1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 3090 3091 3092 3093 3094 3095 3096 3097 3098 3099 3100 3101 3102 3103 3104 3105 3106 3107 3108 3109 3110 3111 3112 3113 3114 3115 3116 3117 3118 3119 3120 3121 3122 3123 3124 3125 3126 3127 3128 3129 3130 3131 3132 3133 3134 3135 3136 3137 3138 3139 3140 3141 3142 3143 3144 3145 3146 3147 3148 3149 3150 3151 3152 3153 3154 3155 3156 3157 3158 3159 3160 3161 3162 3163 3164 3165 3166 3167 3168 3169 3170 3171 3172 3173 3174 3175 3176 3177 3178 3179 3180 3181 3182 3183 3184 3185 3186 3187 3188 3189 3190 3191 3192 3193 3194 3195 3196 3197 3198 3199 3200 3201 3202 3203 3204 3205 3206 3207 3208 3209 3210 3211 3212 3213 3214 3215 3216 3217 3218 3219 3220 3221 3222 3223 3224 3225 3226 3227 3228 3229 3230 3231 3232 3233 3234 3235 3236 3237 3238 3239 3240 3241 3242 3243 3244 3245 3246 3247 3248 3249 3250 3251 3252 3253 3254 3255 3256 3257 3258 3259 3260 3261 3262 3263 3264 3265 3266 3267 3268 3269 3270 3271 3272 3273 3274 3275 3276 3277 3278 3279 3280 3281 3282 3283 3284 3285 3286 3287 3288 3289 3290 3291 3292 3293 3294 3295 3296 3297 3298 3299 3300 3301 3302 3303 3304 3305 3306 3307 3308 3309 3310 3311 3312 3313 3314 3315 3316 3317 3318 3319 3320 3321 3322 3323 3324 3325 3326 3327 3328 3329 3330 3331 3332 3333 3334 3335 3336 3337 3338 3339 3340 3341 3342 3343 3344 3345 3346 3347 3348 3349 3350 3351 3352 3353 3354 3355 3356 3357 3358 3359 3360 3361 3362 3363 3364 3365 3366 3367 3368 3369 3370 3371 3372 3373 3374 3375 3376 3377 3378 3379 3380 3381 3382 3383 3384 3385 3386 3387 3388 3389 3390 3391 3392 3393 3394 3395 3396 3397 3398 3399 3400 3401 3402 3403 3404 3405 3406 3407 3408 3409 3410 3411 3412 3413 3414 3415 3416 3417 3418 3419 3420 3421 3422 3423 3424 3425 3426 3427 3428 3429 3430 3431 3432 3433 3434 3435 3436 3437 3438 3439 3440 3441 3442 3443 3444 3445 3446 3447 3448 3449 3450 3451 3452 3453 3454 3455 3456 3457 3458 3459 3460 3461 3462 3463 3464 3465 3466 3467 3468 3469 3470 3471 3472 3473 3474 3475 3476 3477 3478 3479 3480 3481 3482 3483 3484 3485 3486 3487 3488 3489 3490 3491 3492 3493 3494 3495 3496 3497 3498 3499 3500 3501 3502 3503 3504 3505 3506 3507 3508 3509 3510 3511 3512 3513 3514 3515 3516 3517 3518 3519 3520 3521 3522 3523 3524 3525 3526 3527 3528 3529 3530 3531 3532 3533 3534 3535 3536 3537 3538 3539 3540 3541 3542 3543 3544 3545 3546 3547 3548 3549 3550 3551 3552 3553 3554 3555 3556 3557 