаблон з теки Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Вставити шаблон проекту Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Вставити вузол як дочірній"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Вставити вузол нижче"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Вставити шаблон"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Неправильний предок"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Неправильний вузол-предок"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Неправильний попередній вузол"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Головна тека %s,%sде Borland встановив всі %s коди.%sНаприклад: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Головна тека %s,%sде Borland встановив %s коди,%sякі використовують цей %s проект.%sНаприклад: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Пересунути вузол вниз"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Пересунути вузол на один рівень нижче"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Пересунути вузол на один рівень вище"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Пересунути вузол вгору"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Назва:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Новий вузол"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Вузол лише для читання"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "нічого не вибрано"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "Вузол-предок не може містити дочірніх вузлів."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Попередній вузол не може містити дочірніх вузлів."
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Тека проекту"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "Тека проекту %s"
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Помилка читання"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Зберегти і вийти"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Вибраний вузол:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "Тека сирців Free Pascal SVN. Не обов'язково. Це покращить пошук оголошень при зневаджуванні."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Тека проекту Free Pascal."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "Тека текстів Free Pascal SVN."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Шлях до компілятора Free Pascal.%s Наприклад, %s/usr/bin%s -n%s або %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "Шлях до компілятора проекту Free Pascal. Потрібно лише, якщо Ви встановлюєте нижче програму FPC SVN. Використовується для автостворювання макросів."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "Шлях до компілятора Free Pascal для цього джерела.%sВикористаний для автостворення макросів."
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Тека %s проекту,%sщо містить файли .dpr, dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Зняти визначення"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Зняти визначення зі всіх"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Рекурсивно зняти визначення"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Значення як шляхи до файлів"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Значення як текст"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%sзначення \"%s\" є неправильним."
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Змінна:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Помилка запису"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Оператор @"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Дужка"
#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr "Знак ^"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Колонка"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Кома"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Ідентифікатор"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Ключове слово"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Новий рядок"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Відсутнє"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Номер"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Крапка"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Крапка з комою"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Пробіл"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Рядкова константа"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Символ"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Виконати після"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Виконати перед"
#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr "Адреса"
#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr "Клас"
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr "Згорнути все (/)"
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Колапс всіх класів"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Згорнути всі пакунки"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Колапс всіх модулів"
#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr "Повертає"
#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr "Видимість"
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Параметри командного рядка"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Параметри командного рядка програми"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Компілювати"
#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr "Компілювати в таких режимах"
#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Компіляція проекту"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Компілятор"
#: lazarusidestrconsts.liscompilercfgismissing
msgid "%s is missing."
msgstr "%s відсутній."
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Компілятор \"%s\" не підтримує ціль %s-%s"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Помилка: неправильний компілятор:%s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Назва файлу компілятора"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Довідка: Ви можете задати шлях до компілятора в Інструменти->Параметри->Файли->Шлях до компілятора"
#: lazarusidestrconsts.liscompilermessagesfilenotfound
msgid "Compiler messages file not found:%s%s"
msgstr "Не знайдено файл повідомлень компілятора:%s%s"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "ЗАУВАЖЕННЯ: не знайдено файлу конфігурації для codetools - використовуємо типову"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "ЗАУВАЖЕННЯ: завантажується старий файл з налаштуваннями codetools:"
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Компілювати"
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "Для деталізації компілювати з -vd. Перевірка дублів."
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (компілюю ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Показ довгих підказок"
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Подовжувати далеко вліво"
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Подовжувати трохи вліво"
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Ніколи"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Подовжувати лише вправо"
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a Pascal keyword."
msgstr "Назва компонента \"%s\" є ключовим словом Pascal."
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name \"%s\" is keyword"
msgstr "Назву компонента \"%s\" зарезервовано"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name \"%s\" is not a valid identifier"
msgstr "Назва компонента \"%s\" є некоректним ідентифікатором"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Дивитись все"
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Відкрити пакунок"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Відкрити модуль"
#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr "Стиснути"
#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr "Результуючу теку буде стиснуто до файлу ZIP."
#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Тест"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Умова"
#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Умовні"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Тека конфігурації Lazarus"
#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr "Файл налаштувань додатків:"
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Налаштувати збирання %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Налаштувати \"Збирання Lazarus\""
#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr "Конфігурувати панель"
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Налаштувати Lazarus ІСР"
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Підтвердити"
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Підтвердження"
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus буде перезібраний з такими профілями:%sПродовжити?"
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Підтвердити зміни"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Підтвердити видалення"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Перезібрати Lazarus з профілем: %s ?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Підтвердьте новий набір пакунків для ІСР"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Дія"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Новий набір пакунків"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Старий набір пакунків"
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Конфлікт"
#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Виявлено конфлікт"
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Консольний застосунок"
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Консольна програма Free Pascal, що використовує TCustomApplication для спрощення перевірки параметрів командного рядка, обробки винятків тощо."
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Код конструктора"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "містить"
#: lazarusidestrconsts.liscontents
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Зміст"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "З врахуванням контексту"
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Продовжити"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Продовжити і не питати знов"
#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr "Продовжити збирання"
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Продовжити без завантаження форми"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Учасники"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Елемент управління вимагає \"предка\""
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Після заміни додати коментар"
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr "Після назви модуля додано модифікатор синтаксису MODE Delphi."
#: lazarusidestrconsts.lisconvaddingflagforregister
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr "Додавання прапорця наявності у модулі %s процедури \"Register\"."
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
msgid "\")\" is missing from replacement function: %s"
msgstr "\")\" відсутня у функції заміни: %s"
#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr "Не знайдена дужка"
#: lazarusidestrconsts.lisconvconvertedfrom
msgid " { *Converted from %s* }"
msgstr " { *Перетворено з %s* }"
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Зсув додається до координати верху елементів всередині візуальних контейнерів"
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Зміщення координат"
#: lazarusidestrconsts.lisconvdeletedfile
msgid "Deleted file %s"
msgstr "Видалено файл %s"
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr "До користувацьких параметрів додано визначення %s"
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr "Пакунок %s додано як залежність."
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
msgid "Added unit \"%s\" to uses section."
msgstr "До розділу uses додано модуль \"%s\"."
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Всі підтеки будуть перевірятися на файли модулів"
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "BeginCodeTools не вдався!"
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Категорії:"
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr "Кодування змінено з %s на UTF-8"
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Перетворення перервано."
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Перетворення готове."
#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr "Перетворення зайняло: %s"
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Конвертувати пакунок Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Конвертувати проект Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Конвертувати модуль Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Перетворити файли модулів, знайдені під час перетворення ***"
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** Перетворення файлів модулів, що належать проекту/пакунка ***"
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Помилка=\"%s\""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "При перетворенні модуля трапився виняток. Продовжуємо з файлами форм вже перетворених модулів..."
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Помилка конвертування модуля"
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit \"%s\""
msgstr "Помилка конвертування модуля \"%s\""
#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Виправлений регістр символів модуля \"%s\" на \"%s\"."
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Знайдено всі файли модулів"
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Функція Delphi"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) не знаходить файл включення"
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Назва Delphi"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Назва пакунка існує"
#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "Пакунок %s необхідний, але не встановлений у Lazarus! Встановіть його пізніше."
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr "Знехтуваний модуль %s з проекту"
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
msgid "Removed unit \"%s\" from uses section."
msgstr "Модуль \"%s\" вилучено з розділу uses."
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Виправлення використаних модулів і ремонт файлів форм ***"
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Замінений модуль \"%s\" на \"%s\" в секції uses."
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Вже існує пакунок з назвою \"%s\"%sБудь ласка спочатку виберіть пакунок."
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "Назва модуля є у LCL"
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Модулі для заміни в %s"
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "LCL вже містить модуль з назвою %s. Видалити локальний файл %s?"
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr "Файл .dproj ще не підтримується. Він використовується Delphi 2007 і новішими. Виберіть файл .dpr для проектів або .dpk для пакунків."
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Помилка перетворення"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Конвертувати"
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Конвертувати кодування"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Змінити кодування проектів/пакунків"
#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr "Інші параметри, що впливають на перетворення"
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Конвертувати проект або пакунок"
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Ціль"
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Кросплатформовий"
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Кросплатформовий, а не лише для Windows"
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Конвертер додає умовну компіляцію для підтримки різних цілей"
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Використовувати той самий файл DFM форми"
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Той самий DFM файл для Lazarus та Delphi замість копіювання його в LFM"
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Підтримувати Delphi"
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Використання умовної компіляції для підтримки Delphi"
#: lazarusidestrconsts.lisconvfixedunitname
msgid "Fixed unit name from %s to %s."
msgstr "Назву модуля виправлено з %s на %s."
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Заміни функцій"
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Деякі функції Delphi можна замінити функцію LCL"
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Функції / процедури для заміни"
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Зсув зліва"
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Нова назва"
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Батьківський контейнер"
#: lazarusidestrconsts.lisconvproblemsfindingallunits
msgid "Problems when trying to find all units from project file %s"
msgstr "Проблеми при спробі знайти всі модулі з файлу проекту %s"
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
msgid "Problems when fixing include files in file %s"
msgstr "Проблеми при виправленні включеного файлу файлі %s"
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
msgid "Problems when repairing form file %s"
msgstr "Проблеми з відновленням файлу форми %s"
#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr "Відновлення включених файлів"
#: lazarusidestrconsts.lisconvreplacedcall
msgid "Replaced call %s with %s"
msgstr "Виклик %s замінено на %s"
#: lazarusidestrconsts.lisconvreplfuncparameternum
msgid "Replacement function parameter number should be >= 1: %s"
msgstr "Число параметрів функції заміни має бути >= 1: %s"
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
msgid "\"$\" should be followed by a number: %s"
msgstr "Після \"$\" має бути число: %s"
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr "Зупинено, бо вже є пакунок з такою назвою"
#: lazarusidestrconsts.lisconvthislogwassaved
msgid "This log was saved to %s"
msgstr "Цей журнал збережено до %s"
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Зсув зверху"
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Заміни типів"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Невідомі типи у файлі форми (DFM/LFM)"
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Замінювані типи"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Заміни модулів"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Назви модулів в секції uses джерельного модуля"
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Замінювані модулі"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Невідомі властивості"
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
msgid "User selected to end conversion with file %s"
msgstr "Користувач вибрав завершення перетворення з файлом %s"
#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr "Додати/налаштувати/видалити панелі"
#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr "Додати роздільник"
#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr "Додати вибраний елемент керування на панель"
#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr "Доступні команди"
#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr "Стиль меж панелей"
#: lazarusidestrconsts.liscoolbarborderstyleitem0
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Немає"
#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Одинарний"
#: lazarusidestrconsts.liscoolbarcodeexplorer
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Дослідник коду"
#: lazarusidestrconsts.liscoolbarcodetemplates
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Шаблони коду"
#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr "&Конфігурувати"
#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr "Справді бажаєте видалити вибрану панель інструментів?"
#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr "Тут має бути принаймні одна панель інструментів!"
#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr "Дизайнер"
#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr "Загальні параметри швидкої панелі"
#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr "Стиль вузла захопу"
#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr "Просто"
#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Подвійний"
#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr "ГорЛінії"
#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr "ВерЛінії"
#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr "Затискач"
#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Кнопка"
#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr "Ширина захопу"
#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr "Головне меню ІСР"
#: lazarusidestrconsts.liscoolbarmessages
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Повідомлення"
#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr "Пересунути вибраний елемент панелі донизу"
#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr "Пересунути вибраний елемент панелі догори"
#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr "Швидка панель ІСР"
#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr "Редактор пакунків"
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr "Файли редактора пакунків"
#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr "Вилучити вибрані елементи з панелі"
#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr "Відновити типові"
#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr "Виберіть спочатку панель інструментів!"
#: lazarusidestrconsts.liscoolbarsourceeditor
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Редактор коду"
#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr "Вкладка редактора коду"
#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr "Команди панелі інструментів"
#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr "Швидка панель &видима"
#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr "Ширина швидкої панелі"
#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Копіювати"
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Копіювати все"
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Копіювати всі елементи в буфер"
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Копіювати всі/початкові повідомлення до буфера обміну"
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Копіювати весь вихід в буфер"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Копіювати всі Видимі повідомлення в буфер"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Копіювати опис в буфер обміну"
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Помилка при копіюванні"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Помилка копіювання"
#: lazarusidestrconsts.liscopyfilename
msgid "Copy Filename %s"
msgstr "Копіювати назву файлу %s"
#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Копіювати назву файлу до буфера обміну"
#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr "Не вдалось скопіювати файли."
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy \"%s\" to clipboard"
msgstr "Копіювати \"%s\" до буфера обміну"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Копіювання всієї форми не реалізоване."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Копіювати елемент в буфер"
#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Копіювати/перемістити файл до теки"
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Копіювати вибрані елементи в буфер обміну"
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Копіювати вибрані повідомлення в буфер"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Пошук повідомлень FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Пошук повідомлень Make"
#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr "Перевіряти повідомлення:"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Пропустити виклик компілятора"
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add \"{$I %s}\" to main source!"
msgstr "Неможливо додати \"{$I %s}\" до основного сирцевого файлу!"
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add \"{$R %s}\" to main source!"
msgstr "Неможливо додати \"{$R %s}\" до основного сирцевого файлу!"
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add \"%s\" to main source!"
msgstr "Неможливо додати \"%s\" до основного сирцевого файлу!"
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove \"%s\" from main source!"
msgstr "Неможливо видалити \"%s\" з основного сирцевого файлу!"
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove \"{$I %s}\" from main source!"
msgstr "Неможливо вилучити \"{$I %s}\" з основного сирцевого файлу!"
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove \"{$R %s}\" from main source!"
msgstr "Неможливо вилучити \"{$R %s}\" з основного сирцевого файлу!"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Увага: додатковий файл налаштувань компілятора має ту ж саму назву, як може називатись один із стандартних файлів налаштувань компілятора Free Pascal. Це призведе до використання додаткового файлу і пропуску стандартного."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Відкрити пакунок %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Відкрити модуль %s"
#: lazarusidestrconsts.liscpu
msgid ", CPU: %s"
msgstr ", ЦП: %s"
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Спочатку створіть проект!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Створити режими Debug і Release"
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Створити теку?"
#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Створити фільтр"
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Створити функцію"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Створити вузол Довідки"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Створити його"
#: lazarusidestrconsts.liscreatelocalvariable
msgid "Create local variable \"%s\""
msgstr "Створити локальну змінну \"%s\""
#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr "Створити новий додаток"
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Створити новий пакунок)"
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Створити новий компонент пакунка"
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Створити проект"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Створити/оновити .po файл при збереженні lfm файлу"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Створення файлового індексу джерел FPC %s ..."
#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "Нижній"
#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "Верхній"
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Виберіть теку"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Параметри тек Інструментів коду"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Визначення шаблонів"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Не вибрано змінних>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Відкрити попередній перегляд"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Інструменти"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Змінна: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Назва змінної"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Шаблони"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Оновити всі сигнатури методів"
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Оновлювати все підхожі сигнатури процедур"
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "виберіть будь-ласка макрос"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Вибрати макрос коду"
#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Поточний"
#: lazarusidestrconsts.liscurrentlclwidgetset
msgid "Current LCL widgetset: \"%s\""
msgstr "Поточна бібліотека віджетів LCL: \"%s\""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Поточний стан: "
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Колонка курсору в цьому редакторі"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Рядок курсору в цьому редакторі"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Ці параметри передаються у компілятор після заміни макросів."
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "параметри користувача"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Спеціальні параметри"
#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr "Власні параметри"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Спеціальна програма"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Власна програма на Free Pascal."
#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Вирізати"
#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr "Приєднати"
#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr "Назва зображення"
#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr "Ідентифікатор процесу"
#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr "Запущені процеси"
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Модуль даних"
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Дата"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Видалити все"
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Видалити все"
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Вимкнути все"
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Вимкнути все"
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Ввімкнути все"
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Ввімкнути все"
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to Clipboard"
msgstr "Копіювати в буфер"
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr "Властивості точки зупинки ..."
#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr "&Вираз:"
#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr "&Нове значення:"
#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr "&Результат:"
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Аналіз точки зупинки"
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Досягнення точки зупинки"
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Повідомлення точки зупинки"
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Дамп стеку для точки зупинки"
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Типовий колір"
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Виник виняток"
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Завантаження модуля"
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Вивантаження модуля"
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Рядок виводу зневаджувача"
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Завершення процесу"
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Запуск процесу"
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Завершення нитки"
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Запуск нитки"
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Віконне повідомлення додано"
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Віконне повідомлення надіслано"
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Вилучити"
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Вимкнути"
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Вимкнути"
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Ввімкнути"
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Ввімкнути"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Зневаджувач не визначений"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Встановити точку зупину за будь-яких обставин"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Не вказаний зневаджувач.%sВстановлені точки зупинки не діятимуть до тих пір, поки не буде встановлено Зневаджувач у діалозі параметрів зневаджувача у меню."
#: lazarusidestrconsts.lisdbgterminal
msgctxt "lazarusidestrconsts.lisdbgterminal"
msgid "Console In/Output"
msgstr "Консольний ввід/вивід"
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Увімк/Вимк"
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Вимкнення/Ввімкнення оновлень всього вікна"
#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Зневадження"
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Зневаджувач"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Помилка зневаджувача%sОпа! Зневаджувач знаходиться в неробочому стані%sЗбережіть роботу!%sНатисніть Стоп і сподівайтесь на краще!"
#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr "Помилка зневаджувача"
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr "Інформація зневаджувача"
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr "Попередження зневаджувача"
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Неправильний зневаджувач"
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (йде зневадження ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "Автоматичне зведення типів для об'єктів"
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Додати виняток"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Додатковий пошуковий шлях"
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr "Автоматично закривати вікно асемблера, якщо джерело не знайдено"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Точка зупину"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Очищувати журнал при виконанні"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Зневаджувач"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Загальні параметри зневаджувача"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Особливі параметри зневаджувача (залежать від його типу)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Дубльована назва винятку"
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Введіть назву винятку"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Журнал подій"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Обробляється"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Обробляється зневаджувачем"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Обробляється програмою"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Нехтувати ці винятки"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Мовні винятки"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Обмежити к-сть рядків до"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Модуль"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Exceptions"
msgstr "Повідомляти про винятки"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Винятки ОС"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Виведення"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Процес"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Скидати зневаджувач після кожного запуску"
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Відновити"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Відновити оброблені"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Відновити необроблені"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Показувати повідомлення зверху"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Сигнали"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Нитка"
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Використовувати кольори журналу подій"
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Вікна"
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Неможливо завантажити файл"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file \"%s\"."
msgstr "Неможливо завантажити файл \"%s\"."
#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Десяткове"
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Типово"
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr "Типовий розділ видимості класу нового методу. Наприклад, завершення коду для OnShow:="
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr "Типово - розкривний список з елементами \"True\" і \"False\""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(типово)"
#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr "Типовий розділ методів"
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Затримка виведення довгих підказок у вікні автозавершення"
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Затримка виведення підказок і вікна автозавершення"
#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Вилучити"
#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "Видалити?"
#: lazarusidestrconsts.lisdeleteaddition
msgid "Delete addition \"%s\"?"
msgstr "Видалити додаток \"%s\"?"
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Видалити всі"
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Видалити всі точки зупинки?"
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file \"%s\"?"
msgstr "Видалити всі точки зупинки з файлу \"%s\"?"
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Видалити всі в тому ж файлі сирцевого коду"
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Видалити всі вибрані точки зупинки?"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Видалити всі ці файли?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Видалити файл з неоднозначною назвою?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Видалити точку зупинки"
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Видалити точку зупинки в%s\"%s\" рядок %d?"
#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr "Видалити точку зупинки для адреси %s?"
#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr "Видалити точку спостереження для \"%s\"?"
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Видалення файлу не вдалося"
#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro \"%s\"?"
msgstr "Видалити макрос \"%s\"?"
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Видалити режим \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file \"%s\"?"
msgstr "Видалити старий файл \"%s\"?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Видалити старий файл?"
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Видалити вибраний макрос?"
#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr "Видалити цей додаток"
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value \"%s\"?"
msgstr "Видалити значення \"%s\""
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Видалити значення %s"
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file \"%s\" failed."
msgstr "Видалити файл \"%s\" не вдалося."
#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr "Роздільник - крапка з комою."
#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr "Сирці, сумісні з Delphi. Рекомендовано."
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "Пакунки часу розробки додають компоненти і елементи меню в ІСР. Вони можуть використовуватися проектами, але не компілюватися з ними. Компілятор не знайде модулів такого пакунка під час компілювання проекту."
#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr "Стільниці ..."
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Тека призначення"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Код деструктора"
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Без урахування регістру"
#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "Файл1"
#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "Файл2"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Нехтувати дод./видал. порожніх рядків"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Нехтувати різні заверш. рядків (напр., #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Нехтувати кількість пробілів"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Нехтувати пробіли (без переведення рядка)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Нехтувати пробіли в кінці рядка"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Нехтувати пробіли на початку рядка"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Тільки вибране"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Відкрити відмінності у редакторі"
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
msgid "different unit %s found at new position \"%s\""
msgstr "знайдено інший модуль %s у новому місці \"%s\""
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Розряди:"
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Директиви"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Директиви для нового модуля"
#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Теки"
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Тека:"
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory \"%s\" not found."
msgstr "Теку \"%s\"не знайдено."
#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr "тека %s не знайдена"
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Тека не доступна для запису"
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Тека, в якій ІСР розміщує .po файли"
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Вимкнути всі у тому ж сирцевому файлі"
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Вимкнути точку зупинки"
#: lazarusidestrconsts.lisdisabled
msgctxt "lazarusidestrconsts.lisdisabled"
msgid "Disabled"
msgstr "Вимкнено"
#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr "Вимкнути групи"
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Вимкнути I18N для LFM"
#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr "Вимкнути параметр -Xg?"
#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr "Вимкнути параметр -Xg"
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Асемблер"
#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "Перейти до адреси"
#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "Перейти до адреси"
#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "Перейти до поточної адреси"
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "Перейти до поточної адреси"
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Відхилити зміни"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Відхилити всі зміни"
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Відхилити зміни і відкрити проект"
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Відхилити зміни і вийти"
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Відхилити зміни, створити новий проект"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Виберіть один з елементів вище, щоб побачити різницю"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Помилка читання файлу: %s"
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr "Знехтувати всіма змінами на диску"
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr "Перезавантажити змінені файли з диска"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Деякі файли змінені на диску:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Розрізняти регістр букв, наприклад, А і а"
#: lazarusidestrconsts.lisdlgadd
msgctxt "lazarusidestrconsts.lisdlgadd"
msgid "Add ..."
msgstr "Додати..."
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Всі параметри"
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Змінити клас ..."
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Визначення ..."
#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Змінити ..."
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Експорт ..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Імпорт ..."
#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr "Більше ..."
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Відкрити ..."
#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Збереження ..."
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exist: %s"
msgstr "%s не існує: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Не змінювати"
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "%sDo not check if another IDE instance is already running"
msgstr "%sНе перевіряти, чи запущено інший примірник ІСР"
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Не закривати проект"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "не компілювати залежності"
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Не показувати заставки"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Не показувати цей діалог для цього проекту"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Не показувати це повідомлення знов"
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr "Не записувати оновлений файл інформації про проект після збирання. Якщо параметр не вказано, номер збірки буде нарощуватися (якщо цю функцію увімкнено)."
#: lazarusidestrconsts.lisdonwloadonlinepackages
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?\n"
msgstr ""
"Такі пакунки недоступні локально: %s.\n"
"Перед встановленням їх потрібно звантажити. Звантажити зараз?\n"
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Вниз"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Зниження"
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Понизити конфігурацію"
#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr "Звантажити"
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "Ви все ще хочете створити новий проект?"
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Ви все ще хочете відкрити інший проект?"
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Ви все ще хочете вийти?"
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Малювати лінії сітки"
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "Показувати вибране як таке, що перебуває у фокусі, навіть якщо вікно повідомлень не у фокусі. Користуйтесь цим, якщо елементи не у фокусі малопомітні у даній темі оформлення."
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Копіювати вибрані компоненти в буфер"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Вирізати вибрані компоненти в буфер"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Пересунути на один компонент назад"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Пересунути на один компонент вперед"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Пересунути компонент в кінець"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Пересунути компонент наперед"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Вставити вибрані компоненти з буфера"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Вибрати компонент-предок"
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr "Показати невізуальні компоненти"
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr "Перемикання показу невізуальних компонентів"
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Дублікат"
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Повторний елемент"
#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Повторна назва файлу"
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value \"%s\"."
msgstr "Знайдений дублікат значення \"%s\"."
#: lazarusidestrconsts.lisduplicatemodename
msgid "Mode \"%s\" is already present in the list."
msgstr "Режим \"%s\" вже є в списку."
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Повторна назва"
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Дублювання назви: компонет з назвою \"%s\" вже існує і в успадкованому компоненті %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Дубльовані ppu файли. Видаліть один або переконайтеся, що всі шляхи пошуку мають правильний порядок (Підказка: FPC спершу використовує останній шлях)."
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Шлях пошуку дублікату"
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Дубльовані сирці. Видаліть один або переконайтеся, що всі шляхи пошуку мають правильний порядок (Підказка: FPC спершу використовує останній шлях)."
#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Повторний модуль"
#: lazarusidestrconsts.lisduplicateunitin
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr "Повторний модуль \"%s\" у \"%s\""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Редагувати"
#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr "Змінити додаткову довідку для повідомлень"
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Редагувати контекстну допомогу"
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Змінити довідку"
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Змінити клавіші"
#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Кольори редактора"
#: lazarusidestrconsts.liseditormacros
msgid "Editor Macros"
msgstr "Макроси редактора"
#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr "Панель інструментів редактора"
#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr "Параметри панелі інструментів редактора"
#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr "&Показувати панель інструментів редактора"
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Завантажити схему"
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Всі пакунки"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Поточний проект"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Всі проекти"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "встановити режим FPC в DELPHI"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "встановити режим FPC на FPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "встановити режим FPC в GPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "встановити режим FPC на MacPas"
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "встановити режим FPC в TP"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "ввімкнути IOCHECKS на"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "ввімкнути OVERFLOWCHECKS на"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "ввімкнути RANGECHECKS на"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "використовувати модуль HeapTrc"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "використовувати модуль LineInfo"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Нормальний інструмент обов'язково має мати заголовок і назву файлу."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Інструмент правки"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Клавіша"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Макроси"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Параметри:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Назва файлу програми:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for FPC messages"
msgstr "Пошук повідомлень компілятора FreePascal у виведенні"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for \"make\" messages"
msgstr "Пошук повідомлень \"make\" у виведенні"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Необхідний заголовок і назва файлу"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Робоча тека:"
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr "Завжди показувати це повідомлення як важливе (типово воно належить до менш важливих \"детальних\")"
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Всі"
#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Порожні методи"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Знайдені порожні методи:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Немає класу"
#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr "Немає класу в %s(%s,%s)"
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Лише опублікований"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Публічний"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Опублікований"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Видалити методи"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Пошук в цих секціях класу:"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Неможливо показати порожні методи поточного класу, тому що%s%s"
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Порожньо"
#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr "Цільова тека для опублікування не вказана або задано відносний шлях."
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Увімкнути все"
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Ввімкнути Всі в тому ж джерелі"
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Увімкнути точку зупинки"
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Доступний"
#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr "Доступно лише для пакунків."
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ". Встановіть прапорець \"Використовувати модуль\" для модуля %s у пакунку %s"
#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr "Ввімкнути групи"
#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "Ввімкнути i18n для LFM"
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Включити підтримку інтернаціоналізації та перекладів "
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Макрос доступний"
#: lazarusidestrconsts.lisenableoptiondwarf
msgid "Enable Dwarf 2 (-gw)?"
msgstr "Увімкнути Dwarf 2 (-gw)?"
#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr "Увімкнути Dwarf 2 (-gw)"
#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr "Увімкнути Dwarf 2 з підтримкою множин"
#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr "Увімкнути Dwarf 3 (-gw3)"
#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr "Увімкнути параметр -Xg?"
#: lazarusidestrconsts.lisenableoptionxg2
msgid "Enable option -Xg"
msgstr "Увімкнути параметр -Xg"
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr "Ввімк = натискання Enter замінює цілий ідентифікатор, а Shift+Enter замінює префікс; Вимк = натискання Enter замінює префікс, а Shift+Enter замінює цілий ідентифікатор"
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Задужкувати"
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Вкласти в $IFDEF"
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
msgid "Number of files failed to convert: %d"
msgstr "Число файлів, які не вдалось перетворити: %d"
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "Кодування файлу \"%s\"%sна диску - %s. Нове кодування - %s."
#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr "Нескінченний цикл у макросі"
#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr "Введіть нову назву макросу \"%s\""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Змінна оточення, назва як параметр"
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Теки не існує"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Некоректна назва файлу зневаджувача"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "Файл зневаджувача \"%s\" не є виконуваним."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Теки проб \"%s\" не знайдено."
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Неправильна опція в позиції %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Опція в позиції %d на дозволяє використовувати аргумент %s"
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Опція в позиції %d потребує аргумент %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Помилка: "
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Помилка створення файлу"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Помилка видалення файлу"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Помилка в %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Помилка в назві файлу компілятора:"
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Помилка в власних параметрах компілятора (Інше):"
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Помилка у власних параметрах компонувальника (Компіляція і компонування / Передати параметри компонувальнику):"
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Помилка у \"Доповненні шляху зневаджувача\":"
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Помилка в шляху пошуку для \"Включені файли\":"
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Помилка в шляху пошуку для \"Бібліотеки\":"
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Помилка в шляху пошуку для \"Об'єктні файли\":"
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Помилка в шляху пошуку для \"Інші сирці\":"
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Помилка в шляху пошуку для \"Інші файли модулів\":"
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Помилка в \"вихідній теці модуля\":"
#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "Error: (lazarus) invalid build mode \"%s\""
msgstr "Помилка: (lazarus) неправильний режим збирання \"%s\""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Помилка завантаження файлу"
#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":"
msgstr "Помилка завантаження файлу \"%s\":"
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Помилка завантаження %s з%s%s%s%s"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Помилка переміщення компонента"
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Помилка переміщення компонента %s:%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Помилка при називанні компонента"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Помилка відкриття компонента"
#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr "Помилка відкривання форми"
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Помилка аналізу потоку lfm компонента"
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Помилка читання списку пакунків з файлу%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Помилка читання XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Помилка читання xml-файлу \"%s\"%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Помилка перейменування файлу"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Помилки"
#: lazarusidestrconsts.liserrors2
msgid ", Errors: %s"
msgstr ", Помилок: %s"
#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr "Помилка збереження форми"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Помилка збереження %s до%s%s%s%s"
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Помилка задання назви компонента %s на %s"
#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr "Помилка запису файлу \"%s\""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Помилка запису списку пакунків у файл%s%s%s%s"
#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "Оцінити вираз"
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "О&цінити"
#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr "&Оцінити/Змінити"
#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr "Очистити події"
#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr "Параметри журналу подій ..."
#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr "Зберегти події у файл"
#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr "Додати коментар ..."
#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr "Додати коментар"
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number"
msgstr "Кожен n-ний номер рядка"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Файл прикладу:"
#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr "Зібрати всі вибрані"
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Приклади:%sІдентифікатор%sTMyEnum.Enum%sНазвамодуля.Ідентифікатор%s#Назвапакунку.Назвамодуля.Ідентифікатор"
#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr "Відкрити перший вибраний"
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Повідомлення про виняток зневаджувача"
#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr "%s виключений під час виконання"
#: lazarusidestrconsts.lisexecutableisadirectory
msgid "executable \"%s\" is a directory"
msgstr "виконуваний файл \"%s\" є текою"
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
msgid "executable \"%s\" lacks the permission to run"
msgstr "виконуваний файл \"%s\" не має прав на запуск"
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Виконати команду після"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Виконати команду до"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Виконання завершено"
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Вихід"
#: lazarusidestrconsts.lisexitcode
msgid "Exit code %s"
msgstr "Код завершення %s"
#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr "Розгорнути все (*)"
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Розширити всі класи"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Розгорнути всі пакунки"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Розширити всі модулі"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Повна назва файлу в поточному редакторі"
#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Експортувати"
#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr "Експортувати всі"
#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Експортувати всі елементи до файлу"
#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr "Експортувати параметри оточення"
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Експортувати як HTML"
#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr "Експорт / Імпорт"
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Список експорту"
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr "Експортувати список пакунків (*.xml)"
#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr "Експортувати вибране"
#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr "Експортувати >>"
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Вираз:"
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
msgstr "Доповнити список шляхів пошуку файлів для включення пакунка \"%s\" такими%s\"%s\"?"
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
msgid "Extend include files search path of project with%s\"%s\"?"
msgstr "Доповнити список шляхів пошуку файлів для включення проекту такими%s\"%s\"?"
#: lazarusidestrconsts.lisextendincludepath
msgid "Extend include path?"
msgstr "Доповнити шляхи до файлів для включення?"
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Розширити шлях до модулів?"
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
msgstr "Доповнити список шляхів пошуку модулів пакету \"%s\" такими%s\"%s\"?"
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
msgid "Extend unit search path of project with%s\"%s\"?"
msgstr "Доповнити список шляхів пошуку модулів проекту такими%s\"%s\"?"
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Здобути"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Видобути процедуру"
#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Надзвичайно детально"
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Зовнішні інструменти"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Досягнуто максимуму інструментів"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Припускається максимум %s інструментів."
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
msgid "Failed to add %d not unique resource(s)"
msgstr "Не вдалось додати неунікальні ресурси (%d шт.)"
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Не вдалось створити пакет застосунків для \"%s\""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Не вдалось завантажити стан згортки"
#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "не вдалось розкрити макрос"
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "Не вдалось зберегти файл."
#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr "Фатальна помилка"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Обмежити вимальовування дизайнера"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Малювати елементи дизайну тільки в паузах (зменшує навантаження на повільних машинах)"
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Файл"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Файл:"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Файл \"%s\"%sне схожий на текстовий.%sВсе одно відкрити?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Розширення файлів програм"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Фільтр файлів"
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Файлові фільтри"
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Додати рядок"
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Видалити рядок"
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Вставити рядок"
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Файлова маска"
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Задати типові"
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Це фільтри файлів, які з'являться в усіх діалогах відкриття файлів"
#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr "Файл знайдено"
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File \"%s\" has changed. Save?"
msgstr "Файл \"%s\" змінено. Зберегти?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Файл не має проекту"
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Файл є текою"
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Файл не є виконуваним"
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "У файл не можна писати"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Файл є символьним посиланням"
#: lazarusidestrconsts.lisfileisvirtual
msgid "File \"%s\" is virtual."
msgstr "Файл \"%s\" є віртуальним."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Помилкове посилання на файл"
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Назва файлу/адреса"
#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr "Стиль назви файлу"
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Файл не знайдено"
#: lazarusidestrconsts.lisfilenotfound2
msgctxt "lazarusidestrconsts.lisfilenotfound2"
msgid "File \"%s\" not found."
msgstr "Файл \"%s\" не знайдено."
#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr "файл %s не знайдено"
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "файл не знайдено"
#: lazarusidestrconsts.lisfilenotfound5
msgid "File not found:%s%s"
msgstr "Файл не знайдено:%s%s"
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "Файл \"%s\" не знайдено.%sСтворити його?"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Файл не в нижньому регістрі"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Не текстовий файл"
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Параметри файлу"
#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr "Файл %s має некоректний синтаксис."
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Файлів: %s, з процедурою Register: %s, у виразі Uses пакунка: %s"
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Всі знайдені файли вже мають правильне кодування ***"
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Файли в кодуванні ASCII або UTF-8"
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr "Файл %s перетворено на текстовий."
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Файли не в кодуванні ASCII і не в UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "файл, куди буде записуватись зневаджувальна інформація. Якщо не вказано, зневаджувальна інформація виводиться в консоль."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Фільтр"
#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Фільтр: %s"
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr "Приховати повідомлення певного типу"
#: lazarusidestrconsts.lisfilterallmessagesoftype
msgid "Filter all messages of type %s"
msgstr "Фільтрувати всі повідомлення типу %s"
#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "Фільтрувати вже наявні"
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Не показувати повідомлення зневадження і нижчі"
#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Не показувати підказки і нижчі"
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Не показувати підказки без позиції у коді"
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "Показувати всі, не фільтрувати за важливістю"
#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Фільтрувати повідомлення за важливістю"
#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "Фільтрувати зауваження і нижче"
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Набори фільтрів"
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Фільтрувати доступний список параметрів"
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Не показувати детальні повідомлення і нижчі"
#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Не показувати попередження і нижчі"
#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Знайти ..."
#: lazarusidestrconsts.lisfinddeclarationof
msgid "Find Declaration of %s"
msgstr "Знайти оголошення %s"
#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "&Теки"
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "&Маска файлів"
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Включити &підтеки"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Багаторядковий шаблон"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "шукати в усіх файлах &проекту"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "шукати в усіх від&критих файлах"
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr "шукати в &активному файлі"
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "шукати в &теках"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Де"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Знайти комбінацію клавіш"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Знайти втрачений модуль"
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Перший"
#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr "&Перший тест"
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Виправити файл LFM"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Рухома кома"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Фокусна підказка"
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Розпочати зміну назв"
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr "Наприклад, виводити вгорі локальні змінні, потім елементи поточного класу, його предків, поточного і використаних модулів"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Форма"
#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr "Для macOS (Darwin)"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Помилка формату"
#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr "Для Windows"
#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr "Знайдена версія %s, але очікувалась %s"
#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr "Версія FPC одним числом (наприклад, 20701)"
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "fpcmake провалився"
#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr "Файл повідомлень FPC:"
#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr "Повідомлення FPC: додаток"
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr "Ресурси FPC (.res)"
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Сирцеві коди FPC"
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC надто старий"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Версія FPC: "
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Версія FPC (напр. 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "Помилка запису \"%s\"%s%s"
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Синтаксична помилка FPDoc"
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "Назва пакунка FPDoc:"
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "Назва пакунка FPDoc. Типовим є назва файлу проекту."
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Є синтаксична помилка в елементі fpdoc \"%s\":%s%s"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Фрейм"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "Пошук на&зад"
#: lazarusidestrconsts.lisfreeingbufferlines
msgid "freeing buffer lines: %s"
msgstr "вивільнення рядків буфера: %s"
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Повідомлення компілятора Free Pascal"
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Тека сирців Free Pascal"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Пошук в&перед"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Додаткові файли для пошуку (напр. /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Знайти або перейменувати ідентифікатор"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Знайти посилання"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Ідентифікатор: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "у всіх відкритих пакунках і проектах"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "в поточному модулі"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "в головному проекті"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "у проекті/пакунку, що містить цей модуль"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Некоректний ідентифікатор"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Перейменувати всі посилання"
#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr "Перейменування"
#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr "Пошук"
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Шукати також і в коментарях"
#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Повний"
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Функція"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Загальне"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "взяти слово в поточній позиції"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr "Взяти слово у поточній позиції курсору."
#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr "Глобальні параметри"
#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Перейти до рядка"
#: lazarusidestrconsts.lisgotoselected
msgid "Goto selected"
msgstr "Перейти до вибраного"
#: lazarusidestrconsts.lisgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"Ці сирці є відкритим програмним забезпеченням; ви можете поширювати їх та змінювати на умовах ліцензії GNU GPL v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation. \n"
"\n"
"Цей код поширюється з надією, що він буде корисними, але БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, зокрема не гарантується його придатність для певної мети. Докладнішу інформацію дивіться у ліцензії GNU GPL. \n"
"\n"
"Копія ліцензії доступна у Всесвітній мережі за адресою <http://www.gnu.org/copyleft/gpl.html>. Ви також можете отримати її, написавши листа до Free Software Foundation, Inc. за адресою 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Група"
#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr "Присвоїти до наявної \"%s\" групи?"
#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr "До групи \"%s\" більше не призначено точок зупинки, видалити її?"
#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr "%sЄ ще %d порожніх груп, видалити всі?"
#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr "Групувати автоматично визначені локальні змінні"
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr "Назва групи не може бути порожня. Очистити груп(и) точок зупинки?"
#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr "Назва групи:"
#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr "Назва ГрупиТочокЗупинки має бути дійсною назвою ідентифікатора."
#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr "Задати нову групу ..."
#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr "Очистити груп(и)"
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr "Увімкнення або вимкнення груп виводу зневаджувача. Варіанти:"
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Збільшити до найбільшого"
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Має довідку"
#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr "Кольори заголовка"
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Коментар заголовка для класу"
#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Довідка"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Розділи довідки"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Селектор довідки"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Шістнадцяткове"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Довідка до повідомлень компілятора Free Pascal"
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "Приховати всі поради і попередження, вставивши директиву ІСР {%H-}"
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "Приховати повідомлення у позиції %s вставлянням директиви ІСР {%H-}"
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "Приховати повідомлення, вставивши директиву ІСР {%H-}"
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr "Приховати повідомлення, вставивши {$warn %s off} у модуль \"%s\""
#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Приховати засіб пошуку"
#: lazarusidestrconsts.lishidewindow
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Сховати вікно"
#: lazarusidestrconsts.lishidewithpackageoptionvm
msgid "Hide with package option (-vm%s)"
msgstr "Приховати за допомогою параметра пакунка (-vm%s)"
#: lazarusidestrconsts.lishidewithprojectoptionvm
msgid "Hide with project option (-vm%s)"
msgstr "Приховати за допомогою параметра проекту (-vm%s)"
#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "Підказка"
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Порада: типове значення може бути задане в умовних."
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr "Спливна підказка для назви властивості показує її опис"
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Порада: перевірте чи два пакунки містять модуль з однією назвою."
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr "Підказка: натисніть \"Показати параметри\", щоб з'ясувати, звідки було взято успадковані шляхи."
#: lazarusidestrconsts.lishints
msgid ", Hints: %s"
msgstr ", Підказки: %s"
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Зберегти всі"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "На крок із входом"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Виконати до повернення результату функції"
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "На крок в обхід"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Довідка: функція \"Створити рядок ресурсів\" вимагає рядкової константи.%sВиберіть вираз і спробуйте спочатку."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Перемкнути форму/модуль"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Показувати форми"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Показувати модулі"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "К-сть влучень"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Бази даних"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Параметри довідки"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Властивості:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Переглядачі"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "HTML шлях до FPC документації"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Горизонтально"
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr "Горизонтальні лінії між властивостями."
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr "Додавання"
#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr "Відкривання"
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "ІСР"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Параметри збирання ІСР"
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "Під час встановлення/видалення пакунків ІСР буде перекомпільовано і перезапущено."
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Ласкаво просимо до Lazarus.%0:sЗнайдені налаштування ІСР використовувались іншим примірником Lazarus.%0:sДва або більше примірників Lazarus не повинні мати спільну конфігурацію. Це може спричинити конфлікти і неможливість використання Lazarus.%0:s%0:sЯкщо ви маєте лише один примірник і скопіювали або перемістили виконуваний файл Lazarus, налаштування можна оновити.%0:s%1:s%0:s%0:sВиберіть:%0:s%0:s* Оновити дані: використовувати цю конфігурацію і оновити її для подальшого використання. Старий примірник Lazarus більше не буде її використовувати.%0:s* Знехтувати: використовувати цю конфігурацію, але попереджувати надалі. Це може спричинити конфлікти з іншими примірниками Lazarus.%0:s* Перервати: закінчити роботу. Проблему можна буде виправити, запустивши Lazarus з правильною конфігурацією.%0:s%0:sДодаткова інформація:%0:sЦя конфігурація знаходиться у: %2:s%0:sВона належить примірнику Lazarus у: %3:s%0:sПоточний примірник ІСР запущено з: %4:s%0:s"
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Створюю Makefile для пакунка %s"
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Помилка: для пакунка %s не вдалось виконати засіб, визначений для виконання після компіляції"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Інформація про ІСР"
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "УВАГА: неправильна назва модуля %s, пакунок=%s"
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "Макрос ІСР"
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr "ІСР зберігає Application.Scaled (Hi-DPI) у головному модулі"
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "ІСР зберігає заголовок у головному модулі"
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "Ідентифікатор"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Ідентифікатор починається з ..."
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Ідентифікатор містить ..."
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Параметри ІСР:"
#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr "Показувати у заголовку ІСР вибраний режим збирання"
#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr "Показувати у заголовку ІСР теку проекту"
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Заголовок ІСР починається з назви проекту"
#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Всі режими збирання"
#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Параметри компілятора для"
#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Поточний режим збирання"
#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "Помилка відкривання XML"
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
msgid "Error opening XML file \"%s\":%s%s"
msgstr "Помилка відкривання файлу XML \"%s\":%s%s"
#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Експортувати параметри компілятора"
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Експортований файл існує"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Експортований файл \"%s\" існує.%sВідкрити файл і замінити тільки параметри компілятора?%s(Решту налаштувань буде збережено.)"
#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Імпортувати параметри компілятора"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Завантажити з файлу"
#: lazarusidestrconsts.lisieconocompileroptionsinfile
msgid "File \"%s\" does not contain compiler options."
msgstr "Файл \"%s\" не містить параметрів компілятора."
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Недавні файли"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Зберегти у файл"
#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "Якщо не позначено:"
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr "Якщо змінилась лише інформація про сеанс, запитувати перед її збереженням"
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "Якщо ви хочете використовувати дві різні версії Lazarus ви повинні запустити інший Lazarus з параметром командного рядка primary-config-path чи pcp.%sНаприклад:"
#: lazarusidestrconsts.lisignore
msgctxt "lazarusidestrconsts.lisignore"
msgid "Ignore"
msgstr "Знехтувати"
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Знехтувати все"
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Знехтувати і продовжити"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Нехтувати цей тип винятків"
#: lazarusidestrconsts.lisignoreuseasancestor
msgid "Ignore, use %s as ancestor"
msgstr "Знехтувати, використати %s як предка"
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Наслідувати відступ поточного модуля, проекту або пакунка"
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Коментар перед реалізацією класу"
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Імпортувати"
#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr "Важливо"
#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr "Імпортувати параметри оточення"
#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Імпортувати з файлу"
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr "Імпорт режимів збирання не підтримується для пакунків."
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Список імпорту"
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr "Імпортувати список пакунків (*.xml)"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Неможливо"
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr "В джерельній теці пакунка \"%s\"."
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "В теці сирцевих кодів проекту. Перевірте на дублікати."
#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr "Включно з усіма підтеками"
#: lazarusidestrconsts.lisincludefilter
msgid "Include filter"
msgstr "Фільтр для вибору"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "шлях доданих файлів"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Шляхи до файлів для включення"
#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr "Включно з підтеками"
#: lazarusidestrconsts.lisincompatibleppu
msgid ", incompatible ppu=%s"
msgstr ", несумісний PPU=%s"
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Знайдена неправильна тека конфігурації"
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Відступи для сирців Pascal"
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Індекс"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Інформація"
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Інформація про %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Інфо про використаний FPC"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "У шляху пошуку модулів FPC. Ймовірно, встановлено пакунок FPC. Переконайтеся в тому, компілятор і ppu файл з одного встановлення."
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Перед пов'язаними"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Успадкований елемент"
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Успадковані параметри"
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Успадкований компонент проекту"
#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr "Ініціалізувати локальну змінну"
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Для того, щоб створити чисту копію проекту/пакунка, всі файли в даній теці будуть видалені і весь її вміст буде втрачено.%sВидалити всі файли в \"%s\"?"
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Вставити"
#: lazarusidestrconsts.lisinsertassignment
msgid "Insert Assignment %s := ..."
msgstr "Вставити присвоєння %s := ..."
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Вставити дату"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Вставити дату і час"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string."
msgstr "Вставити дату і час. Можливо: рядок формату."
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string."
msgstr "Вставити дату. Можливо: рядок формату."
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "вставити кінець якщо потрібно"
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName, // extract/add ClassName.\n"
"WithoutClassName, // skip classname\n"
"WithoutName, // skip function name\n"
"WithoutParamList, // skip param list\n"
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes, // skip colon, param types and default values\n"
"WithDefaultValues, // extract default values\n"
"WithResultType, // extract colon + result type\n"
"WithOfObject, // extract 'of object'\n"
"WithCallingSpecs, // extract cdecl; inline;\n"
"WithProcModifiers, // extract forward; alias; external;\n"
"WithComments, // extract comments and spaces\n"
"InUpperCase, // turn to uppercase\n"
"CommentsToSpace, // replace comments with a single space\n"
" // (default is to skip unnecessary space,\n"
" // e.g 'Do ;' normally becomes 'Do;'\n"
" // with this option you get 'Do ;')\n"
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon, // skip semicolon at end\n"
msgstr ""
"Вставити заголовок поточної процедури.\n"
"\n"
"Необов'язкові параметри (відокремлені комою):\n"
"WithStart, // ключове слово процедури, напр. 'function', 'class procedure'\n"
"WithoutClassKeyword,// без ключового слова 'class'\n"
"AddClassName, // видобути/додати назву класу.\n"
"WithoutClassName, // пропустити назву класу\n"
"WithoutName, // пропустити назву функції\n"
"WithoutParamList, // пропустити список параметрів\n"
"WithVarModifiers, // видобути 'var', 'out', 'const'\n"
"WithParameterNames, // видобути назви параметрів\n"
"WithoutParamTypes, // пропустити двокрапки, типи параметрів і типові значення\n"
"WithDefaultValues, // видобути типові значення\n"
"WithResultType, // видобути двокрапку + тип результату\n"
"WithOfObject, // видобути 'of object'\n"
"WithCallingSpecs, // видобути cdecl; inline;\n"
"WithProcModifiers, // видобути forward; alias; external;\n"
"WithComments, // видобути коментарі і пропуски\n"
"InUpperCase, // перевести в верхній регістр\n"
"CommentsToSpace, // замінити коментарі одиничними пропусками\n"
" // (типовим є опускання зайвих пропусків,\n"
" // напр. 'Do ;' зазвичай стає 'Do;'\n"
" // а з цим параметром отримаєте 'Do ;')\n"
"WithoutBrackets, // опустити початкову і кінцеву дужки списку параметрів\n"
"WithoutSemicolon, // опустити крапку з комою в кінці\n"
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Вставити макрос"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure."
msgstr "Вставити назву поточної процедури."
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Вставити тег PrintShort"
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Вставити тег printshort"
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "вставити заголовок процедури"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "вставити назву процедури"
#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr "Вставити за потреби крапку з комою"
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "вставити час"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string."
msgstr "Вставити час. Можливо: рядок формату."
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Вставити тег url"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "В сесії"
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Перевірити"
#: lazarusidestrconsts.lisinspectclassinherit
msgid "%s: class %s inherits from %s"
msgstr "%s : клас %s успадковує від %s"
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Дані"
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Інспектор зневадження"
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Методи"
#: lazarusidestrconsts.lisinspectpointerto
msgid "Pointer to %s"
msgstr "Вказівник на %s"
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Властивості"
#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr "Показати стовпець класу"
#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr "Показати стовпець типу"
#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr "Показати стовпець видимості"
#: lazarusidestrconsts.lisinspectunavailableerror
msgid "%s: unavailable (error: %s)"
msgstr "%s: недоступно (помилка: %s)"
#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr "Примірник"
#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr "Використати клас примірника"
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Встановлення не вдалося"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "Встановлено"
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Встанови його, мені подобається жир"
#: lazarusidestrconsts.lisinstallpackagesmsg
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?\n"
msgstr ""
"Такі пакунки не встановлені, але є в головному сховищі: %s.\n"
"Встановити відсутні пакунки?\n"
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Встановити вибране"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Встановлення/Видалення пакунків"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr "Замість компілювання пакунка створити простий Makefile."
#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr "Непідхоже кодування"
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Інтерактивний"
#: lazarusidestrconsts.lisinternalerror
msgid "internal error: %s"
msgstr "внутрішня помилка: %s"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Неприпустиме видалення"
#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr "Неправильний виконуваний файл"
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
msgid "The file \"%s\" is not executable."
msgstr "Файл \"%s\" не є виконуваним."
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Неправильний вираз.%sДовідка: функція \"Створити рядок ресурсів\" вимагає рядкової константи в одному файлі. Виберіть вираз і спробуйте ще раз."
#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr "Некоректна назва файла"
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Неправильний фільтр"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Неприпустимий рядок, стовпець в повідомленні%s%s"
#: lazarusidestrconsts.lisinvalidmacrosin
msgid "Invalid macros in \"%s\""
msgstr "Неправильний макрос у \"%s\""
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Неправильний макрос \"%s\" у зовнішньому засобі \"%s\""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "Недійсний макрос \"%s\". Назва макросу має бути ідентифікатором Pascal."
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Недійсна назва макросу \"%s\". Назва є ключовим словом."
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Неправильна маска"
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Неправильний режим %s"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Неправильний множинний вибір"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Неправильний (Вимк)"
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Неправильний (Увімк)"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Некоректний ідентифікатор паскаля"
#: lazarusidestrconsts.lisinvalidpascalidentifiername
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr "Назва \"%s\" не є правильним ідентифікатором Паскаля.%sВсе одно використати?"
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Неправильна назва проц."
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Неправильна назва файлу проекту"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Неправильна тека публікації"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Неправильний вибір"
#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr "неправильна версія у %s"
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s вже є частиною проекту."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"%s\" не є коректною назвою проекту.%s Виберіть іншу (напр., project1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s це %s.%sЦя кругова залежність не допускається."
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "теку не знайдено"
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Питання"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr "Цікаво, як ви це зробили. Помилка в %s:"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Цікаво, як ви це зробили. Помилка у базовій теці:"
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Історія переходів"
#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr "Перейти до помилки"
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr "Переходити до помилки, виявленої у сирцях при завершенні ідентифікатора."
#: lazarusidestrconsts.lisjumptoprocedure
msgid "Jump to procedure %s"
msgstr "Перейти до процедури %s"
#: lazarusidestrconsts.liskb
msgid "%s KB"
msgstr "%s КБ"
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Залишити"
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Залишити конвертовані файли відкритими в редакторі"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Всі файли проекту буде відкрито в редакторі після перетворення"
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Залишити в списку встановлення"
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Залишати назву"
#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr "Залишити відкритим"
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "Зберігати відносний відступ багаторядкового шаблона"
#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "Залишити відступи"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Залишити їх і продовжити"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Ключ"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Спеціальні команди"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Команди дизайнера"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Команди Інспектора об'єктів"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Клавіша (або двоклавішна комбінація)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Перервати збирання"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Додати адресну точку зупинки"
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Додати точку зупинки коду"
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Додати Дані/ТочкуОгляду"
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Додати спостереження"
#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Зібрати в багатьох режимах"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Зібрати проект/програму"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Вибір схеми розкладки клавіатури"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Класичний"
#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Очистити і зібрати"
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Закрити проект"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "CodeTools визначає редактор"
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Компілювати проект/програму"
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "Налаштувати \"файл збирання\""
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Налаштувати нетипові компонети"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Контекстна допомога"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Перетворення пакунка Delphi на пакунок Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Перетворення проекту Delphi в проект Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Перетворення модуля Delphi в модуль Lazarus"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "Перетворення файлу DFM в LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected components"
msgstr "Копіювати вибрані компоненти"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected components"
msgstr "Вирізати вибрані компоненти"
#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr "Типова адаптована до macOS"
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Видалення останнього символу"
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "Порівняти файли редактора"
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Редагувати шаблони коду"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Редагувати контекстну допомогу"
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Задужкувати вибране"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Обчислити/Змінити"
#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr "Приклади проектів"
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Налаштування зовнішніх інструментів"
#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Знайти за зростанням"
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to bookmark 0"
msgstr "Перейти до закладки 0"
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to bookmark 1"
msgstr "Перейти до закладки 1"
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to bookmark 2"
msgstr "Перейти до закладки 2"
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to bookmark 3"
msgstr "Перейти до закладки 3"
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to bookmark 4"
msgstr "Перейти до закладки 4"
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to bookmark 5"
msgstr "Перейти до закладки 5"
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to bookmark 6"
msgstr "Перейти до закладки 6"
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to bookmark 7"
msgstr "Перейти до закладки 7"
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to bookmark 8"
msgstr "Перейти до закладки 8"
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to bookmark 9"
msgstr "Перейти до закладки 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Перейти до редактора коду 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Перейти до редактора коду 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Перейти до редактора коду 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Перейти до редактора коду 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Перейти до редактора коду 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Перейти до редактора коду 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Перейти до редактора коду 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Перейти до редактора коду 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Перейти до редактора коду 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Перейти до редактора коду 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Вставити дату і час"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Вставити назву користувача"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Перевірити"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Схема розкладки клавіатури"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus default"
msgstr "Типова для Lazarus"
#: lazarusidestrconsts.liskmmacosxapple
msgid "macOS, Apple style"
msgstr "macOS, стиль Apple"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "macOS, Lazarus style"
msgstr "macOS, стиль Lazarus"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Новий пакунок"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Новий проект"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Новий проект з файлу"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Новий модуль"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Примітка: Всі ключі будуть встановлені відповідно до обраної схеми."
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Відкриття файлу пакунка"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components"
msgstr "Вставити компоненти"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Зупинити програму"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Опублікувати проект"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Швидке компілювання, без компонування"
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Видалити активний файл з проекту"
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Виконати програму"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "ЗберегтиВсе"
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "ЗберегтиЯк"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Зберегти проект"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Зберегти проект як"
#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Вибрати кінець рядка"
#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Вибрати початок рядка"
#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Вибрати низ сторінки"
#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Вибрати верх сторінки"
#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Вибрати слово зліва"
#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Вибрати слово справа"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Встановити вільну закладку"
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set bookmark 0"
msgstr "Встановити закладку 0"
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set bookmark 1"
msgstr "Встановити закладку 1"
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set bookmark 2"
msgstr "Встановити закладку 2"
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set bookmark 3"
msgstr "Встановити закладку 3"
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set bookmark 4"
msgstr "Встановити закладку 4"
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set bookmark 5"
msgstr "Встановити закладку 5"
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set bookmark 6"
msgstr "Встановити закладку 6"
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set bookmark 7"
msgstr "Встановити закладку 7"
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set bookmark 8"
msgstr "Встановити закладку 8"
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set bookmark 9"
msgstr "Встановити закладку 9"
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Зупинити програму"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Перемкнути між модулем і формою"
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle bookmark 0"
msgstr "Перемкнути закладку 0"
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle bookmark 1"
msgstr "Перемкнути закладку 1"
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle bookmark 2"
msgstr "Перемкнути закладку 2"
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle bookmark 3"
msgstr "Перемкнути закладку 3"
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle bookmark 4"
msgstr "Перемкнути закладку 4"
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle bookmark 5"
msgstr "Перемкнути закладку 5"
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle bookmark 6"
msgstr "Перемкнути закладку 6"
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle bookmark 7"
msgstr "Перемкнути закладку 7"
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle bookmark 8"
msgstr "Перемкнути закладку 8"
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle bookmark 9"
msgstr "Перемкнути закладку 9"
#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Переглянути Асемблер"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Переглянути точки зупинки"
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Показати стек викликів"
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Перемкнути показ Оглядача коду"
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Перемкнути до перегляду Дослідник коду"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Перемкнути до перегляду палітри компонентів"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Переглянути журнал подій зневаджувача"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Переглянути повідомлення зневаджувача"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Перемкнути до перегляду Редактора документації"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Переглянути історію"
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Перемкнути до перегляду гарячих клавіш графічної оболонки"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Перегляд локальних змінних"
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Перемкнути до перегляду Повідомлень"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Перемкнути до перегляду Інспектора об'єктів"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr "Показати консольний ввід/вивід"
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Переглянути регістри"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Перемкнути до перегляду Результатів пошуку"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Перемкнути до перегляду Редактора програмного Коду"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Переглянути нитки"
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Показувати спостереження"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Переглянути історію переходів"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Переглядання опцій проекту"
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Переглядання тексту проекту"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Переглянути інформацію про модулі"
#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr "Останнє відкрите"
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Виконуваний застосунок є неправильним"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Командний рядок виконуваної програми"
#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Типове для Lazarus"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Тека Lazarus"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory to be used as a basedirectory"
msgstr "тека, що буде використана як базова"
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "ІСР Lazarus v%s"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Графічна оболонка Lazarus"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Мова графічної оболонки Lazarus (напр. en, uk, de, br, fi)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Назва мови для Lazarus (напр. english, deutsch, ukrainain)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [параметри] <назва файлу проекту>"
#: lazarusidestrconsts.lislazarussvnrev
msgid "r%s"
msgstr "r%s"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Дія"
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Виберіть вихідний каталог виконуваного файлу ІСР"
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Ви точно хочете видалити цей профіль збирання?"
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Зібрати багато"
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Загальні налаштування"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Підтвердити перед збиранням"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Підтвердьте видалення"
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "Зневадження ІСР"
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Визначення"
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Визначення без -d"
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Редагувати визначення"
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Редагувати список визначень, які можуть бути використані будь-яким профілем"
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Помилка запису файлу"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild не інтерактивний, зупиняю зараз."
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Керування профілями збирання"
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Керування профілями"
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Назва активного профілю"
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Додати новий профіль"
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Поточні параметри збирання будуть пов'язані з:"
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "Звичайне ІСР"
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "Оптимізований ІСР"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Параметри:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Опції, передані компілятору"
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Профіль для збирання"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Перейменувати профіль"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Нова назва для профілю:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Перезапустити після збирання ІСР"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Перезапустити Lazarus автоматично після збирання ІСР (не впливає на збирання інших частин)"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Виберіть профілі для збирання"
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Показати діалог підтвердження при збиранні безпосередньо з меню Інструментів"
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Показувати параметри і визначення для командного рядка"
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Для ЦП"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Цільова тека:"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Для ОС:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Неможливо записати файл \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Оновити revision.inc"
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Оновити дані про ревізію в діалозі \"Про Lazarus\""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Очистити + Зібрати все"
#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Версія Lazarus (наприклад, 1.2.4)"
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "Тип LCL widget"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Додати посилання до нащадка"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Копіювати з успадкованого"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s не має діючого шляху FPDoc.%sНеможливо створити файл fpdoc для %s"
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Пересунути включення до успадкованого"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Немає дійсного шляху FPDoc"
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Модуль %s не належить жодному пакунку чи проекту.%sДодайте модуль до пакунка або проекту.%sНеможливо створити fpdoc файл."
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Ліворуч"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Лівий бордюр. Це значення додається до базового бордюру і використовується для відступу зліва від контролю."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ліве якорювання"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Це елемент керування одного рівня, за яким зафіксовано лівий край. Залишити порожнім для фіксації за батьківським, як у Delphi (BorderSpacing і ReferenceSide не враховуються)."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Ліві краї"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Рівномірно ліві краї"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Менше"
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Рівні"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM файл"
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "Файл LFM містить невідомі властивості/класи, які не існують у LCL. Їх можна замінити або вилучити."
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Зламався файл LFM"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM справний"
#: lazarusidestrconsts.lislgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"Ця бібліотека є вільним програмним забезпеченням; ви можете поширювати її та змінювати на умовах ліцензії GNU Library General Public License v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation. \n"
"\n"
"Ця програма поширюється з надією, що вона буде корисною, але БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, зокрема не гарантується її придатність для певної мети. Докладнішу інформацію дивіться в ліцензії GNU LGPL. \n"
"\n"
"Ви повинні були отримати копію ліцензії GNU LGPL разом з бібліотекою; якщо ви її не отримали, напишіть листа до Free Software Foundation, Inc. за адресою 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "шлях до бібліотек"
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr "Спільна бібліотека Free Pascal (.dll під Windows, .so під Linux, .dylib під MacOS X)."
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Рядок:"
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Рядок/Довжина"
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Посилання:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "параметри компонувальника"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Ціль посилання"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "список всіх значень case"
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Завантаження %s провалилось."
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Завантажити макрос з"
#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr "&Локальна"
#: lazarusidestrconsts.lislocals
msgctxt "lazarusidestrconsts.lislocals"
msgid "Local Variables"
msgstr "Локальні змінні"
#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr "&Копіювати назву"
#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
msgid "Copy &RAW Value"
msgstr "Копіювати &сирі значення"
#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr "Ко&піювати значення"
#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr "Локальні не оцінені"
#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr "Стек викликів журналу"
#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr "(межа фреймів. 0 - необмежено)"
#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "Оцінити вираз"
#: lazarusidestrconsts.lislogmessage
msgid "Log Message"
msgstr "Повідомлення журналу"
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "рядок в нижньому регістрі"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter."
msgstr "Рядок у нижньому регістрі, поданий як параметр"
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "lpk зник з диска. Замість нього використовується%s"
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "lpk відсутній"
#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr "Файли ресурсів Lazarus (.lrs) для включення"
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Макрос %s"
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Введіть дані"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Введіть параметри запуску"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main unit has Application.CreateForm statements"
msgstr "Головний модуль має оператори Application.CreateForm"
#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
msgid "Main unit has Application.Scaled statement"
msgstr "Головний модуль має вираз Application.Scaled"
#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
msgid "Main unit has Application.Title statement"
msgstr "Головний модуль має вираз Application.Title"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "Головний модуль має секцію Uses, що містить всі модулі проекту"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "Головний модуль у сирцях Паскаля"
#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr "Вважати, що файл містить код на Pascal, навіть якщо він не має розширення .pas/.pp"
#: lazarusidestrconsts.lismakecurrent
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "Поточний"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Створити виконуваний"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make не знайдено"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Створити рядок ресурсу"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Додати до розділу"
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Рядок ресурсів \"%s\" вже існує. %sВиберіть іншу назву. %s Використовуйте Знехтувати, щоб все-таки додати."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Параметри перетворення"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Спеціальний ідентифікатор"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Ідентифікатор"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Довжина ідентифікатора:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Префікс ідентифікатора:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Вставити за алфавітом"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Вставити з врахуванням контексту"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Неправильна секція Resourcestring"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Виберіть секцію рядки ресурсів зі списку."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Рядок ресурсів вже існує"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Секція Resourcestring:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Переглядання коду"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Рядкова константа в коді"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Рядки з тим же значенням:"
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr "Пакунку необхідна вихідна тека."
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Керування редакторами сирців ..."
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr "Найбільше число потоків для паралельної компіляції. Типове значення 0 означає намагатись визначити число ядер процесорів у системі."
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr "Найбільше число паралельних процесів, 0 - типове значення (%s)"
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Макс %d"
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr "%s Може вам треба перезібрати пакунок."
#: lazarusidestrconsts.lismb
msgid "%s MB"
msgstr "%s МБ"
#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "Дія"
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Дамп пам'яті"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Перервати збирання"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Про FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Додати &точку зупинки"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Додати активний файл до пакунка ..."
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Додати точку переходу до історії"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Додати файл редактора до проекту"
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Додати &спостереження..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Розбивати рядки у вибраному"
#: lazarusidestrconsts.lismenubreak
msgid "&Break"
msgstr "&Перервати"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Зібрати файл"
#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Зібрати Lazarus з поточним профілем"
#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with Profile: %s"
msgstr "Зібрати Lazarus з профілем: %s"
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "Перевірити файл LFM у редакторі"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Очистити теку ..."
#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Очистити і зібрати ..."
#: lazarusidestrconsts.lismenucloseall
msgid "Close A&ll"
msgstr "Закрити всі"
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "&Закрити файл редактора"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Закрити проект"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "Редактор визначень CodeTools ..."
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Вибір коментаря"
#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Порівняти файли ..."
#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr "Компілювати у багатьох режимах ..."
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Завершити код"
#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr "Завершувати код (у діалозі)"
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Налаштувати файл збирання+виконання ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Налаштувати користувацькі компоненти ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Налаштувати зовнішні інструменти ..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Налаштувати \"Збирання Lazarus\" ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Контекстна довідка"
#: lazarusidestrconsts.lismenucontinue
msgid "&Continue"
msgstr "&Продовжити"
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Перетворення пакунка Delphi на пакунок Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Перетворення проекту Delphi в проект Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Перетворення модуля Delphi в модуль Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "Перетворити двійковий DFM в текстовий LFM + перевірка синтаксису ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Конвертувати кодування проектів/пакунків ..."
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Вікна зневадження"
#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Перетворення Delphi"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Зміни"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Кодові шаблони ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Редагувати контекстну довідку"
#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Встановити/Видалити пакунки ..."
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr "Клавішу (&&) швидкого виклику \"%s\" слід змінити"
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr "Додати новий елемент над вибраним"
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr "Додати новий елемент після вибраного"
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr "Додати новий елемент перед вибраним"
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr "Додати новий елемент під вибраним"
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr "Додати підменю праворуч від вибраного елемента"
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr "Додати підменю під вибраним елементом"
#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr "&Додати з шаблона ..."
#: lazarusidestrconsts.lismenueditoraddiconfroms
msgid "Add icon from %s"
msgstr "Додати значок з %s"
#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr "Додати &значок з ImageList"
#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr "Додати елемент меню"
#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr "&Додати новий елемент вище"
#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr "Додати &новий елемент після"
#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr "&Додати новий елемент перед"
#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr "Додати &новий елемент нижче"
#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr "Додати &обробник OnClick"
#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr "Додати &роздільник після"
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr "Додати роздільник &перед"
#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr "Додати підменю"
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr "Додати &підменю нижче"
#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr "Додати підменю п&раворуч"
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr "Збережено новий шаблон меню, описаний як \"%s\", на основі %s, з %d піделементами"
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr "&Зміни,Базове меню \"Зміни\",&Скасувати,Ctrl+Z,&Повернути,,-,,Ви&брати всі,Ctrl+A,В&ирізати,Ctrl+X,&Копіювати,Ctrl+C,В&ставити,Ctrl+V,Сп&еціальна вставка,,-,,&Знайти,,&Замінити,,&Перейти ...,,"
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr "&Файл,Базове меню \"Файл\",&Новий,,&Відкрити ...,,&Зберегти,,Зберегти &як,,-,,&Друк,,П&араметри друку ...,,-,,В&ихід,,"
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr "&Довідка,Базове меню \"Довідка\",Зміст,F1,&Покажчик,,Довідка у м&ережі,,-,,Відомості про &ліцензію,,&Перевірити оновлення,,-,,&Про програму,,"
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr "Вік&но,Базове меню \"Вікно\",&Нове вікно,,&Замостити,,&Каскадувати,,&Упорядкувати всі,,-,,Прихо&вати,,&Показати,,"
#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr "Заголовок"
#: lazarusidestrconsts.lismenueditorcaptioneditemss
msgid "Captioned items: %s"
msgstr "Елементів з заголовками: %s"
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr "Заголовок не може бути порожнім"
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
msgid "Change conflicting accelerator \"%s\""
msgstr "Змінити конфліктну швидку клавішу \"%s\""
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr "Змінити &значок з ImageList"
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
msgid "Change %s for %s"
msgstr "Змінити %s для %s"
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
msgid "Change shortcut conflict \"%s\""
msgstr "Змінити конфліктне сполучення клавіш \"%s\""
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
msgid "Change the shortCut for %s"
msgstr "Змінити значення shortCut для %s"
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
msgid "Change the shortCutKey2 for %s"
msgstr "Змінити значення ShortCutKey2 для %s"
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr "Виберіть шаблон для видалення"
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr "Виберіть шаблон для вставлення"
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr "Клацніть активний елемент для зміни сполучення клавіш або заголовок стовпця списку для упорядкування"
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr "Компонент неочікуваного виду"
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr "Компонент без назви"
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr "<розв'язування конфліктів завершено>"
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
msgid "Conflicts found initially: %d"
msgstr "Було знайдено конфліктів: %d"
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
msgid "Deepest nested menu level: %s"
msgstr "Глибина вкладеності меню: %s"
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "&Delete item"
msgstr "&Вилучити елемент"
#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr "&Видалити шаблон меню ..."
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr "Видалити збережений шаблон меню"
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr "Видалити вибраний шаблон меню"
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr "Видалити цей елемент і його піделементи?"
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr "Попередній перегляд як &спливне меню"
#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr "&Змінити заголовок"
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
msgid "Editing Caption of %s"
msgstr "Змінення заголовка %s"
#: lazarusidestrconsts.lismenueditoreditingsdots
msgid "To resolve conflict edit %s.%s"
msgstr "Для розв'язання конфлікту змініть %s.%s"
#: lazarusidestrconsts.lismenueditoreditingsfors
msgid "Editing %s for %s"
msgstr "Змінення %s для %s"
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
msgid "Editing %s.%s - no menuitem selected"
msgstr "Редагування %s.%s - елементи меню не вибрано"
#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr "Введіть &опис меню:"
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
msgid "Enter a new ShortCut for %s"
msgstr "Уведіть значення ShortCut для %s"
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
msgid "Enter a new ShortCutKey2 for %s"
msgstr "Уведіть значення ShortCutKey2 для %s"
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr "Наявні збережені шаблони"
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr "Додатковий конфлікт сполучень клавіш"
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr "Отримати довідку з користування цим редактором"
#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr "&Захопити клавішу"
#: lazarusidestrconsts.lismenueditorgroupindexd
msgid "GroupIndex: %d"
msgstr "GroupIndex: %d"
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
msgid "Values in use: %s"
msgstr "Наявні значення: %s"
#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr "Недостатній опис"
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
msgid "Insert menu template into root of %s"
msgstr "Вставити шаблон меню у корінь %s"
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr "Вставити вибраний шаблон меню"
#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr "не присвоєно"
#: lazarusidestrconsts.lismenueditoritemswithicons
msgid "Items with icon: %s"
msgstr "Елементи зі значками: %s"
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
msgid "List shortcuts and &accelerators for %s ..."
msgstr "Показати сполучення і &швидкі клавіші для %s ..."
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
msgid "List shortcuts for %s ..."
msgstr "Показати сполучення клавіш для %s ..."
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Редактор меню"
#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr "Дії з елементами меню"
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
msgid "Menuitem shortcut conflicts in %s"
msgstr "Конфлікти сполучень клавіш меню %s"
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Пересунути вниз (або вправо)"
#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr "Пере&містити елемент вниз"
#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr "&Перемістити елемент вліво"
#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr "Перемістити &елемент вправо"
#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr "Перемістити елемент &вгору"
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Перемістити вибраний елемент вниз"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr "Перемістити вибраний елемент вліво"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr "Перемістити вибраний елемент вправо"
#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Перемістити вибраний елемент вгору"
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Пересунути вгору (або вліво)"
#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr "недоступне"
#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr "(меню не вибрано)"
#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr "<немає>"
#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr "<немає>,<немає>"
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr "<немає конфліктів сполучень>"
#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr "Немає користувацьких шаблонів"
#: lazarusidestrconsts.lismenueditorpickaniconfroms
msgid "Pick an icon from %s"
msgstr "Додати значок з %s"
#: lazarusidestrconsts.lismenueditorpopupassignmentss
msgid "Popup assignments: %s"
msgstr "Присвоєнь зі спливного меню: %s"
#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr "Елемент-перемикач"
#: lazarusidestrconsts.lismenueditorremainingconflictss
msgid "Remaining conflicts: %s"
msgstr "Залишилось конфліктів: %s"
#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr "&Вилучити всі роздільники"
#: lazarusidestrconsts.lismenueditorresolvedconflictss
msgid "Resolved conflicts: %s"
msgstr "Розв'язані конфлікти: %s"
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr "Розв'язати вибраний конфлікт"
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr "&Розв'язати конфлікт сполучень ..."
#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr "Збережені шаблони"
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr "&Зберегти меню як шаблон ..."
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr "Зберегти меню як шаблон"
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr "Зберегти меню як шаблон для подальшого використання"
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr "Зберегти показане меню як новий шаблон"
#: lazarusidestrconsts.lismenueditorsconflictswiths
msgid "%s conflicts with %s"
msgstr "%s конфліктує з %s"
#: lazarusidestrconsts.lismenueditorseparators
msgid "Se¶tors"
msgstr "&Роздільники"
#: lazarusidestrconsts.lismenueditorshortcutitemss
msgid "Shortcut items: %s"
msgstr "Елементи сполучень: %s"
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr "Сполучення ще не змінено"
#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr "Сполучення"
#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr "Сполу&чення"
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr "Сполучення і швидкі клавіші"
#: lazarusidestrconsts.lismenueditorshortcutsd
msgid "Shortcuts (%d)"
msgstr "Сполучення (%d)"
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr "Сполучення (%d) і швидкі клавіші (%d)"
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr "Сполучення клавіш,Властивість-джерело"
#: lazarusidestrconsts.lismenueditorshortcutsusedins
msgid "Shortcuts used in %s"
msgstr "Сполучення використано в %s"
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
msgid "Shortcuts used in %s (%d)"
msgstr "Сполучення використано у %s (%d)"
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
msgid "ShowMenuEditor: TMenu parameter is nil"
msgstr "ShowMenuEditor: параметр TMenu є нульовим"
#: lazarusidestrconsts.lismenueditorsins
msgid "\"%s\" in %s"
msgstr "\"%s\" в %s"
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut.\n"
msgstr ""
"Сполучення клавіш \"%s\" вже використовується у %s.\n"
"Спробуйте інше.\n"
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr "Опишіть детальніше: \"%s\" занадто коротке"
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
msgid "Some widgetsets do not allow separators in the main menubar"
msgstr "Деякі бібліотеки віджетів не допускають роздільників у головному рядку меню"
#: lazarusidestrconsts.lismenueditorsshortcuts
msgid "%s: Shortcuts"
msgstr "%s: Сполучення"
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
msgid "%s: Shortcuts and accelerator keys"
msgstr "%s: Сполучення клавіш і швидкі клавіші"
#: lazarusidestrconsts.lismenueditorsssonclicks
msgid "%s.%s.%s - OnClick: %s"
msgstr "%s.%s.%s - OnClick: %s"
#: lazarusidestrconsts.lismenueditorssubmenu
msgid "%s submenu"
msgstr "Підменю %s"
#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr "Стандартні шаблони"
#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr "Опис шаблона:"
#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr "&Шаблони"
#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr "Шаблон збережено"
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available.\n"
msgstr ""
"Немає шаблонів меню, збережених користувачем.\n"
"\n"
"Доступні лише стандартні типові шаблони.\n"
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr "TSCList.GetScanListCompName: некоректний індекс %d у FScanList"
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict\n"
msgstr ""
"Слід змінити сполучення клавіш %s\n"
"для уникнення конфлікту.\n"
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr "Потрібно ввести текст заголовка"
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Вкласти в $IFDEF ..."
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Задужкувати вибране ..."
#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "Об&числити/Змінити..."
#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr "Приклади проектів ..."
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Витягти процедуру ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Файл"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Знайти"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Знайти ..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Знайти інший кінець блока коду"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Знайти початок блока коду"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Знайти опис під курсором"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Знайти посилання на ідентифікатор ..."
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "&Пошук у файлах ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Шукати &далі"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Знайти &попередній"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Знайти посилання використаних модулів"
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Параметри ..."
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Перейти за директивою Include"
#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Перейти до рядка ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Вгадати невідповідність IFDEF/ENDIF"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Вгадати незакінчений блок"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Довідка"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "Нутрощі ІСР"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Пошук за зростанням"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Зсунути вибране"
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Елемент ChangeLog"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Вставити з Таблиці символів ..."
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "Вставити ключ CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Поточні дата і час"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Вставити повну назву файлу ..."
#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Вставити загальні"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "Примітки GPL"
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "Зауваження GPL (перекладено)"
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "Примітки LGPL"
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "Зауваження LGPL (перекладено)"
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "Зауваження MIT"
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "Зауваження MIT (перекладено)"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Нотатки зміненої LGPL"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Зауваження зміненої LGPL (перекладено)"
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Поточне ім'я користувача"
#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "&Слідкувати за ..."
#: lazarusidestrconsts.lismenujumpback
msgid "Jump Back"
msgstr "Перейти назад"
#: lazarusidestrconsts.lismenujumpforward
msgid "Jump Forward"
msgstr "Перейти вперед"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Перейти до"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Перейти до реалізації"
#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr "Перейти до uses в реалізації"
#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr "Перейти до ініціалізації"
#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr "Перейти до інтерфейсу"
#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr "Перейти до uses в інтерфейсі"
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Перейти до наступної закладки"
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Перейти до наступної помилки"
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Перейти до попередньої закладки"
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Перейти до попередньої помилки"
#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr "Перейти до початку процедури"
#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr "Перейти до заголовка процедури"
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Вибір в нижньому регістрі"
#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr "Макрос редактора ..."
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Створити рядок ресурсу ..."
#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr "Мультивставка ..."
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Новий компонент"
#: lazarusidestrconsts.lismenunewcustom
msgid "New %s"
msgstr "Створити %s"
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Нова форма"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Новий..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Новий пакунок ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Новий проект ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Новий проект з файлу ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Новий модуль"
#: lazarusidestrconsts.lismenuok
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&Гаразд"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Мережева довідка"
#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Відкрити ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "Відкрити назву файлу над курсором"
#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr "Відкрити теку ..."
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Відкрити завантажений пакунок ..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Відкрити файл пакунка (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Відкрити пакунок поточного модуля"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Відкрити проект ..."
#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Відкрити не&давні"
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Відкрити недавній пакунок"
#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Відкрити недавній проект"
#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr "Відкрити модуль ..."
#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "Па&кунок"
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Граф пакунків"
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Зв'язки пакунка ..."
#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Вставити з буфера обміну"
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Новий компонент пакунка"
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Список процедур ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Проект"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Інспектор проекту"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Параметри проекту ..."
#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "Вико&нати"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Опублікувати проект ..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Швидка компіляція"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Швидка перевірка синтаксису"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Швидка перевірка синтаксису OK"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Прибрати з проекту ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Перейменувати ID ..."
#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Повідомити про ваду"
#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr "Перезаписати форми з увімкненою інтернаціоналізацією"
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Переглянути теку сирців FPC"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Скидання зневаджувача"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Зворотний експорт"
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Виконання"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Виконати файл"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "Пара&метри виконання ..."
#: lazarusidestrconsts.lismenuruntocursor
msgid "Step over to &Cursor"
msgstr "Виконати до &курсору"
#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr "Запустити без зневадження"
#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Зберегти"
#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Зберегти &як ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Зберегти проект"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Зберегти проект як ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "П&ошук"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Вибрати"
#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Вибрати все"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Вибрати блок коду"
#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Вибрати рядок"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Вибрати абзац"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Вибрати до дужки"
#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Вибрати слово"
#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Встановити вільну закладку"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "По&казати точку виконання"
#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr "Контекстно-залежна розумна підказка"
#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Сортування вибраного ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "&Сирці"
#: lazarusidestrconsts.lismenustepinto
msgid "Step In&to"
msgstr "Увій&ти"
#: lazarusidestrconsts.lismenustepintocontext
msgid "Step Into (Context)"
msgstr "Увійти (Контекст)"
#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "Увійти в інструкцію"
#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "Увійти в інструкцію"
#: lazarusidestrconsts.lismenustepout
msgid "Step O&ut"
msgstr "Пове&рнутись"
#: lazarusidestrconsts.lismenustepover
msgid "&Step Over"
msgstr "&Переступити"
#: lazarusidestrconsts.lismenustepovercontext
msgid "Step Over (Context)"
msgstr "Переступити (Контекст)"
#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "Переступити інструкцію"
#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "Переступити інструкцію"
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Перемкнути регістр у вибраному"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Табуляція в пробіли у вибраному"
#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "Про"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Перемкнути коментар в виборі"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Інструменти"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Розкоментувати вибране"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Скасувати відступ вибраного"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Верхній регістр для вибраного"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Додати модуль у секцію Uses ..."
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Вигляд"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Редактор прив'язок"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Асемблер"
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Точки зупину"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Стек викликів"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Оглядач коду"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Дослідник коду"
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Палітра компонентів"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Компоненти"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Журнал подій"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Повідомлення зневаджувача"
#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Форми ..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Історія"
#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Історії переходів"
#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Локальні змінні"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Повідомлення"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Інспектор об'єктів"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "&Показати код проекту"
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr "Консольний ввід/вивід"
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Регістри"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Оглядач обмежень"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Результати пошуку"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Редактор тексту"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Порядок за Таб"
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Нитки"
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Перемкнути форму/модуль"
#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Залежності модулів"
#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Інформація про модуль..."
#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Модулі..."
#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Вікно спостережень"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Що потребує збирання"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Вікно"
#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Інші таби"
#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr "Проекти"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Редактор повідомлень"
#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Вікно повідомлень"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Клас методу не знайдено"
#: lazarusidestrconsts.lismissingdirectory
msgid "missing directory \"%s\""
msgstr "відсутня тека \"%s\""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Пропущені події"
#: lazarusidestrconsts.lismissingexecutable
msgid "missing executable \"%s\""
msgstr "відсутній виконуваний файл \"%s\""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Відсутні ідентифікатори"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Пропущені пакунки"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Ваш вибір:"
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Закоментувати"
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Лише для Delphi"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Закоментувати вибрані модулі."
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Використовувати модулі лише для Delphi."
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Шукати модулі. Знайдені шляхи додати до параметрів проекту."
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Перервати зараз, встановити пакунки або виправити шляхи і спробувати знов."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Шлях пошуку модуля"
#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr "Пропустити цей модуль"
#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
msgstr ""
"<description>\n"
"\n"
"© <year> <copyright holders>\n"
"\n"
"Дана ліцензія дозволяє особам, які мають копію даного програмного забезпечення та супутньої документації (надалі іменуються «Програмне Забезпечення»), безоплатно використовувати Програмне Забезпечення без обмежень, включаючи необмежене право на використання, копіювання, змінення, додавання, публікування, розповсюдження, ліцензування та/або продаж копій Програмного Забезпечення, а також і особам, яким надається дане Програмне Забезпечення, при дотриманні таких умов:\n"
"\n"
"Зазначене вище повідомлення про авторське право і дані умови повинні бути включені в усі копії або значущі частини Програмного Забезпечення.\n"
"\n"
"ПРОГРАМНЕ ЗАБЕЗПЕЧЕННЯ НАДАЄТЬСЯ «ЯК Є», БЕЗ ЖОДНИХ ГАРАНТІЙ, ПРЯМО ПЕРЕДБАЧЕНИХ АБО ТАКИХ, ЩО МАЮТЬСЯ НА УВАЗІ, ЗОКРЕМА, АЛЕ НЕ ОБМЕЖУЮЧИСЬ ГАРАНТІЯМИ ТОВАРНОЇ ПРИДАТНОСТІ, ВІДПОВІДНОСТІ ЙОГО ПЕВНОМУ ПРИЗНАЧЕННЮ І ВІДСУТНОСТІ ПОРУШЕНЬ ПРАВ. НІ В ЯКОМУ РАЗІ АВТОРИ АБО ПРАВОВЛАСНИКИ НЕ БУДУТЬ НЕСТИ ВІДПОВІДАЛЬНІСТЬ ЗА БУДЬ-ЯКИМИ ЗАЯВАМИ ПРО ВІДШКОДУВАННЯ ВТРАТ, ЗБИТКІВ АБО ІНШИМИ ВИМОГАМИ ПРО ПОРУШЕННЯ УМОВ ЧИННИХ КОНТРАКТІВ, ДЕЛІКТІВ ЧИ ІНШОГО, ЩО ВИНИКЛИ ЧЕРЕЗ АБО ПОВ'ЯЗАНІ З ПРОГРАМНИМ ЗАБЕЗПЕЧЕННЯМ АБО ВИКОРИСТАННЯМ ПРОГРАМНОГО ЗАБЕЗПЕЧЕННЯ АБО ІНШИМИ ДІЯМИ З ПРОГРАМНИМ ЗАБЕЗПЕЧЕННЯМ.\n"
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Додатки і перекриття"
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Додати власні параметри:"
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Додати довільні параметри FPC, наприклад, -O1 -ghtl -dFlag"
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Застосувати до всіх пакунків."
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Застосувати до всіх пакунків і проектів."
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr "Застосувати до всіх пакунків з назвами \"%s\""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Застосувати до проекту."
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Створити нову групу параметрів"
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Власний параметр"
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "Видалити вибрану ціль або параметр"
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "Власні параметри не додано:"
#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr "Не має макросу ІСР %s:=%s"
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "Не перекривається OutDir (-FU)"
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr "Виключити всі пакунки з назвами \"%s\""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
msgid "expected \":=\" after macro name but found \"%s\""
msgstr "після назви макросу очікувалось \":=\", а виявлено \"%s\""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
msgid "expected macro name but found \"%s\""
msgstr "очікувалась назва макросу, а виявлено \"%s\""
#: lazarusidestrconsts.lismmfromto
msgid "From %s to %s"
msgstr "З %s до %s"
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "Макрос ІСР"
#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr "Макрос ІСР %s:=%s"
#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr "неправильний символ \"%s\" у %s"
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr "неправильний символ у значенні макросу \"%s\""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "пропущена назва макросу"
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Перемістити вибраний елемент вниз"
#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Перемістити вибраний елемент вгору"
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Нова ціль"
#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr "Перекривається OutDir (-FU): %s"
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Перекриття вихідної теки (-FU)"
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "Перекриття вихідної теки -FU цілі"
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Повернути останнє скасоване для цієї сітки"
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Задайте макрос ІСР, наприклад: LCLWidgetType:=win32"
#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr "Задайте \"%s\""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Збережено в ІСР (environmentoptions.xml)"
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Збережено у проекті (.lpi)"
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Збережено у сеансі проекту (.lps)"
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Цілі:"
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Скасувати останню зміну для цієї сітки"
#: lazarusidestrconsts.lismmusesystemencoding
msgid "Use system encoding"
msgstr "Використати системне кодування"
#: lazarusidestrconsts.lismmusesystemencodinghint
msgid "Disable support for UTF-8 default string encoding."
msgstr "Вимкнути підтримку типового кодування рядків UTF-8."
#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr "Значення \"%s\""
#: lazarusidestrconsts.lismmwas
msgid "(was \"%s\")"
msgstr "(було \"%s\")"
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr "Зміна WidgetSet доступна лише для LCL"
#: lazarusidestrconsts.lismode
msgid ", Mode: %s"
msgstr ", Режим: %s"
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"Ця бібліотека є вільним програмним забезпеченням; ви можете поширювати її та змінювати на умовах ліцензії GNU Library General Public License v2 або (на ваш розсуд) новішої версії, що видана Free Software Foundation з такими змінами: \n"
"\n"
"Як особливий виняток, власники авторських прав на цю бібліотеку дають вам дозвіл компонувати цю бібліотеку з незалежними модулями для створення виконуваних файлів, незалежно від умов ліцензії цих незалежних модулів, а також копіювати і поширювати отриманий виконуваний файл відповідно до умов на ваш вибір, за умови, що ви виконаєте для кожного пов'язаного незалежного модуля умови ліцензії цього модуля. Незалежний модуль - це модуль, який не отриманий з або на основі цієї бібліотеки. Якщо ви зміните цю бібліотеку, ви можете розширити цей виняток для вашої версії бібліотеки, але ви не зобов'язані це робити. Якщо ви не хочете це робити, видаліть цей виняток з вашої версії.\n"
"\n"
"Ця програма поширюється з надією, що вона буде корисною, але БЕЗ БУДЬ-ЯКИХ ГАРАНТІЙ, зокрема не гарантується її придатність для певної мети. Докладнішу інформацію дивіться в ліцензії GNU LGPL. \n"
"\n"
"Ви повинні були отримати копію ліцензії GNU LGPL з цією бібліотекою; якщо ви її не отримали, напишіть листа до Free Software Foundation, Inc. за адресою 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Змінити"
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Більше"
#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Більше"
#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Перемістити"
#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Перемістити файли"
#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "Перемістити файли?"
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Перемістити %s файл(и,ів) з %s до теки%s%s%sу %s?"
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Перемістити \"%s\" на позицію вниз"
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Перемістити \"%s\" на позицію вверх"
#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "Перемістити або скопіювати файли?"
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Перемістити або скопіювати %s файл(и,ів) з %s до теки%s%s%sу %s?"
#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Перемістити сторінку"
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Змістити вибраний елемент вниз (Ctrl+Down)"
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Змістити вибраний елемент вгору (Ctrl+Up)"
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Перемістити до:"
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Переміщення цих модулів зіпсує їхні секції Uses. Детальніше дивіться у вікні повідомлень."
#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr "Стиль C: \" => \\\""
#: lazarusidestrconsts.lismpescapequotes
msgid "Escape "es"
msgstr "Екранувати &лапки"
#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr "Мультивставка"
#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr "Стиль Pascal: ' => ''"
#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr "Параметри &вставки"
#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr "&Попередній перегляд"
#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr "Текст п&ісля кожного рядка"
#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr "Текст п&еред кожним рядком"
#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr "&Обрізати вміст буфера"
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(мс)"
#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr "Кольори повідомлення"
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr "Декілька тек, відокремлених крапкою з комою"
#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ", декілька пакунків:"
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Зберегти повідомлення у файл (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Назва"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Конфлікт назв"
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Назва активного режиму збирання"
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Назва нової процедури"
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Ніколи"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Новий"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Новий клас"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Новий консольний застосунок"
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Створити новий файл редактора.%s Виберіть тип."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Створити новий порожній текстовий файл."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Створити новий проект.%sВиберіть тип."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Створити новий стандартний пакунок%sПакунок - це набір модулів і компонентів."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Створити новий модуль з модулем даних."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Створити новий модуль з фреймом."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Створити новий модуль з формою LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Успадкувати з форми або компонента проекту"
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Не вибрано пункту"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Виберіть спочатку елемент"
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Нове кодування:"
#: lazarusidestrconsts.lisnewmacroname
msgid "Macro %d"
msgstr "Макрос %d"
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Нова назва макросу"
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr "Реалізації нових методів вставлено між наявними методами цього класу. За алфавітом, в кінці чи в порядку оголошення."
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr "Оголошення нових методів і членів у розділах class..end вставляються за алфавітом чи в кінці."
#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Нова сторінка"
#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(новий проект)"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Новий записаний макрос. Не збережений"
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "Нові модулі додаються в секцію uses"
#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Ні"
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Немає резервних файлів"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Профілів збирання не вибрано."
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Без змін"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Не вибрано коду"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Не успадковані параметри компілятора"
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "підказок немає"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Вікно ІСР не вибране"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Файл LFM відсутній"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Макрос не вибраний"
#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr "(повідомлення не вибрано)"
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "без назви"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%sжоден"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "жоден, клацніть щоб вибрати"
#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr "(Не вибрано)"
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "не вибрано вузлів"
#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "Файл Pascal відсутній"
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file \"%s\" found."
msgstr "Файл програми \"%s\" не знайдено."
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Не знайдено розділу в ResourceString"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Як правило фільтр є регулярним виразом. В простому синтаксисі a . є нормальним символом, a * відповідає за все, a ? відповідає за будь-який символ, а кома і крапка з комою відділяють альтернативи. Наприклад, простий синтаксис *.pas;*.pp переписується на ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Рядкову константу не знайдено"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "Не пакунок часу розробки"
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Не встановлювальний пакунок"
#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid Pascal identifier"
msgstr "Не є допустимим ідентифікатором Pascal"
#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr "Зауваження"
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Нижній"
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Ліворуч"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Справа"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Верхній"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "ЗАУВАЖЕННЯ: Неможливо створити означений шаблон для текстів Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "ЗАУВАЖЕННЯ: Неможливо створити означений шаблон для текстів Lazarus"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "шаблон не вибрано"
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
msgstr "Не вдалось знайти %s у %s у рядку %s, у стовпці %s.%sМожливо, повідомлення застаріло."
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Не реалізовано"
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Ще не реалізовано:%s%s"
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "не встановлено"
#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr "Невстановлені пакунки"
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Не зараз"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Завантажено: "
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Створити"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Створити новий проект"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "К-сть файлів для конвертування: %s"
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr "Показувати інспектор об'єктів при виборі компонентів у редакторі форм"
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - типово"
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "шлях до об'єкта"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Перейти на вкладку Обрані Інспектора об'єктів"
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Викл)"
#: lazarusidestrconsts.lisofpackage
msgid " of package %s"
msgstr " пакунка %s"
#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr " в інспекторі проекту"
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Додати до обраних властивостей"
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Виберіть базовий клас для обраної властивості \"%s\"."
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class \"%s\" not found."
msgstr "Клас \"%s\" не знайдено."
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Вилучити з обраних властивостей"
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "авто-встановити динамічно"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "авто-встановити статично"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Опис: "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sОпис: %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Назва файлу: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "встановлено динамічно"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "встановлено статично"
#: lazarusidestrconsts.lisoiplicenselicense
msgid "%sLicense: %s"
msgstr "%sЛіцензія: %s"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "відсутній"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "змінено"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Відкрити завантажений пакунок"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Назва Пакунку"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Виберіть пакунок"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "тільки для читання"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Стан"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%sЦей пакунок вже встановлений, але файлу lpk не знайдено"
#: lazarusidestrconsts.lisok
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "Гаразд"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Старий клас"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (Вкл)"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "При розриванні рядка (тобто при натисканні клавіші Enter)"
#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr "доступні в головному сховищі"
#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr "лише 32біт"
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr "Лише для Windows. Запускати прихованим."
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr "Лише для Windows. Запускати у новій консолі."
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr "Лише повідомлення, що відповідають регулярному виразу:"
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr "Лише повідомлення з такими ідентифікаторами FPC (розділені комами):"
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr "Лише зареєструвати файли пакунків Lazarus (.lpk). Не збирати."
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Шукати лише для повних слів"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "При вставці з буферу обміну"
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Відкрити"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Відкрити як XML-файл"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Відкривати дизайнер при відкритті модуля"
#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr "Форма завантажується в Дизайнер при кожному відкритті сирцевого модуля."
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Відкрити наявний файл"
#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Відкрити файл"
#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Відкрити файл"
#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr "Відкрити файл біля курсору"
#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr "Відкрити у файловому менеджері"
#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr "Відкрити цільову теку у файловому менеджері"
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Відкрити %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Відкрити пакунок?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Відкрити пакунок %s"
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Відкрити файл пакунка"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Відкрити проект?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Відкрити проект"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Відкрити проект знову"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Відкрити файл проекту"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Відкрити символьне посилання"
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Відкрити ціль"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Відкрити файл як текст програми"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Відкрити пакунок %s"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Відкрити проект %s"
#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr "Відкрити діалог параметрів"
#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr "Відкрити модуль"
#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr "Відкрити URL"
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Відкритий XML"
#: lazarusidestrconsts.lisoptions
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Параметри"
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr "Опції змінені, перезбираю начисто з -B"
#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr "знехтувано"
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "або"
#: lazarusidestrconsts.lisos
msgid ", OS: %s"
msgstr ", ОС: %s"
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr "список шляхів до \"інших модулів\" пакунка \"%s\" містить теку \"%s\", яка вже є у списку шляхів пошуку модулів."
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr "кінцева тека %s містить джерело модуля Pascal \"%s\""
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Підмінити мову. Наприклад --language=de. Для можливих величин див. теку languages"
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr "Перекрити типи рядка результатів функції типом виразу першого параметра"
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%sперевизначити типовий компілятор. напр. ppc386 ppcx64 ppcppc і т.д. типовий міститься в environmentoptions.xml"
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project or IDE build mode."
msgstr "%sперекрити режим збирання проекту чи ІСР."
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%sперевизначити цп проекту. напр. i386 x86_64 powerpc powerpc_64 etc. типовий: %s"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%sперевизначити операційну систему проекту. напр. win32 linux. типова: %s"
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%sперевизначити набір віджетів проекту. напр. gtk gtk2 qt win32 carbon. типовий: %s"
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Переписати файл?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Переписати файл на диску"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Власник' вже використовується в TReader/TWriter. Виберіть іншу назву."
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Пакунок"
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "пакунок %s"
#: lazarusidestrconsts.lispackage3
msgid ", package %s"
msgstr ", пакунок %s"
#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Інфо про пакунок"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Назва пакунка починається з ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Назва пакунка містить ..."
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr "Пакунку необхідна вихідна тека."
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Пакунок потрібно встановити"
#: lazarusidestrconsts.lispackageoption
msgid "Package \"%s\" Option"
msgstr "Параметри пакунка \"%s\""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Вихідні теки пакунка"
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Теки з сирцями пакунка"
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr "пакунків=%s/%s модулів=%s/%s ідентифікаторів=%s/%s рядків=%s байтів=%s"
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "модуль пакунка"
#: lazarusidestrconsts.lispage
msgid "Page"
msgstr "Сторінка"
#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr "Назва сторінки"
#: lazarusidestrconsts.lispagenamealreadyexists
msgid "Page name \"%s\" already exists. Not added."
msgstr "Назва сторінки \"%s\" вже існує. Не додано."
#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr "Паніка"
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", проаналізовано "
#: lazarusidestrconsts.lisparser
msgid "parser \"%s\": %s"
msgstr "аналізатор \"%s\": %s"
#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr "Аналізатори:"
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Кількість Проходів"
#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
msgid "passing compiler define \"%s\" twice with different values"
msgstr "неодноразове передавання визначення компілятора \"%s\" з різними значеннями"
#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
msgid "passing compiler option -%s twice with different values"
msgstr "неодноразове передавання визначення компілятора -%s з різними значеннями"
#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Вставити"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "вставити буфер обміну"
#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Вставити з буфера обміну."
#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr "Пастельні кольори"
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Шлях"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Переглянути"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Видалити недійсні Шляхи"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Зсунути шлях вниз (Ctrl+Down)"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Зсунути шлях вверх (Ctrl+Up)"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Додати новий шлях до списку"
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Видалити вибраний шлях"
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Видалити зі списку шляхи, які не існують (сірі)"
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Замінити вибраний шлях новим шляхом"
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Додати шаблон в список"
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Шляхи шаблонів"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Шляхи пошуку:"
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "шлях кешу instantfpc"
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Шлях утиліти make"
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Шлях до невдалого примірника:"
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Пауза"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Очистити для використання назви пакунка"
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Вимкнути I18N в lfm"
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr "Додати файли з файлової системи"
#: lazarusidestrconsts.lispckeditaddotheritems
msgid "Add other items"
msgstr "Додати інші елементи"
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Додати до проекту"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Застосувати зміни"
#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr "(доступні онлайн)"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Викликати процедуру %sRegister%s вибраного модуля"
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Очистити залежності ..."
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Очистити типову/бажану назву файлу залежності"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Скомпілювати всі?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Компіляція пакунка"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Параметри компілятора для пакунка %s"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "Створити fpmake.pp"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Створити Makefile"
#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, стандартний: %s"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Властивості залежності"
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit general options"
msgstr "Змінити загальні параметри"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Властивості файлу"
#: lazarusidestrconsts.lispckeditfpmakepackage
msgid "(fpmake)"
msgstr "(fpmake)"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Встановити"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Неправильна найвища версія"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Неправильна найнижча версія"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Найвища версія"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Найнижча версія"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Змінено: %s"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Пересунути залежність вниз"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Пересунути залежність вверх"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Пакунок %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Пакунок \"%s\" змінено.%s Зберегти пакунок?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "пакунок%s не збережений"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Сторінка: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Оновити залежність"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Оновити файл"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Тільки для читання:%s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Необхідно перекомпілювати все"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Перекомпілювати начисто"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Перекомпілювати це, а також і всі потрібні пакунки?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Зареєстровані доповнення"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Зареєструвати модуль"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Видалити залежність"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Видалити залежність?"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Видалити залежність \"%s\"%sз пакунка \"%s\"?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Видалені файли"
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Видалені необхідні пакунки"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Видалити файл"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Видалити файл?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Видалити файл \"%s\"%s з пакунка \"%s\"?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Видалити вибраний елемент"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Необхідні пакунки"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Зберегти пакунок"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Зберегти назву файлу як типову для цієї залежності"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Зберегти назву файлу як бажану для цієї залежності"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Найвища версія \"%s\" не є правильною версією пакунка.%s(гарний приклад 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Найнижча версія \"%s\" не є правильною версією пакунка.%s(гарний приклад 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Видалити"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Продивитись код пакунка"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "Базовий, не може бути видаленим"
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Встановлено"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Встановити при наступному запуску"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sСтан: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Видалити при наступному запуску (якщо не потрібен іншому пакунку)"
#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Деінсталювати пакунок %s"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Додати параметри до підпорядкованих пакунків і проектів"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Додати шляхи до залежних пакунків/проектів"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Автор"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Перезібрати за необхідністю автоматично"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Перезібрати автоматично при перезбиранні всіх"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Спеціальний"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Опис / Абстрактно"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Час розробки"
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "При розробці і запуску"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Інтегрування в ІСР"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Вставити"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Неправильний тип пакунка"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Бібліотека"
#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Ліцензія"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Компонувальник"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Важливий"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Компіляція вручну (ніякої автоматизації)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Другорядний"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Об'єкт"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Параметри пакунка"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Тип пакунка"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Забезпечує"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Версія"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Час виконання"
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Пакунок \"%s\" має мітку Автовстановлення.%sЦе означає, що він автоматично вмонтується в ІСР. Встановлювані пакунки%sмають бути пакунками для розробки."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Цей пакунок пропонує те саме що і такі пакунки:"
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Оновити/Перезібрати"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Використання"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Пакунок:"
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Пошукові шляхи для fpdoc xml-файлів. Кілька шляхів повинні бути розділені комою."
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Показати непотрібні залежності"
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Коли форму буде збережено, ІСР може зберігати всі властивості TTranslateString до файлу po. Для цього необхідно включити I18N для цього пакунка, забезпечити вихідну теку po і зняти цей прапорець."
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Перервати"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Перебіг"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Згорнути теку"
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Знайдений конфлікт"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Змінити віртуальний модуль"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Розгорнути каталог"
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Назва файлу"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Виправити регістр файлів"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Неправильна назва файлу модуля"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Неправильна назва модуля"
#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr "Загублені файли пакунка %s"
#: lazarusidestrconsts.lispendingon
msgid "Pending (On)"
msgstr "Очікування (Увімкн.)"
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Новий файл не в шляху включення"
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Немає втрачених файлів. Всі на місці."
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Видалити файли"
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Повернути пакунок"
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Зберегти пакунок як ..."
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Показати структуру тек"
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Показати загублені файли"
#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Сортувати файли остаточно"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Упорядкувати файли за алфавітом"
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "Файл \"%s\" зараз не є в шляху включення пакунка.%sДодати \"%s\" в шлях включення?"
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Назва модуля:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Викор. всі модулі в теці"
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Не викор. модулі в теці"
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Очищення залежностей пакунків"
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Зняти вибір"
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Додавання CompiledSrcPath"
#: lazarusidestrconsts.lispkgdefsnamespaces
msgid "Namespaces"
msgstr "Простори назв"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Вихідна тека"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Позначити теку сирців пакунка"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Шлях до модулів"
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Видалити залежності"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Ви дійсно бажаєте забути всі зміни до пакунка %s і завантажити його з файлу?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Новий модуль не знаходиться в шляху до модулів"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Опублікувати пакунок"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Повернути пакунок?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "Файлу \"%s\"%sзараз немає у списку шляхів модулів пакунка.%sДодати \"%s\" до шляхів модуля?"
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr "Більше функцій для пакунка"
#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Бінарне"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Включити файл"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "xml файл питань"
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "Текст форми LFM - Lazarus"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "Ресурс LRS - Lazarus"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Головний модуль"
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Текст"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Віртуальний модуль"
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Тека пакунка. Параметром є ID пакунка, наприклад \"Name\" або \"Name 1.0\""
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Шлях пошуку заголовних файлів пакунка. Параметром є ID пакунка, наприклад, \"Name\" або \"Name 1.0\""
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Назва пакунка. Параметром є ID пакунка, наприклад \"Name\" або \"Name 1.0\""
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Вихідна тека пакунка. Параметром є ID пакунка, напр., \"Name\" or \"Name 1.0\""
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Шлях пошуку сирців пакунка. Параметром є ID пакунка, наприклад, \"Name\" або \"Name 1.0\""
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Шлях пошуку модуля пакунка. Параметром є ID пакунка, наприклад, \"Name\" або \"Name 1.0\""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sДодавання нової залежності для пакунка %s: пакунок %s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sДодавання нової залежності до проекту %s: пакунок %s"
#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr "Додати модуль до частини uses головного файлу пакунка. Унеможливити це тільки для модулів, які в жодному випадку не треба компілювати"
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Знайдено модулі з однаково розпізнаними назвами"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Автом. встановлені пакунки"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sОбидва пакунки є пов'язаними. Це означає, що або один із них використовує інший, або обидва вони використовуються третім пакунком."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Залежність порушена"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Знайдені кругові залежності"
#: lazarusidestrconsts.lispkgmangcompilepackage
msgid "Compile package %s"
msgstr "Скомпілювати пакунок %s"
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Видалення не вдалося"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Видалити старий файл пакунка?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file \"%s\"?"
msgstr "Видалити старий файл пакунка \"%s\"?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Залежність без власника:%s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Помилка читання файлу"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Помилка читання пакунка"
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Помилка: оновлення po файлу не вдалось для пакунка %s"
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Помилка запису файлу"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Помилка запису пакунка"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Файл вже є у пакунку"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Файл у проекті"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Назва файлу відрізняється від назви пакунка"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Назву файлу використано іншим пакунком"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Назву файлу використано проектом"
#: lazarusidestrconsts.lispkgmangfilenotfound
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "Файл \"%s\" не знайдено."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Файл не збережений"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "При встановленні пакунка %s буде автоматично встановлено пакунок:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "При встановленні пакунка %s будуть автоматично встановлені пакунки:"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "неправильна назва файлу компілятора"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Неправильне розширення файлу"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Неправильне розширення файлу пакунка"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Неправильна назва файлу пакунка"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Неправильна назва пакунка"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Неправильна назва пакунка"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Завантаження пакунка %s замінить пакунок%s%s з файлу %s.%sСтарий пакунок змінено.%sЗберегти старий пакунок%s?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "НовийПакунок"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Пакунок: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Конфлікти пакунків"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "Пакунок не є пакунком часу розробки"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Потрібен пакунок"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "головний сирцевий файл пакунка"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Така назва пакунка вже існує"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Пакунки повинні мати розширення файлів .lpk"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Спочатку скомпілюйте пакунок."
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Збережіть файл перед додаванням в пакунок."
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Проект: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Перезібрати Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Перейменувати файл у нижній регістр?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file \"%s\"?"
msgstr "Замінити наявний файл \"%s\"?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Замінити файл"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Один або кілька необхідних пакунків не були знайдені. Дивіться граф пакунків."
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name.\n"
msgstr ""
"Пакунок %s вже відкрито в ІСР.\n"
"Неможливо зберегти пакунок з такою ж назвою.\n"
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Зберегти пакунок?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Зберегти пакунок%s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Чи треба змінити назву файлу на нижн. рег. на %s\"%s\"?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Пропустити цей пакунок"
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "статичний файл налаштувань пакунка"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "Файл компілятора для пакунка %s не є виконуваним:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "Файл \"%s\"%sвже у пакунку %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file \"%s\" is not a Lazarus package."
msgstr "Файл \"%s\" не є пакунком Lazarus."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "Назва файлу \"%s\" не відповідає назві пакунка \"%s\" у файлі.%sЗмінити назву пакунка на \"%s\"?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "Назва файлу \"%s\" є частиною поточного проекту.%sПроекти і пакунки не мають ділити файли."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "Назва файлу \"%s\"використовується%sпакунком \"%s\"%sу файлі \"%s\"."
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr "Файл \"%s\" пакунка %s не знайдено."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Не вдалось завантажити такий пакунок:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Не вдалось завантажити такі пакунки:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sТакі модулі будуть додані до розділу uses %s%s:%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
msgstr "Пакунок \"%s\" не компілюється.%sВидалити його зі списку встановлення?"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "Назва пакунка \"%s\" у%s\"%s\" не є правильною назвою пакунка Lazarus."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Пакунок %s є пакунком тільки часу виконання.%sТакі пакунки не можуть бути встановлені в ІСР."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "Пакунок \"%s\" компілюється автоматично, а його вихідна тека - \"%s\", яка знаходиться в типовому шляху пошуку модулів компілятора. Пакунок використовує інші пакунки, які також використовують типовий шлях пошуку модулів компілятора. Це створює нескінченний цикл.%sВи можете виправити це, видаливши шлях з конфігурації компілятора (напр. fpc.cfg),%sабо вимкнувши автооновлення цього пакунка, або видаливши залежності."
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Пакунок \"%s\" позначено для встановлення, але його не було знайдено.%sВидалити залежність зі списку встановлення пакунків?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "Пакунок %s потребується для %s, який був позначеним для встановлення.%sДив. діаграму пакунків."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Назва пакунка \"%s\" є некоректною.%sВиберіть інший пакунок (напр., package1.lpk)."
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "Назва пакунка \"%s\" %sфайлу \"%s\" є некоректною."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Пакунок \"%s\" позначено.%sЗараз Lazarus підтримує тільки статично пов'язані пакунки. Поточне видалення потребує перезбирання і перезапуску Lazarus.%sВи бажаєте перезібрати Lazarus зараз?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Пакунок \"%s\" позначено для встановлення.%sЗараз Lazarus підтримує тільки статично пов'язані пакунки. Поточна установка потребує перезбирання і перезапуску Lazarus.%sВи бажаєте перезібрати Lazarus зараз?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Проект вимагає пакунка \"%s\".%sАле його не знайдено. Див. Проект -> Інспектор проекту."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Існує два модулі з однаковими назвами:%s1. \"%s\" з %s%s2. \"%s\" з %s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "В пакунках є кільцева залежність. Дивіться граф пакунків."
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Існує модуль FPC з такою самою назвою, як і пакунок:%s\"%s\""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Існує модуль FPC з такою самою назвою, як:%s\"%s\" з %s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Вже існує іншій пакунок з назвою \"%s\".%sКонфліктний пакунок:\"%s\"%sФайл: \"%s\""
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Вже завантажено пакунок \"%s\" %sз файлу \"%s\".%sДив. Пакунок -> Діаграма пакунків.%sЗаміна неможлива."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Посеред необхідних пакунків є не збережений. Див. діаграму пакунків."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Існує модуль з такою самою назвою, як і пакунок: %s1. \"%s\" з %s%s2. \"%s\""
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Це віртуальний пакунок. В нього немає коду. Збережіть спочатку пакунок."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Неможливо створити теку"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory \"%s\"%sfor package %s."
msgstr "Неможливо створити теку виведення \"%s\"%sдля пакунка %s."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory \"%s\"%sfor package %s."
msgstr "Неможливо створити теку сирців пакунка \"%s\"%sдля пакунка %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Неможливо створити теку цілі для Lazarus:%s\"%s\".%sЦя тека потрібна для оновленого ІСР Lazarus з вашими пакунками."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file \"%s\"."
msgstr "Неможливо видалити файл \"%s\"."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Неможливо видалити файл"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file \"%s\"%sfor package %s."
msgstr "Неможливо видалити старий файл \"%s\"%sдля пакунка %s."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Неможливо завантажити пакунок"
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
msgstr "Неможливо відкрити пакунок\"%s\".%sЦей пакунок було позначено для встановлення."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
msgstr "Неможливо прочитати файл стану \"%s\"%sпакунку %s.%sПомилка: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Неможливо записати пакунок \"%s\"%sу файл \"%s\".%sПомилка: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
msgstr "Неможливо записати файл стану \"%s\"%sпакунку %s.%sПомилка: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Видалити пакунок?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Видалити пакунок%s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Не збережений пакунок"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Викор. модуль"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Увага: файл \"%s\"%sналежить поточному проекту."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "залишити"
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "новий"
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "видалити"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Виберіть пакунок"
#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "Встановлено"
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Cannot register components without unit"
msgstr "Неможливо зареєструвати компоненти без модуля"
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class \"%s\" already defined"
msgstr "Клас компонента \"%s\" вже визначено"
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: \"%s\""
msgstr "%s%sНазва файлу: \"%s\""
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Неправильний клас компонента"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Неправильна назва модуля: %s"
#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: \"%s\""
msgstr "%s%slpk файл: \"%s\""
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Файл пакунка не знайдено"
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "Помилка реєстрації пакунка"
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Порожня процедура реєстрації"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called but no package is registering."
msgstr "Було викликано RegisterUnit, але пакунків не зареєстровано."
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr "%s%sФайл lpk не знайдено."
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "Пакунок \"%s\" встановлено, але не знайдено правильного файлу з пакунком (.lpk).%sБуло створено неробочий фіктивний пакунок."
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Це типовий пакунок. Використовується тільки для компонентів без пакунка. Такі компоненти є застарілими."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Цей пакунок встановлено, але lpk-файл не знайдено. Всі його компоненти деактивовано. Будь-ласка, виправте проблему."
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: \"%s\""
msgstr "%s%sНазва модуля: \"%s\""
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr "Модуль \"%s\" не знайдено в lpk файлі.%sНапевне цей lpk файл не був використаний для збирання цього ІСР. Або пакунок зловживає процедурою RegisterUnit."
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr "Модуль \"%s\" був видалений з пакунка (lpk)"
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr "Перелічені залежності не потрібні через автоматичне перенесення залежностей між пакунками."
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "Проект перекриває вихідні теки перелічених пакунків.%sДив. Проект -> Параметри проекту (розділ параметрів компілятора) -> Додатки і перекриття%s%s"
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Цього файлу немає у всіх завантажених пакунках."
#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr "Перенесення"
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Неможливо прочитати файл пакунка \"%s\".%sПомилка: %s"
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Відтворити"
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Глобальна"
#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr "Мережні"
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr "Онлайнові пакунки неможливо видалити"
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Зв'язки пакунка"
#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr "Показувати глобальні зв'язки у "
#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr "Показувати мережні посилання"
#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr "Показувати користувацькі зв'язки у "
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr "Деякі пакунки неможливо видалити"
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Користувацька"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr "Виправте помилку, показану у вікні повідомлень, яке зазвичай розташоване під редактором сирцевого коду."
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Відкрийте модуль перед запуском."
#: lazarusidestrconsts.lispleaseselectatleastonebuildmode
msgid "Please select at least one build mode."
msgstr "Виберіть принаймні один режим побудови."
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Виберіть трохи коду, щоб витягти нову процедуру/метод."
#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Всі>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Змінити шрифт"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Копіювати назву методу з буферу обміну"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Фільтр за збіжністю будь-якої частини метода"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Фільтр за збіжністю початку метода"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Перейти до вибраного"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<нічого>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Об'єкти"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Список процедур"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Тип"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Виберіть теку з файлом .po"
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Не зберігати ніякої сесії"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Вказівник"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr "Зберегти у файлі .lps у теці конфігурації ІСР"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Зберегти у файлі .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Зберегти у файлі .lpi в теці проекту"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Зберегти інформацію про сесію в"
#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ".lpi - головний файл інформації проекту, .lps - окремий файл лише для даних сеансу."
#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr "Положення"
#: lazarusidestrconsts.lispositionoutsideofsource
msgid "%s (position outside of source)"
msgstr "%s (положення за межами сирців)"
#: lazarusidestrconsts.lisppuinwrongdirectory
msgid "ppu in wrong directory=%s."
msgstr "PPU у неправильній теці=%s."
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr "%s.ppu не знайдено. Перевірте файл fpc.cfg."
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Попереднє слово"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory where Lazarus stores its config files. Default is "
msgstr "тека головних налаштувань, де Lazarus зберігає свої файли налаштувань. Типово"
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Основний шлях конфігурації"
#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr "перед %s"
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Пріоритет"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Приватний"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Приватний метод"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Можливо, потрібно встановити деякі пакунки перед тим, як продовжувати.%sПопередження:%sПроект використовує такі пакунки часу розробки, які можуть знадобитись для відкриття форми у дизайнері. Якщо Ви продовжите, ви можете отримати помилки через відсутність компонентів і завантаження форми, найпевніше, призведе до неприємних результатів.%sРекомендується скасувати та спочатку встановити ці пакунки."
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Процедура"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Процедура з інтерфейсом"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Програма"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Виявлена програма"
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Програма Free Pascal для командного рядка з деякими корисними налаштуваннями."
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Текст програми повинен мати розширення Pascal, напр., .pas, .pp або .lpr"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Залежність вже існує"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Додати файли редактора"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Неправильна версія (Min-Max)"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid Pascal unit name"
msgstr "Неправильна назва модуля Pascal"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Неправильна версія"
#: lazarusidestrconsts.lisprojaddlocalpkg
msgid "Local (%s)"
msgstr "Локальні (%s)"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Найвища версія (не обов'язково)"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Найнижча версія (не обов'язково)"
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr "Нова залежність FPMake"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Нова вимога"
#: lazarusidestrconsts.lisprojaddonlinepkg
msgid "Online (%s)"
msgstr "Онлайнові (%s)"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Назва пакунка:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Пакунок не знайдено"
#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr "Тип пакунка:"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "Залежності \"%s\" не знайдено.%sВиберіть наявний пакунок."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Найвища версія \"%s\" некоректна.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Найвища версія менша за найнижчу."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Найнижча версія \"%s\" є некоректною.%sВикористовуйте формат головний.вторинний.реліз.збірка%sНаприклад: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Проект вже залежить від пакунка \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "Назва модуля \"%s\" вже існує у проекті%sу файлі: \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "Назва модуля \"%s\" вже є у вибраному%sу файлі: \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name \"%s\" is not a valid Pascal identifier."
msgstr "Назва модуля \"%s\" не є правильним ідентифікатором Pascal. "
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Назва модуля вже існує"
#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr "Проект %s"
#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Проект:"
#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "проект"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Проект змінено"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Проект змінився на диску"
#: lazarusidestrconsts.lisprojectcount
msgid "%d projects"
msgstr "%d проектів"
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Тека проекту"
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Назва на панелі завдань показує також шлях до теки проекту"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Назва файлу проекту"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Шляхи, що включені до проекту"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Виявлено info-файл проекту"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Проект є виконуваним"
#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr "Створюється двійковий виконуваний файл, який можна запустити."
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Проект"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Властивості макросів проекту"
#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr "Простори назв проекту"
#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Параметр проекту"
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Вихідна тека проекту (напр. тека ppu)"
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Вихідна тека проекту"
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Тека з основним файлом проекту повинна бути"
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Сеанс проекту"
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "Сеанс проекту змінився"
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Теки сирців проекту"
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s За адресою %1:x"
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Проект %s зазнав винятку класу '%s'."
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Проект %s зазнав винятку класу '%s' з повідомленням:%s%s"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s У файлі '%1:s' за адресою %2:x"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s У файлі '%1:s' рядок %2:d"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:s У файлі '%1:s' рядок %2:d:%0:s%3:s"
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Шлях до сирців проекту"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "модуль проекту"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Шлях до модулів проекту"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Майстер Проектів"
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Підтвердити видалення залежності"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Підтвердіть видалення файлу"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Видалити залежність для %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Інспектор проекту - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Видалені необхідні пакунки"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Видалити файл %s з проекту?"
#: lazarusidestrconsts.lisprojinspremoveitemsf
msgid "Remove %s items from project?"
msgstr "Вилучити %s елементів з проекту?"
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Неможливо прочитати файл стану %s проекту %s%sПомилка: %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Неможливо записати файл стану у проект %s%sПомилка: %s"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Завжди збирати (навіть якщо нічого не мінялось)"
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr "Може знадобитись, коли є помилка перевірки залежностей; зазвичай не потрібно."
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Помилка"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Неможливо змінити список автостворюваних форм в коді програми.%sВиправте спочатку помилки."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Мітка теки програмних файлів проекту"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Довідка за значенням"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Властивості (замінити чи видалити)"
#: lazarusidestrconsts.lisproperty
msgid "%s property"
msgstr "властивість %s"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Захищений"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Захищений метод"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Спільний метод"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Опублікований метод"
#: lazarusidestrconsts.lispublishedto
msgid "Published to %s"
msgstr "Опубліковано в %s"
#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr "Файли, що належать до проекта / пакунка, буде включено автоматично."
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Тека публікації проекту"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Опублікувати проект"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Зберігати .lrs файли в кінцеву теку"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr "Ресурс буде доступний для FPC."
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Модуль Pascal повинен мати розширення .pp або .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Редагувати віртуальний модуль"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Вже є модуль з такою назвою. %sФайл: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Назва модуля не є правильним ідентифікатором Pascal. "
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "Назва модуля використана графічною оболонкою при розширенні користувацьких виразів"
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Назва модуля і Назва файлу не збігаються.%sНаприклад: unit1.pas і Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Конвертувати проект &Delphi"
#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "&Новий проект"
#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "Від&крити проект"
#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Відкрити не&давній проект"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Переглянути &приклади проектів"
#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "Помилка QuickFix"
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Швидкі виправлення"
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Шв. випр: Видалити модуль"
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Шукати ідентифікатор"
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Вийти"
#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "&Вийти з Lazarus"
#: lazarusidestrconsts.lisrange
msgctxt "lazarusidestrconsts.lisrange"
msgid "Range"
msgstr "Діапазон"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Помилка читання"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Справді видалити?"
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Недавні вкладки"
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Запис"
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Записано"
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Запис/Структура"
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Повернути"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Регістри"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Регулярний вираз"
#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Відносно"
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Відносні шляхи"
#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Видалити"
#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Вилучити?"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Видалити всі некоректні властивості"
#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Вилучити всі фільтри повідомлень за типами"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Видалити всі модулі"
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Не приховувати повідомлення параметром компілятора"
#: lazarusidestrconsts.lisremovedependenciesfrompackage
msgid "Remove %s dependencies from package \"%s\"?"
msgstr "Вилучити %s залежностей з пакунка \"%s\"?"
#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr "Вилучено властивість \"%s\"."
#: lazarusidestrconsts.lisremovefilesfrompackage
msgid "Remove %s files from package \"%s\"?"
msgstr "Вилучити %s файлів з пакунка \"%s\"?"
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Видалити з списку встановлення"
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Видалити з проекту"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Видалити з пошукового шляху"
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Видалити включений шлях?"
#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Видалити локальну змінну %s"
#: lazarusidestrconsts.lisremovelocalvariable3
msgid "Remove local variable \"%s\""
msgstr "Вилучити локальну змінну \"%s\""
#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Вилучити фільтр типів повідомлень"
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Вилучити неіснуючі файли"
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Видалити вибрані модулі"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Видалити їх"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Видалити шляхи з \"Інші джерела\""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Видалити шлях до модуля?"
#: lazarusidestrconsts.lisremoveuses
msgid "Remove uses \"%s\""
msgstr "Вилучити \"%s\" з Uses"
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Перейменувати"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Перейменувати ..."
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Перейменувати файл?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Не вдалося змінити назву файла"
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Показати список перейменованих ідентифікаторів"
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Перейменувати на %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Превести в нижній регістр"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Перевідкрити проект"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Перевідкрити з іншим кодуванням"
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Повторити"
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Повторень:"
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Заміна"
#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "Властивість \"%s\" замінено на \"%s\"."
#: lazarusidestrconsts.lisreplacedtypeswiths
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "Тип \"%s\" замінено на \"%s\"."
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Заміна"
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Функції заміни"
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Заміни"
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Виправити невідомі властивості і типи"
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Замінити весь ідентифікатор"
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Помилка заміни"
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Пересканувати"
#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr "Скинути"
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Скинути всі фільтри до типових?"
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "Скинути властивості Left, Top, Width, Height вибраних компонентів до успадкованих значень?"
#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr "Назва ресурсу має бути унікальною."
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Помилка збереження ресурсу"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Тип ресурсів проекту"
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Перезапуск"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Результат:"
#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
msgstr ""
"Повернути слово, індексоване параметром, з частини поточного рядка перед курсором.\n"
"\n"
"Слова в рядку нумеруються 1,2,3,... зліва направо, але останнє слово,\n"
"яке завжди є розкриваним макросом, має номер 0, тому $PrevWord(0)\n"
"завжди містить поточний макрос.\n"
"\n"
"Приклад:\n"
"i 0 count-1 forb|\n"
"Тут $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"В кінці шаблона використайте $PrevWord(-1), який розкривається порожнім рядком, але при цьому виконує важливу операцію очищення всіх знайдених $PrevWord. Для довідки наведемо регулярний вираз, що використовується для виявлення слів для цього макросу: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent // the case list will be generated without extra indentation\n"
msgstr ""
"Повертає список всіх значень змінної case перед змінною.\n"
"\n"
"Необов'язкові параметри (відокремлюють комою):\n"
"WithoutExtraIndent // список case буде створено без додаткових відступів\n"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Обертання не вдалося"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Справа"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Праве якорювання"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Правий бордюр. Значення додається до базового бордюру і використовується для відступу справа від елемента керування."
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Це елемент керування одного рівня, за яким зафіксовано правий край. Залишити порожнім для фіксації за батьківським, як у Delphi (BorderSpacing і ReferenceSide не враховуються)."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Праві краї"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Рівномірно праві краї"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Корінь"
#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr "Коренева тека"
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Виконати"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "Пакунки часу розробки і виконання не мають обмежень."
#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Виконати"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "%s (виконується ...)"
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Файл не є виконуваним"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application \"%s\" is not executable."
msgstr "Головний застосунок \"%s\" не є виконуваним файлом."
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Виконати"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Для часу виконання, не можна встановити в ІСР"
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "Пакунки лише часу виконання призначені виключно для проектів. Їх не можна встановити в ІСР, навіть опосередковано."
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr "Пакунки часу виконання можуть використовуватися проектами. Їх не можна встановити в ІСР, якщо вони не потрібні певним пакункам часу розробки."
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Виконати-до не вдався"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Абстрактні Методи - ще не перекриті"
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Абстрактні методи %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Курсор не в оголошенні класу"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "ІСР зайняте"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s є абстрактним класом, він має %s абстрактних методів."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Не знайдено абстрактних методів"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Перевизначити всі вибрані"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Перевизначити перший вибраний"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Не вибирати нічого"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Можна перевизначити %s абстактних методів.%sВиберіть методи для яких треба створити пробки:"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Не лишилось абстрактних методів для перевизначення."
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Цей метод не можна перевизначити бо він визначений у поточному класі"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Неможливо показати абстрактні методи поточного класу, бо"
#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Зберегти"
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Зберегти всі"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Зберегти всі позначені"
#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Зберегти всі змінені файли"
#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Зберегти всі/початкові повідомлення у файл ..."
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Зберегти і вийти з діалогу"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Зберегти і перезібрати ІСР"
#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Зберегти як"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Зберегти змінені файли?"
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Зберегти зміни?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Зберегти зміни в проект %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Зберегти поточний файл редактора"
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "Збережено з параметрами ІСР"
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Збережено з сеансом проекту"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Зберегти файл як"
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Зберегти файл \"%s\"%sперед закриттям форми \"%s\"?"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Зберегти макрос як"
#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Зберегти повідомлення"
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Зберегти проект %s (*%s)"
#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr "Зберегти зміни сеансу до проекту %s?"
#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Зберегти згорток до"
#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr "Редактор коду підтримує згортання (тимчасове приховування) блоків коду."
#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Зберегти історію переходів"
#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr "Клацання з Ctrl на ідентифікаторі у Редакторі коду зберігається в історії переходів."
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Зберегти налаштування"
#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Записати показані повідомлення до файлу ..."
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Зберегти "
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr "Збереження файлу \"%s\" у \"%s\" призведе до втрати символів (рядок %s, стовпець %s)."
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Масштаб:"
#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr "Шукати файли у батьківській теці"
#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr "Шукати сирцеві файли у сусідніх теках (батьківській і її підтеках)"
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Триває пошук"
#: lazarusidestrconsts.lisscanning2
msgid "%s. Scanning ..."
msgstr "%s. Пошук ..."
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Перегляд батьківської теки"
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Шляхи пошуку"
#: lazarusidestrconsts.lissearchunit
msgid "Search Unit \"%s\""
msgstr "Знайти модуль \"%s\""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory where Lazarus searches for config template files. Default is "
msgstr "вторинна тека налаштувань, де Lazarus шукає свої шаблони налаштувань. Типово "
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Вторинний шлях конфігурації"
#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr "&Друга перевірка"
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Дивись повідомлення."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sДив.. Проект -> Інспектор проекту"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Шукати елемент довідки:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Виберіть вузол"
#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr "Виберіть іншу бібліотеку віджетів LCL (макрос LCLWidgetType)"
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Виберіть файли форм Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Вибрані"
#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr "Вибраний додаток:"
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "Вибрані і дочірні елементи керування"
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(вибраний нижній сусід)"
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Картографія вибраної команди"
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "вибрано для встановлення"
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "вибрано для вилучення"
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(вибраний лівий сусід)"
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr "Повідомлення, вибране у вікні повідомлень:"
#: lazarusidestrconsts.lisselectedmodeswerecompiled
msgid "Selected %d modes were successfully compiled."
msgstr "Вибрані %d режимів успішно скомпільовано."
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(вибраний правий сусід)"
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(вибраний верхній сусід)"
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Вибрати файл"
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Вибрати теку сирцевих кодів FPC"
#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr "Виберіть фрейм"
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Вибір перевищує рядкову константу"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Інструмент вибору"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Вибрати теку сирцевих кодів Lazarus"
#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr "Виберіть шлях до %s"
#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "Виберіть цільову теку"
#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Задати всі кольори:"
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Встановити за замовчуванням"
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr "Задайте для перекладу повідомлень компілятора іншою мовою (наприклад, не англійською). Наприклад: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Встановити типові відступи)"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Коротко:"
#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Коротке, без шляху"
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr "Чи повинен компонент \"%s\" автоматично створюватись при запуску застосунку?"
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Показати"
#: lazarusidestrconsts.lisshowabstractmethodsof
msgid "Show abstract methods of \"%s\""
msgstr "Показати абстрактні методи \"%s\""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Показати дерево компонентів"
#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr "Показати консоль"
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Виводити підказки оголошень"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Показати відмінності між режимами ..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Показати порожні модулі/пакунки"
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr "Показувати повідомлення FPC \"рядків скомпільовано\""
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Показувати значки для"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Показувати смужку"
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Показати довідку"
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Показувати підказки"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Показувати змінні"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Показувати панель інформації"
#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Виводити ідентифікатор типу повідомлення"
#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr "Показати декілька рядків"
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Показати лише змінене"
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr "Показувати лише одну кнопку на панелі завдань для всього ІСР замість однієї на кожне вікно. Деякі віконні менеджери (наприклад, Cinnamon) не підтримують дану можливість і завжди показують по одній кнопці на кожне вікно."
#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr "Показати вивід"
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview gutter"
msgstr "Показати смужку огляду"
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Показувати пакунки"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Показати позицію редактора коду"
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "Показувати часто вживані ідентифікатори вгорі"
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Показувати відносні шляхи"
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr "Показати всі елементи керування у деревовидній ієрархії."
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr "Поле внизу показує опис вибраної властивості."
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr "Показати діалог налаштування найбільш важливих параметрів"
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Показувати спеціальні символи"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Показувати рядок стану"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Показувати модулі"
#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr "Показувати модулі з розділами ініціалізації/фіналізації"
#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr "Ці модулі можуть ініціалізувати глобальні дані, що використовуються програмою/застосунком. Вилучайте обережно."
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Показати не використані модулі ..."
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Виводити підказки зі значеннями під час зневадження"
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "показати версію і вийти"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Зменшити до найменшого"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Рівень"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Проста програма"
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "Найпростіша програма Free Pascal для командного рядка."
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Простий синтаксис"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Пропустити помилки"
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Пропустити файл"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Пропустити файл і продовжити завантаження"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Пропустити завантаження останнього проекту"
#: lazarusidestrconsts.lisskipthesewarnings
msgid "Skip these warnings"
msgstr "Пропустити ці попередження"
#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr "Повільніше, але точніше"
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Зменшити за рахунок швидкодії"
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Збіги"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Вибачте, цей тип ще не реалізовано"
#: lazarusidestrconsts.lissortforscope
msgid "Sort for scope"
msgstr "Упорядкувати за областю дії"
#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr "Упорядкування"
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "за зростанням"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Враховувати регістр"
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "за спаданням"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Об'єкти сортування"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Нехтувати пробіли"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Рядки"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Параметри"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Абзаци"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Попередній перегляд"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Прийняти"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Сортування вибраного"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Слова"
#: lazarusidestrconsts.lissortunicoderangelistalphabetically
msgid "Sort Unicode range list alphabetically"
msgstr "Упорядкувати список діапазонів Unicode за алфавітом"
#: lazarusidestrconsts.lissourceanddestinationaresame
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr "Початкова \"%s\"%sі цільова \"%s\"%sтеки збігаються. Виберіть іншу теку."
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Код і призначення однакові:%s%s"
#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source Breakpoint ..."
msgstr "Точка зупинки &джерела ..."
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory \"%s\" does not exist."
msgstr "Теки сирців \"%s\" не існує."
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Керування вікном редактора сирців"
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Код змінено"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Код сторінки \"%s\" змінено. Зберегти?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "Сирці сторінок були змінені. Зберегти сторінки \"%s\"? (%d більше)"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Шляхи до програмних файлів"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Однакові проміжки"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Джр ОС"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Пошук"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Шукати текст"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Почати перетворення"
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Запустити ІСР"
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Розпочати з нового проекту"
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr "Рядок стану показує назву властивості і клас, де її опубліковано."
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Закінчити"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Закінчити зневаджування і перезібрати проект?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Закінчити зневаджування?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Закінчити зневаджування?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Зупинитись на винятку"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Закінчити зневаджування?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Зберігати роздільники шляху \\ та / як"
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Дивний lpi файл"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Помилка потоків"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "Рядок"
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Стиль"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Підпроцедура"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Підпроцедура того ж рівня"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Успішно"
#: lazarusidestrconsts.lissuccessfullyexported
msgid "Successfully exported to \"%s\"."
msgstr "Успішно експортовано до \"%s\"."
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr " %d режимів збирання успішно експортовано до \"%s\"."
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
msgid "Successfully exported compiler options to \"%s\"."
msgstr "Параметри компілятора успішно експортовано до \"%s\"."
#: lazarusidestrconsts.lissuccessfullyimported
msgid "Successfully imported from \"%s\"."
msgstr "Успішно імпортовано з \"%s\"."
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr " %d режимів збирання успішно імпортовано з \"%s\"."
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
msgid "Successfully imported compiler options from \"%s\"."
msgstr "Параметри компілятора успішно імпортовано з \"%s\"."
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Запропонувати типову назву нового файлу у нижньому регістрі"
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Підозрілий шлях включення"
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Підозрілий шлях модуля"
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Версія SVN"
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Неправильна назва змінної"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" не є коректним ідентифікатором."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Змінювання системної змінної"
#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Перемкнути налаштування фільтру"
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr "Перейти на вкладку Обрані після запиту назви компонента."
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Синтаксичний режим"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "system.ppu не знайдено. Перевірте ваш fpc.cfg."
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "ТАБ"
#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Сортувати вкладки всіх контролів-нащадків \"%s\" за позиціями?"
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Змістити вибраний елемент вниз у Таб-порядку"
#: lazarusidestrconsts.listaborderof
msgid "Tab Order of %s"
msgstr "Таб-порядок %s"
#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr "Розраховувати порядок за tab для дочірніх елементів керування рекурсивно"
#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr "рекурсивно"
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Обчислити Таб-порядок елементів за їх X- та Y- позиціями"
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Змістити вибраний елемент вгору в Таб-порядку"
#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr "Вкладки для %s"
#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr "Зробити знімок"
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Ціль:"
#: lazarusidestrconsts.listarget2
msgid ", Target: %s"
msgstr ", ціль: %s"
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Для ЦП:"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Назва цільового файлу: (-o, порожньо = викор. вихідну теку модуля)"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Назва цільового файлу (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Назва цільового файлу проекту"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Назва цільового файлу + параметри"
#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "Ціль доступна лише для читання"
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Для якої ОС"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Редагована комірка"
#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "Вставляє редаговану комірку. По комірках можна переміщатися за допомогою клавіші tab.%0:sМакрос \"param\" приймає список розділених комами аргументів.%0:sПерший аргумент є типовим значенням.%0:sДругий аргумент (необов'язковий) може бути використаний щоб пов'язати комірку з іншою (синхронна зміна)%0:s%0:s а param(\"foo\") do param(foo);%0:sВставляє 2 незалежних комірки, з типовим текстом \"foo\"%0:sЛапки необов'язковіl%0:s%0:s Якщо param(\"foo\") > 0 та param(\"foo\",sync=1) < 99 тоді%0:sВставляє 2 пов'язані комірки, редагування однієї змінить іншу також%0:sЗначення \"1\" вказує позицію іншого \"param()\", так що якщо є ще параметри:%0:s якщо param(\"bar\") та param(foo) > 0 і param(foo,sync=2) < 99 тоді%0:s2-га і третя пов'язуються. (3-тя вказує на \"2\") %0:s%0:s\"синх може бути скорочений до \"s\":%0:s якщо param(\"foo\") > 0 та param(\"foo\",s=1) < 99 тоді%0:s%0:s якщо param(\"bar\") та param(\"foo\") > 0 і param(\"foo\",sync) < 99 тоді%0:sДругий і третій пов'язуються.%0:sЗауважте: \"Синх не має позиції і не має \"=\", тому він синхронізує з попередньою коміркою з тим самим типовим текстом (тут це \"foo\")"
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "Файл шаблона"
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Тека проб"
#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "Перевірити URL"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "Пакет застосунків був створений для \"%s\""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "Клас \"%s\" є елементом керування (TControl) і його не можна вставити на щось інше.%sНеможливо вставити."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The Codetools found an error:%s%s"
msgstr "Codetools знайшов помилку:%s%s"
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "Файл компілятора \"%s\" виглядає неправильним:%s%s"
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "Компонент %s не може бути видалений, бо %s ним не володіє."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "Редактор компонента для класу \"%s\" викликав помилку:%s\"%s\""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "Редактор компонента для класу \"%s\",%sщо пов'язаний зі словом #%s \"%s\"%sвикликав помилку:%s\"%s\""
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Компонент %s успадкований від %s.%sДля видалення успадкованого компонента слід відкрити об'єкт-предок і видалити його там."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Компонент %s успадкований від %s.%sДля перейменування успадкованого компонента слід відкрити об'єкт-предок і перейменувати його там."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "Назви компонентів мають бути унікальними у межах форми/модуля даних. Порівнюються назви, як і звичайні ідентифікатори Pascal, без урахування регістру."
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "Конфігурація буде понижена/перетворена."
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "%s містить теку, яка не існує:%s%s"
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "%s містить символ зірочки *.%sLazarus інтерпретує його як звичайний символ, не розкриваючи в якості маски файлу."
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "Поточний FPC не має файлу налаштувань. Ймовірно, компілятор не зможе знайти ряд модулів. Перевірте, що fpc правильно встановлено."
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "Зневаджувач \"%s\"%sвідсутній або не є виконуваним.%sДив. Інструменти -> Параметри -> Параметри зневаджувача"
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr "Виконуваний файл зневаджувача здебільшого має назву \"%s\". Вкажіть повний шлях до файлу."
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "Типовий режим має зберігатись у проекті, а не у сеансі."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s\"%s\" does not exist."
msgstr "Теки призначення%s\"%s\" не існує."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "Теки призначення \"%s\" не існує.%sПеревірте назву виконуваного файлу в Меню > Проект > Параметри проекту."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "Каталог \"%s\" більше не містить файлів включення проекту. Видалити його зі списку шляхів пошуку файлів включення проекту?"
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "Каталог \"%s\" більше не містить модулі проекту. Видалити його зі списку шляхів пошуку модулів проекту?"
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "Тека \"%s\" більше не потрібна у шляху до модулів.%sПрибрати її?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory \"%s\" is not writable."
msgstr "Тека \"%s\" недоступна для запису."
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "Теку %s не знайдено."
#: lazarusidestrconsts.listhefile
msgid "The file \"%s\""
msgstr "Файл \"%s\""
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "Файл %s не схожий на lpi файл."
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "Індекс файлів потрібен для забезпечення роботи функції пошуку і їй подібних. Під час сканування можна редагувати сирцевий код і компілювати, але функція пошуку і їй подібні будуть повідомляти, що необхідні модулі не знайдені. Це може зайняти кілька хвилин."
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
msgstr "Файл \"%s\" є символьним посиланням.%sВідкрити замість нього \"%s\"?"
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "Файл \"%s\" не є проектом Lazarus.%sСтворити новий прокт для цього \"%s\"?"
#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr "Файлова маска \"%s\" недійсна."
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "Файлова маска \"%s\" не є правильним регулярним виразом."
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Файл \"%s\"схожий на програму. %sЗакрити поточний проект і створити новий проект Lazarus для цієї програми?%s\"Ні\" відкриє файл як звичайний код."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Схоже, що файл %s є програмним в існуючому проекті Lazarus."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
msgstr "Файл \"%s\"%sзнайдено в одному з каталогів сирцевого коду пакунка %s, і він виглядає як скомпільований модуль. Такі модулі повинні бути у вихідній теці пакунка, інакше інші пакунки можуть мати проблеми з використанням цього пакунка.%sВидалити невизначений файл?"
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "Файлу \"%s\" не знайдено.%sБажаєте пошукати його самостійно?"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Файл \"%s\" не знайдено.%sЗнехтувати продовжить завантаження проекту,%sПерервати зупинить завантаження."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "Такі методи, що використовуються %s відсутні у джерелі%s%s%s%s%sПрибрати завислі посилання?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "Джерельна тека FPC \"%s\" виглядає неправильною:%s%s"
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "Виконуваний файл компілятора Free Pascal зазвичай має назву \"%s\". Ви також можете використовувати компілятор для певної платформи, наприклад, \"%s\". Задайте повний шлях до файлу."
#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr "ІСР ще збирається."
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Ідентифікатор є модулем. Для його перейменування використайте функцію Файл - Зберегти як."
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "Клавішу %s вже призначено для %s%s.%s%sВидалити старе призначення і призначити клавішу для нової функції %s?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "Необхідний для виконання пакет програм %s%sне існує або не є виконуваним файлом.%sВи хочете створити такий?%s%Для налаштування дивіться Проект -> Параметри проекту -> Застосунок."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "Застосунок, що запускається, \"%s\"%sне існує або не є виконуваним файлом.%sДивіться Виконання -> Параметри виконання -> Локальні"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "Тека Lazarus містить сирцеві коди ІСР, файли пакетів LCL і багато стандартних пакунків. Наприклад, вона містить файл \"ide%slazarus.lpi\". Файли перекладу також знаходяться там."
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "Тека Lazarus \"%s\" виглядає неправильною:%s%s"
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "LFM-файл (файл форми Lazarus) містить некоректні властивості. Це означає, наприклад, що він містить деякі властивості/класи, яких немає у поточній версії LCL. Як правило треба прибрати ці властивості з lfm і виправити код Pascal вручну."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "Макрос \"%s\" не починається з \"%s\"."
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "Виконуваний файл \"make\" здебільшого має назву \"%s\". Він необхідний для збирання ІСР. Вкажіть повний шлях до файлу."
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Новий файл для включення відсутній у теках пошуку включень.%sДодати теку %s?"
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Новий модуль ще не в теках пошуку модулів.%sДодати теку %s?"
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "Стара конфігурація буде оновлена."
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\"Інші джерела\" містить каталог, який вже знаходиться в \"Інші файли модулів\".%s%s"
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory \"%s\" is missing."
msgstr "Кінцева тека \"%s\" відсутня."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Вихідна тека %s є в списку пошуку включених шляхів %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Вихідна тека %s є в списку пошуку шляху успадкованого включення %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Вихідна тека %s є в списку пошуку шляху успадкованого модуля %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Вихідна тека %s є в списку пошуку шляху модуля %s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr " Вихідна тека повинна бути окремою текою і не містити файлів сирцевих кодів."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "Клас власника має цю назву"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Власник має цю назву"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Пакунок %s додає шлях \"%s\" до шляху включення ІСР.%sНапевне пакунок погано сконфігурований."
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Пакунок %s додає шлях \"%s\" до шляху модулів ІСР.%sНапевне пакунок погано сконфігурований."
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Пакунок вже містить модуль з такою назвою."
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr "Пакунок %s неможливо встановити, бо він вимагає пакунка \"%s\", який є пакунком лише часу виконання."
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr "Пакунок %s не можна деінсталювати, бо він потрібен для самого ІСР."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Пакунок %s не має жодних процедур \"Реєстрації\", яка зазвичай означає, що він не надає аддон ІСР. Його встановлення швидше всього лише збільшить розмір ІСР і може навіть зробити його нестійким.%sПідказка: якщо ви хочете використати пакунок у проекті, використайте пункт меню \"Додати у проект\"."
#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr "Пакунок %s вже в списку"
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "Пакунок %s не є пакунком часу розробки. Він не може бути встановлений в ІСР."
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "Шлях \"make\" є неправильним: \"%s\""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "Програму \"make\" не знайдено.%sЦей засіб потрібен, щоб зібрати Lazarus."
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Опції компілятора проекту і директиви в основному коді відрізняються. Для нового модуля будуть використані такі режим і тип рядка проекту:"
#: lazarusidestrconsts.listheprojectdoesnotusedwarf
msgid "The project does not write debug info in Dwarf format. The \"%s\" supports only Dwarf."
msgstr "Проект не записує зневаджувальної інформації у форматі Dwarf. \"%s\" підтримує тільки Dwarf."
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "Проект не використовує інтерфейси модулів LCL, які вимагає LCLBase.%sВи отримаєте дивні помилки компонувальника, якщо ви використаєте LCL без інтерфейсів."
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Проект не має основного файлу з сирцевим кодом."
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "Файл відомостей проекту \"%s\"%sзбігається з головним сирцевим файлом!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "Інформаційний файл проекту \"%s\"%sзмінився на диску."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Проект треба зберегти перед компіляцією%sЯкщо ви встановите тестову теку в параметрах ІСР,%sВи можете створювати проекти і збирати їх одразу.%sЗберегти проект?"
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr "У проекті використовуються ресурси FPC, для яких потрібен принаймні FPC 2.4"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Проект використовує цільову ОС=%s та ЦП=%s.%ssystem.ppu для цієї цілі не було знайдено у теках бінарників. %sПереконайтесь, що fpc для цієї цілі встановлено правильно і в fpc.cfg вказано правильні теки."
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr "Проект записує зневаджувальні дані у зовнішній файл. \"%s\" підтримує лише зневаджувальні дані, розміщені безпосередньо у виконуваному файлі."
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr "Проект записує зневаджувальні символи у виконуваний файл, а не в зовнішній файл. \"%s\" підтримує тільки зневаджувальні символи, розміщені у зовнішньому файлі."
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
msgid "%sThere are additional notes for this message on%s"
msgstr "%sДо цього повідомлення є додаткові зауваження у%s"
#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr "Конфліктів клавіш немає."
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "В теці є і інші файли з такою самою назвою,%s, що відрізняється тільки регістром:%s%s%sВидалити їх?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "На диску є файл з такою самою назвою і схожим розширенням%sФайл: %s%sСхожий файл: %s%sВидалити схожий файл?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Режим збирання з такою назвою вже існує."
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr "Клас компонента з назвою %s вже існує."
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Вже існує компонент з такою назвою"
#: lazarusidestrconsts.listhereisalreadyafilein
msgid "There is already a file%s%s%sin %s"
msgstr "Файл %s%s%sу %s вже існує"
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr "Файл \"%s\" у %s вже існує%sСтарий: %s%sНовий: %s%s%sПродовжити?"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name \"%s\""
msgstr "Вже існує форма з назвою \"%s\""
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name \"%s\"."
msgstr "Вже є макрос з назвою \"%s\"."
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Вже існує макрос ІСР з назвою \"%s\""
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr "В списку вже є пакунок %s"
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr "Модуль \"%s\" вже є в \"%s\"%sСтарий: %s%sНовий: %s%sПереконайтесь, що у теках пошуку модулів є лише один з них.%s%sПродовжити?"
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Вже існує модуль з назвою \"%s\". Ідентифікатори Pascal мають бути унікальними."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "У проекті є модуль з назвою \"%s\".%sВиберіть іншу назву"
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr "У теці з %s немає fpc.exe. Зазвичай виконуваний файл make встановлюється разом з компілятором FPC."
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Має бути хоча б один режим збирання."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "Клас ресурсу \"%s\" походить від \"%s\". Можливо, що це мало бути TForm."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Сталася помилка при запису вибраних компонентів %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Сталася помилка при перетворенні бінарного потоку вибраного компонента %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Сталася помилка при копіюванні потоку компонента в буфер:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "Компонент верхнього рівня не може бути видалено."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Ці файли будуть видалені"
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Ці налаштування зберігаються з проектом."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Ці модулі не були знайдені:"
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Сирці пакунків Free Pascal необхідні для перегляду і завершення коду. Наприклад, вони мають файл \"%s\"."
#: lazarusidestrconsts.listhetargetdirectoryisafile
msgid "The target directory is a file:%s"
msgstr "Цільова тека є файлом:%s"
#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr "Зазначений цільовий файл є текою."
#: lazarusidestrconsts.listhetargetisnotwritable
msgid "The target %s is not writable."
msgstr "Ціль %s не доступна для запису."
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "Неможливо знайти тестову теку:%s\"%s\"%s(див. параметри ІСР)"
#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit \"%s\" already exists."
msgstr "Модуль \"%s\" вже існує."
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "Модуль належить пакунку %s."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Модуль %s існує двічі в шляху модулів %s:"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "Модуль має цю назву"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "Назва файлу модуля \"%s\" - не в нижньому регістрі.%sКомпілятор Free Pascal не шукає всі регістри. Рекомендовано користуватися нижнім регістром для назви.%sПерейменувати файл?"
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "Модуль %s є частиною сирців FPC, але відповідний fpdoc xml файл не було знайдено.%sАбо ви ще не додали теку fpcdocs до пошукового шляху або модуль ще не документований.%sФайли fpdoc файли для сирців FPC можуть бути завантажені з: %s%sДодайте теку в опціях редактора fpdoc.%sЩоб створити новий файл, каталог має бути доступним для запису."
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "Модуль %s використовується іншими файлами.%sОновити залежності автоматично?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "Модуль вже називається \"%s\". Ідентифікатори Pascal мають бути унікальними."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "Шлях пошуку модулів \"%s\" містить теку сирцевих кодів \"%s\" пакунка %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Робоча тека \"%s\" не існує.%sПеревірте робочу теку у Меню > Виконати > Параметри виконання."
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr "Цей компонент вже містить клас з назвою %s."
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Цій функції потрібен відкритий у редакторі коду .lfm файл."
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "це довідкове повідомлення"
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr "Тестовий проект для перевірки пакунка часу розробки поза ІСР."
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Це виглядає як файл Pascal.%sРекомендується використовувати назви файлів у нижньому регістрі, щоб уникнути різних проблем на деякиих операційних системах і різних компіляторах.%sЗмінити на нижній регістр?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Проект не має основного файлу з поч. кодом"
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Цей проект має лише типовий режим збирання."
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Цей набір параметрів для збирання Lazarus не підтримується встановленням.%sТека \"%s\" недоступна для запису.%sДивіться сайт Lazarus для інших способів встановлення."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Цей вираз не може бути витягнутий.%sВиберіть будь-який код, щоб витягти нову процедуру/метод."
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr "Це дозволить за раз змінити всі режими збирання. Ще не реалізовано."
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Це створить кругову залежність."
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "До буфера обміну буде вміщено багато тексту (%s).%sПродовжити?"
#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr "Нитки"
#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Поточний"
#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "Функція"
#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr "ЙтиДо"
#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Рядок"
#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr "Нитки не визначені"
#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Джерело"
#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Стан"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Заголовок"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Назва на панелі завдань показує наприклад: project1.lpi - Lazarus"
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Назва (залишити порожнім для типової)"
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Функція: додати розподілювач шляхів"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: remove trailing path delimiter"
msgstr "Функція: прибрати кінцевий роздільник шляху"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Функція: витягнути розширення файлу"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Функція: витягнути назву файлу з розширенням"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Функція: витягнути тільки назву файлу"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Функція: витягнути шлях до файлу"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(невідомий макрос: %s)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Шлях:"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Перемкнути показ назв файлів з повним або відносним шляхом"
#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr "Конфігурація панелі інструментів"
#: lazarusidestrconsts.listoolbaroptions
msgid "Toolbar"
msgstr "Панель інструментів"
#: lazarusidestrconsts.listoolbaroptionshighlight
msgid "Highlight toolbars buttons"
msgstr "Підсвітити кнопки на панелях"
#: lazarusidestrconsts.listoolbaroptionsraise
msgid "Raise toolbars"
msgstr "Підняти інструментальні панелі"
#: lazarusidestrconsts.listoolhasnoexecutable
msgid "tool \"%s\" has no executable"
msgstr "засіб \"%s\" не має виконуваного файлу"
#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "Заголовок засобу: Невдача"
#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "Заголовок засобу: Виконання"
#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "Заголовок засобу: Прокрутка вгору"
#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "Заголовок засобу: Успішно"
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "засіб завершив роботу з кодом %s. Скористайтесь контекстним меню, щоб отримати більше інформації."
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr "зупинено з ExitCode 0 і ExitStatus %s. Для детальнішої інформації скористайтесь контекстним меню."
#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Вгорі"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Фіксація по верху"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Верхній бордюр. Ця величина додається до базового бордюру і використовується для відступу над контролем."
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Procedure hint"
msgstr "Показувати підказку Клас/Процедура"
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Вершини"
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Це елемент керування одного рівня, за яким зафіксовано верхній край. Залишити порожнім для фіксації за батьківським, як у Delphi (BorderSpacing і ReferenceSide не враховуються)."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Рівномірно верхні краї"
#: lazarusidestrconsts.listotalpages
msgid "Total Pages: %s"
msgstr "Всього сторінок: %s"
#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "Перекласти англійські повідомлення"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Дерево потребує оновлення"
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Два переміщувані файли мають однакові назви:%s%s%s%s%sу %s"
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Типи (не видалені якщо немає заміни)"
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Додаткові теки:"
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Всі модулі пакунків"
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Всі модулі у редакторі коду"
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Всі модулі"
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "Типово пошук виконується лише у модулях проекту, а також у модулях, відкритих у редакторі коду. Додайте тут список тек, відокремлюючи крапками з комою, щоб шукати ще й у них."
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Згорнути всі вузли"
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Розгорнути всі вузли"
#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr "Файл: %s"
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Фільтр)"
#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr "Uses з Implementation: %s"
#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr "Uses з Implementation: %s"
#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr "Uses з Interface: %s"
#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr "Uses з Interface: %s"
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Проекти і пакунки"
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Триває пошук ..."
#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr "Триває пошук: %s модулів ..."
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Пошук)"
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "Знайти наступне входження цієї фрази"
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "Знайти наступне модуль з цією фразою"
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "Знайти попереднє входження цієї фрази"
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "Знайти попередній модуль з цією фразою"
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Вибрані модулі"
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Показувати вузли для тек"
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "Показувати вузли для проектів і пакунків"
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Модулі"
#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr "Модулі: %s"
#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr "Використовується в Implementation: %s"
#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr "використовується в Implementation: %s"
#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr "Використовується в Interface: %s"
#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr "використовується в Interface: %s"
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Не показувати це повідомлення знову."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Помилка в регулярному виразі"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Шрифт без UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Перейти до рядка:"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Не знайдено"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Замінити \"%s\"%s на \"%s\" у цьому місці?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Шукаю: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Продовжити пошук з початку?"
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Продовжити пошук з кінця?"
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Рядок пошуку '%s' не знайдено!"
#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Поточний шрифт редактора не підтримує UTF-8, але у вашій системі схоже він використовується.%sЦе означає, що не-ASCII символи, ймовірно, будуть показані неправильно.%sВи можете вибрати інший шрифт у параметрах редактора."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Очистити кеш включень (includes)"
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s байтів"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Доданий:"
#: lazarusidestrconsts.lisuidinproject
msgid "In project:"
msgstr "У проекті:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Рядків"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Назва:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "ні"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Розмір"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Тип:"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "так"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Значення CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Неможливо перетворити бінарний потік на текст"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Неможливо скопіювати компоненти до буфера"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Неможливо додати коментар заголовка ресурсу до файлу ресурсу %s\"%s\".%sМожливо, помилка синтаксису."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Неможливо додати ресурс T%s:FORMDATA до файлу ресурсів %s\"%s\".%sМожливо, помилка синтаксису."
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr "Не вдається додати залежність %s, бо пакунок %s уже має залежність %s"
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr "Не вдається додати залежність %s, бо це створить кругову залежність. Залежність %s"
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Неможливо додати %s до проекту, тому що в проекті вже є модуль з такою самою назвою."
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Неможливо зберегти резервний файл \"%s\" як \"%s\"!"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sНеможливо змінити клас %s на %s"
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
msgid "Unable to change project scaled in source.%s%s"
msgstr "Неможливо змінити властивість Scaled проекту в сирцевому коді.%s%s"
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr "Неможливо змінити заголовок проекту у джерелі.%s%s"
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Неможливо очистити теку призначення"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Неможливо очистити \"%s\".%sПеревірте доступ."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Неможливо перетворити компонент з текстового на бінарний формат:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Неможливо перетворити файл \"%s\"%sПомилка: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Неможливо перетворити текстові дані форми файлу %s\"%s\"%sна двійковий потік. (%s)"
#: lazarusidestrconsts.lisunabletoconverttoencoding
msgid "Unable to convert to encoding \"%s\""
msgstr "Неможливо конвертувати у кодування \"%s\""
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Неможливо скопіювати файл"
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file \"%s\"%sto \"%s\""
msgstr "Неможливо скопіювати файл \"%s\"%sу \"%s\""
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory \"%s\"."
msgstr "Неможливо створити теку \"%s\"."
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Неможливо створити файл"
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file \"%s\""
msgstr "Неможливо створити файл \"%s\"."
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s\"%s\""
msgstr "Неможливо створити файл%s\"%s\""
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link \"%s\" with target \"%s\""
msgstr "Неможливо створити посилання \"%s\" з ціллю \"%s\""
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file because there is already a directory with this name."
msgstr "Неможливо створити новий файл, бо вже існує тека з такою назвою."
#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr "Неможливо створити новий метод."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Неможливо створити тимчасовий lfm буфер"
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Неможливо видалити"
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Неможливо видалити двозначний файл \"%s\""
#: lazarusidestrconsts.lisunabletoexecute
msgid "unable to execute: %s"
msgstr "неможливо виконати: %s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Неможливо знайти секцію ResourceString в цьому чи будь-якому з використовуваних модулів."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in \"%s\""
msgstr "Неможливо знайти правильну назву класу в \"%s\""
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file \"%s\"."
msgstr "Неможливо знайти файл \"%s\"."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Неможливо знайти файл \"%s\".%sЯкщо він належить до вашого проекту, перевірте шлях пошуку в%sПроект -> Параметри компілятора -> Шляхи пошуку -> Інші файли модулів. Якщо файл належить пакунку, перевірте відповідні опції компілятора пакунків. Якщо цей файл відноситься до Lazarus, переконайтесь що компілюєте начисто. Якщо файл належить FPC тоді перевірте fpc.cfg. Якщо не впевнені, перевірте Проект -> Параметри компілятора -> Текст"
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Неможливо знайти %s у потоці LFM"
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Неможливо знайти метод."
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "Неможливо знайти модуль Pascal (.pas,.pp) для .lfm файлу%s\"%s\""
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "Неможливо знайти клас компонента \"%s\".%sВін не зареєстрований за допомогою RegisterClass, а відповідний файл LFM відсутній.%sПотрібен для модуля:%s%s"
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Неможливо зібрати зміни редактора"
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Неможливо знайти код для дизайнера"
#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr "не можу завантажити файл %s: %s"
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package \"%s\""
msgstr "Неможливо завантажити пакунок \"%s\""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "Неможливо завантажити клас компонента \"%s\" через те, що він залежить сам від себе. "
#: lazarusidestrconsts.lisunabletoopen
msgid "Unable to open \"%s\""
msgstr "Неможливо відкрити \"%s\""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Не вдалося відкрити компонент предок"
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Неможливо відкрити дизайнер.%sКлас %s не походить від придатного для розробки класу на кшталт TForm або TDataModule."
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Неможливо прочитати %s"
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Неможливо прочитати файл"
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file \"%s\"."
msgstr "Неможливо прочитати файл \"%s\"."
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file \"%s\"%sError: %s"
msgstr "Неможливо прочитати файл \"%s\"%sПомилка: %s"
#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr "Неможливо прочитати lpi"
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "неможливо прочитати код завершення процесу"
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s\"%s\"."
msgstr "Неможливо прочитати файл інформації проекту%s\"%s\"."
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Неможливо стерти старий резервний файл \"%s\"!"
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
msgid "Unable to remove project scaled from source.%s%s"
msgstr "Неможливо змінити властивість Scaled проекту з сирцевого коду.%s%s"
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr "Неможливо видалити заголовок проекту з джерела.%s%s"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Неможливо змінити назву двозначного файлу \"%s\"%sна \"%s\""
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Неможливо змінити назву файла"
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file \"%s\" to \"%s\"!"
msgstr "Неможливо змінити назву файлу \"%s\" на \"%s\"!"
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file \"%s\"%sto \"%s\"."
msgstr "Неможливо перейменувати файл \"%s\"%sна \"%s\"."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Неможливо змінити назву форми в коді"
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Неможливо змінити назву метода. Виправте помилку. Див. вікно повідомлень."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Неможливо змінити назву змінної в коді."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Неможливо запустити"
#: lazarusidestrconsts.lisunabletorun2
msgid "Unable to run \"%s\""
msgstr "Неможливо запустити \"%s\""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Неможливо встановити AnchorSide Control"
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Неможливо відобразити метод."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Неможливо вивести вибрані компоненти у потік"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Неможливо вивести вибрані компоненти у потік."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Неможливо вивести у потік %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Неможливо перетворити потік двійкових компонентів %s:T%s на текст."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Неможливо оновити вираз CreateForm в коді проекту"
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write \"%s\""
msgstr "Неможливо записати \"%s\""
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Неможливо записати файл"
#: lazarusidestrconsts.lisunabletowritefile2
msgid "Unable to write file \"%s\"."
msgstr "Неможливо записати файл \"%s\"."
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file \"%s\"%sError: %s"
msgstr "Неможливо записати файл \"%s\"%sError: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
msgstr "Неможливо записати файл інформації проекту%s\"%s\".%sПомилка: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Неможливо записати файл сеансу проекту%s\"%s\".%sПомилка: %s"
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "Неможливо записати у файл \"%s\"."
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Неможливо записати xml-потік до %s%sПомилка: %s"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Зняти мітки з усіх"
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Скасувати"
#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr "Деінсталювати %s"
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Деінсталювання неможливе"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Видалити вибране"
#: lazarusidestrconsts.lisunit
msgctxt "lazarusidestrconsts.lisunit"
msgid "Unit"
msgstr "Модуль"
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit \"%s\" has changed. Save?"
msgstr "Модуль \"%s\" змінено. Зберегти?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Ідентифікатор модуля існує"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s"
msgstr "%s модуль %s у пакунку %s"
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Модуль з такою назвою вже є в проекті"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Назва модуля починається з ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Назва модуля включає ..."
#: lazarusidestrconsts.lisunitnotfound
msgid "unit %s not found"
msgstr "модуль %s не знайдено"
#: lazarusidestrconsts.lisunitnotfoundatnewposition
msgid "unit %s not found at new position \"%s\""
msgstr "модуль %s не знайдено у новому розташуванні \"%s\""
#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr "Модуль не знайдено в проекті %s"
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Тека для генерації модулів"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "шлях до модуля"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Шляхи до модулів"
#: lazarusidestrconsts.lisunitrequirespackage
msgid "unit %s requires package %s"
msgstr "модуль %s потребує пакунка %s"
#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr "Модулі не знайдено в проекті %s"
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "Непідписаний"
#: lazarusidestrconsts.lisunusedunitsof
msgid "Unused units of %s"
msgstr "Невикористані модулі в %s"
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Незвичайна назва компілятора. Зазвичай вона починається на fpc, ppc чи ppcross."
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr "Незвична назва файлу компілятора pas2js. Зазвичай вона починається з pas2js."
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Вверх"
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Оновити дані"
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Оновлювати решту сигнатур процедур навіть при зміненні регістру"
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Оновити залежності?"
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
msgid "Updating PO files failed for package %s"
msgstr "Не вдалось оновити файли PO для пакунка %s"
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Модернізація"
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Параметри модернізації"
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "рядок в верхньому регістрі"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter."
msgstr "Рядок у верхньому регістрі, поданий як параметр"
#: lazarusidestrconsts.lisurlonwikithebaseurlis
msgid "URL on wiki (the base url is %s)"
msgstr "Адреса сторінки Вікі (базова - %s)"
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Повідомлення використання (опція -h)"
#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr "Використати"
#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Використовувати рядки ansistring"
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Використовувати прапорці для логічних значень"
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Використовувати коментарі у параметрах користувача"
#: lazarusidestrconsts.lisusedby
msgid " used by %s"
msgstr ", використаний в %s"
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Викор. пакунки часу розробки"
#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr "Використано для автоматично створених форм."
#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr "Використайте фільтр, щоб включити більше файлів"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Використати ідентифікатор"
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Використати ідентифікатор %s в %s на %s"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Запуск програми"
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Використати пакунок %s у пакунку %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Використати пакунок у пакунку"
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Використати пакунок %s у проекті"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Використати пакунок у проекті"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr "Додати до спсику \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Користувацька розмітка тексту"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr "Вилучити зі списку \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr "Перемкнути у списку \"%s\""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Домашня тека користувача"
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Додати Unit до секції Uses"
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Викор. модуль %s в модулі %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 з BOM"
#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Змінна"
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Змінна%s"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Змінна: "
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Змінні"
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr "Значення властивостей, відмінні від типових, зберігаються у файлі .lfm і виділяються в інспекторі об'єктів"
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Змінна"
#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr "Детально"
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Виклики перевірки методу"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Версія"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Помилкова версія"
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Вертикально"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Копіювати дані про версію в буфер"
#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "Дуже детально"
#: lazarusidestrconsts.lisviewbreakpointproperties
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Властивості точки зупинки ..."
#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr "Дивитись джерело"
#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "Перемкнути вигляд Асемблер"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Переглянути код (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Попередження: "
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
msgstr "Попередження: знайдено двозначний файл \"%s\". Сирцевий файл: \"%s\""
#: lazarusidestrconsts.liswarnings
msgid ", Warnings: %s"
msgstr ", попереджень: %s"
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sУвага: Це головний модуль. Новий головний модуль буде %s.pas."
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Спостерігати"
#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr "Огляд:"
#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr "Дія огляду"
#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr "Читання"
#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr "Читання/Запис"
#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr "Запис"
#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr "Точка зупинки &даних/огляду ..."
#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr "Точка зупинки &даних/огляду ..."
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Властивості Спостерігання"
#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr "Межі огляду"
#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "Глобально"
#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr "Оголошення"
#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr "Створити точку зупинки &даних/огляду ..."
#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr "Вітаємо в ІСР Lazarus %s"
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Вітаємо у Lazarus %s%sВже існує конфігурація з версії %s у%s%s"
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Що потребує збирання"
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Коли модуль перейменований оновити залежності"
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr "Якщо ввімкнено, поточні налаштування зберігаються в шаблон, який використовується при створенні нових проектів"
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr "Якщо є лише один варіант завершення, застосовувати його негайно, не показуючи вікна автозавершення"
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Коли рухається курсор редактора коду, показати поточний вузол у Досліднику коду"
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr "Меню вікна показує назву форми замість заголовка"
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr "Корисно, якщо заголовок залишено порожнім."
#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr "Вікно залишається попереду всіх"
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", з включеннями "
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Без належного компілятора перегляд і компілювання коду буде невтішним."
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr "Без правильного зневаджувача зневадження не матиме успіху."
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Без правильної теки Lazarus ви отримаєте багато попереджень."
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr "Збирання ІСР неможливе без вказання коректного виконуваного файлу \"make\"."
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Без належних сирців FPC перегляд і завершення буде дуже обмеженим."
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "З необхідними пакунками"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "Ви&далити всі"
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "Н&едоступні Всі"
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "В&вімкнути все"
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Вираз"
#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr "Панель перегляду"
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Властивості"
#: lazarusidestrconsts.liswlwatchlist
msgctxt "lazarusidestrconsts.liswlwatchlist"
msgid "Watches"
msgstr "Спостереження"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Слово під курсором в цьому редакторі"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Робоча тека для збирання"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Робоча тека для виконання"
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Помилка запису"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Помилка запису: %s%sФайл: %s%s%s"
#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr "Не вдалося записати пакунок до файлу."
#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr "Не вдалося записати проект до файлу."
#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr "неправильна версія в %s: %s"
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Помилка XML"
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Помилка розбору XML у файлі %s%sПомилка: %s"
#: lazarusidestrconsts.lisyes
msgid "Yes"
msgstr "Так"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Ви можете вимкнути це для окремих форм у редакторі пакунків"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Ви можете вимкнути це для окремих форм в спливаючому меню в інспекторі проектів"
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr "FPC і його сирці можна звантажити з http://sourceforge.net/projects/lazarus/?source=directory"
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Ви не можете перезібрати Lazarus під час зневаджування або компіляції."
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr "Ви не можете змінити режим збирання під час компіляції."
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr "Елементи можна вибрати, просто натискаючи підкреслені літери"
#: lazarusidestrconsts.lis_all_
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Всі>"
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Редактор тексту"
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr "Видалити вибране"
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr "неправильний"
#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr "неправильний файл LPK (%s)"
#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr "правильний файл LPK (%s)"
#: lazarusidestrconsts.lrspldunabletodeletefile
msgid "Unable to delete file \"%s\""
msgstr "Неможливо видалити файл \"%s\""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr "правильний"
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr "Переглянути файли LPL"
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Додати модуль пакунка у секцію uses"
#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Двійковий"
#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Десятковий"
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr "Показувати тип вибраних регістрів"
#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr "Формат"
#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr "Шістнадцятковий"
#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr "Вісімковий"
#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr "Сирі дані"
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Додати зворотне"
#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr "Додати новий терм"
#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr "Приєднати до"
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Атрибути"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Автоматично збільшувати номер збірки"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr "Збільшується при кожному компілюванні проекту."
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "Зі&брати:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Набір символів:"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Закрити поточну сторінку"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Умовні визначення"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Створити нове визначення"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Ввімкнути i18n"
#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr "Введіть ідентифікатор процесу"
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr "Фільрувати рядки в списку з текстом"
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found but not listed here: "
msgstr "Знайдено, але тут не вказано: "
#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr "Виключені"
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr "При наступному збиранні примусово оновити PO-файли"
#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr "Ідентифікатори:"
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Параметри i18n"
#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr "Початкові рядки:"
#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr "Дані про версію зберігаються лише за умови, що їх підтримує формат виконуваного файлу."
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Включити версію до виконуваного файлу"
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Африкаанс"
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Арабська"
#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or English)"
msgstr "Автоматично (або англійська)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Каталонська"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Китайська"
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Чеська"
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Голландська"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Англійська"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Фінська"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Французька"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Німецька"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Іврит"
#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr "Угорська"
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Індонезійська"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Італійська"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Японська"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Литовська"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Мовні параметри"
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Польська"
#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr "Португальська"
#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "Бразильська португальська"
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Російська"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Вибір мови:"
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Словацька"
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Іспанська"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Турецька"
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Українська"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "&Основна версія:"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "&Другорядна версія:"
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Інша інформація"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Результуюча тека PO:"
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Ресурс"
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "Вилучити всі ресурси?"
#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr "Назва файлу"
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Тип"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Ревізія:"
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Виберіть успадкований елемент"
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Почати новий пошук"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Нумерація версій"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Команди меню Довідка"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Команда команди"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Команди інструментів коду"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Команди вибирання стовпців тексту"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Команди переміщення курсору"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Команди редагування тексту"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Команди файлового меню"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Команди згортання тексту"
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Макроси"
#: lazarusidestrconsts.srkmcatmarker
msgid "Text bookmark commands"
msgstr "Команди закладок"
#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr "Команд для декількох курсорів"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Команди меню Пакунок"
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Команди меню Проект"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Команди меню Виконати"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Команди пошуку і заміни тексту"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Команди вибирання тексту"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Команди блокноту зауважень до тексту програми"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Синхронне редагування"
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Синхронне редагування (не в комірці)"
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Синхронне редагування (при виборі)"
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Редагування шаблонів"
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Редагування шаблонів (не в комірці)"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Команди меню Інструменти"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Команди меню Перегляд"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Команда:"
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Конфлікт "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "перервати збирання"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Абстрактні методи ..."
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "додати точку зупинки за адресою"
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "додати точку зупинки в сирцевому коді"
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "додати дані/точку огляду"
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Додати точку переходу"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "додати спостереження"
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Приєднати до програми"
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Завершення шаблонів коду"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Копіювати блок"
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Видалити блок"
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Перейти до початку блока"
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Перейти до кінця блока"
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Сховати блок"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Зсунути блок вправо"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Перемістити блок"
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Вказати початок блока"
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Вказати кінець блока"
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Показати блок"
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Перемкнути блок"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Скасувати зсув блока вправо"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "зібрати програму/проект"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "зібрати файл"
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Зібрати Lazarus"
#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr "зібрати у багатьох режимах"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Символ"
#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr "очистити і зібрати"
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Видалити весь текст"
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Очистити всі закладки"
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "Очистити закладки для поточного файлу"
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Вибір стовпців вниз"
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Вибір стовпців до самого кінця"
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Вибір стовпців до самого початку"
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Вибір стовпців зліва"
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Вибір стовпців до кінця рядка"
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Вибір стовпців до початку рядка"
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Вибір стовпців до початку тексту в рядку"
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Вибрати стовпців до низу сторінки"
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Вибрати стовпців сторінку внизу"
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Вибрати стовпців до верху сторінки"
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Вибрати стовпців сторінку зверху"
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Вибір стовпців праворуч"
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Вибір стовпців вгору"
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Додати до вибору стовпців слово зліва"
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Додати до вибору стовпців слово справа"
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Режим вибору стовпців"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "компілювати програму/проект"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "файл налаштувань збірки"
#: lazarusidestrconsts.srkmeccopy
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Копіювати"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Копіювати редактор в нове вікно"
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Копіювати редактор в наступне вільне вікно"
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Копіювати редактор у попереднє вільне вікно"
#: lazarusidestrconsts.srkmeccut
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Вирізати"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Видалити до початку рядка"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Видалити символ біля курсору"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Видалити до кінця рядка"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Видалити останній символ"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Видалити до початку слова"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Видалити поточний рядок"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Видалити до кінця слова"
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Від'єднати від програми"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Порівнянти"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "Змістити курсор вниз"
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Пересунути курсор на абсолютний кінець"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Пересунути курсор на абсолютний початок"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Порожні методи ..."
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Параметри ІСР"
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "розрахувати/змінити"
#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Видобути процедуру"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Зовнішній інструмент %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Налаштування зовнішнього інструменту"
#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Пошук тексту"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Знайти інший кінець блока"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Знайти початок блока"
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Знайти опис"
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Знайти посилання на ідентифікатор"
#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Знайти у файлах"
#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Знайти далі"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Знайти наступне входження слова"
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr "Знайти перевантаження"
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr "Знайти перевантаження ..."
#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Знайти попередній"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Знайти попереднє входження слова"
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Знайти опис процедури"
#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr "Знайти метод процедури"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Згорнути під курсором"
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Згорнути до рівня %d"
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Перейти до редактора %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Перейти до директиви include поточного включеного файлу"
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Перейти до номера рядка"
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to bookmark %d"
msgstr "Перейти до закладки %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Перейти за координатою XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Передбачити зміщене $IFDEF"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr "Пересунути курсор вліво на частину слова (напр., ЗмішанийРегістр)"
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr "Пересунути курсор вправо на частину слова (напр., ЗмішанийРегістр)"
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Вставити елемент журналу змін"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Вставити з таблиці символів"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Вставити ключове слово CVS Author"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Вставити ключове слово CVS Date"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Вставити ключове слово CVS Header"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Вставити ключове слово CVS ID"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Вставити ключове слово CVS Log"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Вставити ключове слово CVS Name"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Вставити ключове слово CVS Revision"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Вставити ключове слово CVS Source"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Вставити поточні дату і час"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Вставити повний шлях до файлу"
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Вставити примітку про GPL"
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr "Вставити зауваження GPL (перекладено)"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Вставити GUID"
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Вставити примітку про LGPL"
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr "Вставити зауваження LGPL (перекладено)"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Розірвати рядок, залишити курсор"
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr "Вставити зауваження MIT"
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr "Вставити зауваження MIT (перекладено)"
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Режим вставки"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Вставити змінений LGPL допис"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr "Вставити зауваження зміненої LGPL (перекладено)"
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Вставити поточне ім'я користувача"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "перевірити"
#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Інвертувати присвоєння"
#: lazarusidestrconsts.srkmeckeymapleft
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Ліворуч"
#: lazarusidestrconsts.srkmeckeymapright
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Праворуч"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "Змістити курсор вліво"
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Розірвати рядок і зсунути курсор"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Пересунути курсор в кінець рядка"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Метод вибору рядка"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Пересунути курсор на початок рядка"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Змістити курсор до початку тексту в рядку"
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Заблокувати редактор"
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "Створити рядок ресурсу"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Перейти до відповідної дужки"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Пересунути редактор вліво"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Перемістити редактор вліво в кінець"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Перемістити редактор в нове вікно"
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Перемістити редактор в наступне вільне вікно"
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Перемістити редактор у попереднє вільне вікно"
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Пересунути редактор вправо"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Перемістити редактор вправо в кінець"
#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr "Мультиставляння"
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Наступна закладка"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Перейти до наступного редактора"
#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr "Перейти до наступного редактора в історії"
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Йти до наступного редактора з тим самим джерелом"
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Йти до наступного вікна"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Нормальний режим вибрання"
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "Відкрити файл під курсором"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Режим перезапису"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Пересунути курсор до низу сторінки"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Пересунути курсор вниз на одну сторінку"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Пересунути курсор вліво на одну сторінку"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Пересунути курсор вправо на одну сторінку"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Пересунути курсор на початок сторінки"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Пересунути курсор на попередню сторінку"
#: lazarusidestrconsts.srkmecpaste
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Вставити"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "призупинити програму"
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr "Очистити всі додаткові курсори"
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr "Клавіші курсору вилучають всі додаткові курсори"
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr "Клавіші курсору керують всіма додатковими курсорами"
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr "Встановити додатковий курсор"
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr "Перемкнути додатковий курсор"
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr "Вилучити додатковий курсор"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Попередня закладка"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Перейти до попереднього редактора"
#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr "Перейти до попереднього редактора в історії"
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Йти до попереднього редактора з тим самим джерелом"
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Йти до попереднього вікна"
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "швидке компілювання, без компонування"
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "видалити точку зупинки"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Видалити порожні методи"
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Видалити невикористані модулі"
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Перейменувати ID"
#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Замінити текст"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Повідомити про баг"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "скидання зневаджувача"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "Змістити курсор вправо"
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "запустити програму"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "запуск файлу"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "параметри запуску"
#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr "запустити без зневадження"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Прокрутити вниз один рядок"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Прокрутити вліво один символ"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Прокрутити вправо на один символ"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Прокрутити вверх на один рядок"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Вибрати вниз"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Вибрати все"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Перетворити табуляцію в пробіли у вибраному"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Вибрати до самого кінця"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Вибрати до самого початку"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Вибрати до координати XY"
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr "Вибрати частину слова ліворуч (напр., ЗмішанийРегістр)"
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr "Вибрати частину слова праворуч (напр., ЗмішанийРегістр)"
#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr "Вибрати зліва"
#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Вибрати кінець рядка"
#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Вибрати початок рядка"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Вибрати до початку тексту в рядку"
#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Вибрати низ сторінки"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Вибрати сторінку внизу"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Вибрати сторінку зліва"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Вибрати сторінку справа"
#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Вибрати верх сторінки"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Вибрати сторінку вгорі"
#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr "Вибрати справа"
#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr "Розумний вибір слова ліворуч (початок/кінець слова)"
#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr "Розумний вибір слова праворуч (початок/кінець слова)"
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr "Почати вибір з прив'язкою"
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr "Почати вибір з прив'язкою (стовпці)"
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr "Почати вибір з прив'язкою (рядки)"
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr "Закінчити вибір з прив'язкою"
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Вибрати вгору"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Вибрати кінець слова зліва"
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Вибрати кінець слова справа"
#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Вибрати слово зліва"
#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Вибрати слово справа"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Задати вільну закладку"
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set bookmark %d"
msgstr "Встановити закладку %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Показати абстрактні методи"
#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr "Показати контекст коду"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "показати точку виконання"
#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr "Розумне переміщення курсора ліворуч (початок/кінець слова)"
#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr "Розумне переміщення курсора праворуч (початок/кінець слова)"
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "зупинити програму"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Виконати макрос"
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Записати макрос"
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Йти до ост. позиції у комірці"
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Йти до перш. позиції в комірці"
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Вибрати комірку"
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Вийти"
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Наступна комірка"
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Наступна комірка (всі вибрані)"
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Наступна комірка (лише перші)"
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Наступна комірка (всі вибрані / лише перші)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Попередня комірка"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Попередня комірка (всі вибрані)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Попередня комірка (лише перші)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Попередня комірка (всі вибрані / лише перші)"
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Почати синхронне редагування"
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Йти до ост. позиції у комірці"
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Йти до перш. позиції у комірці"
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Вибрати комірку"
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Вийти"
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Фініш"
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Наступна комірка"
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Наступна комірка (обертати)"
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Наступна комірка (всі вибрані)"
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Наступна комірка (обертати / всі вибрані)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Наступна комірка (лише перші)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr "Наступна комірка (по колу / лише перші)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Наступна комірка (всі вибрані / лише перші)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr "Наступна комірка (по колу / всі вибрані / лише перші)"
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Попередня комірка"
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Попередня комірка (всі вибрані)"
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Попередня комірка (лише перші)"
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Попередня комірка (всі вибрані / лише перші)"
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Перевірка синтаксису"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Переглянути асемблер"
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "перемкнути точку зупинки"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Переглядання точок зупинки"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Переглядання стеку викликів"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Оглядач коду програми"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Показувати Дослідник коду"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Переглянути палітру компонетів"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Показати вивід зневаджувача"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Перемкнути модуль/форму"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Показати Редактор документації"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Переглянути швидкі клавіші графічної оболонки"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Переглядання локальних змінних"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle bookmark %d"
msgstr "Перемкнути закладку %d"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Перемкнути підсвічення поточного слова "
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Переглядання повідомлень"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Перемкнути режим"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Показувати інспектор об'єктів"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Переглянути регістри"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Дивитись браузер обмежень"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Показувати результати пошуку"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Показувати редактор тексту"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Показувати спостереження"
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Розгорунти все"
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Розгортати під курсором"
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "невідома команда редактора"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Невикористовувані модулі ..."
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "Змістити курсор вгору"
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Показувати редактор прив'язок"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Переглянути компоненти"
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Показати макроси редактора"
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Показувати форми"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Переглянути історію"
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr "Показати консольний ввід/вивід"
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Переглянути Таб-порядок"
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Переглянути нитки"
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Показувати залежності модулів"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Показувати відомості про модулі"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Показувати модулі"
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Завершення слів"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "Змістити крусор на кінець слова зліва"
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "Змістити крусор на кінець слова справа"
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Пересунути курсор на слово вліво"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Пересунути курсор на слово вправо"
#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr "Збільшити"
#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr "Зменшити"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Змінити кнопки команди"
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr "Продовжити з наступним відпусканням кнопки миші"
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr "Згорнути коментарі"
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Згорнути коментарі у вибраному"
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr "Згорнути неактивний блок IFDEF"
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr "Згорнути неактивний блок IFDEF (крім умовно активних)"
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr "Згорнути неактивний блок IFDEF у вибраному"
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr "Згорнути неактивний блок IFDEF у вибраному (крім умовно активних)"
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Приховати коментарі"
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Сховати коментарі у вибраному"
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr "Враховувати кнопку миші при її натисканні"
#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr "Враховувати рядок при натисканні кнопки миші"
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr "Враховувати модифікатори при натисканні кнопки миші"
#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr "Враховувати положення при натисканні кнопки миші"
#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr "Шукати всі дії при натисканні кнопки миші"
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr "Розгорнути активний блок IFDEF"
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr "Розгорнути активний блок IFDEF у вибраному"
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Розгорунти все"
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr "Розгорнути всі блоки IFDEF"
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr "Розгорнути всі блоки IFDEF у вибраному"
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr "Розгорнути все у вибраному"
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr "Розгорнути коментарі"
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr "Розгорнути коментарі у вибраному"
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr "Розгорнути неактивний блок IFDEF"
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr "Розгорнути неактивний блок IFDEF у вибраному"
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Файл тільки для читання"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Файл \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" не для запису."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Заблоковано"
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Запис"
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Зап-пауза"
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Додати спостереження біля курсору"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "Додати точку&огляду біля курсору"
#: lazarusidestrconsts.uembookmarknset
msgid "Bookmark &%s: %s"
msgstr "Закладка &%s: %s"
#: lazarusidestrconsts.uembookmarknunset
msgid "Bookmark &%s"
msgstr "Закладка &%s"
#: lazarusidestrconsts.uembookmarknunsetdisabled
msgid "Bookmark %s"
msgstr "Закладка %s"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Закрити всі &інші сторінки"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Закрити сторінку"
#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Копіювати назву файлу"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Клонувати у нове вікно"
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Клонувати в інше вікно"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Нове вікно"
#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Зневадження"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Кодування"
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "&Оцінити/Змінити ..."
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Знайти опис"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Знайти в іншому вікні"
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Перехід на закладку"
#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr "Перейти до закладки ..."
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Маркер"
#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "Слідкувати за ..."
#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Інвертувати присвоєння"
#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Кінець рядка"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Закріпити сторінку"
#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Перемістити сторінку вліво"
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Помістити сторінку в кінці зліва"
#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Перемістити сторінку вправо"
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Помістити сторінку в кінці справа"
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Перемістити у нове вікно"
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Перемістити в інше вікно"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Нове вікно"
#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Перейти до наступної закладки"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Змінено"
#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "&Відкрити файл біля курсору"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Перейти до попередньої закладки"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Процедурний перехід"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Тільки для читання"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Переробка коду"
#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Встановити вільну закладку"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Показувати нумерацію рядків"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Джерело"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Перемкнути закладку"
#: lazarusidestrconsts.uemtogglebookmarknset
msgid "Toggle Bookmark &%s: %s"
msgstr "Перемкнути закладку &%s: %s"
#: lazarusidestrconsts.uemtogglebookmarknunset
msgid "Toggle Bookmark &%s"
msgstr "Перемкнути закладку &%s"
#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr "Перемкнути закладку ..."
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "Перемкнути &точку зупинки"
#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Показувати стек викликів"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Ще не реалізовано"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "ВСТ"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "ЗАМ"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Тільки для читання"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Інформація про версію"
|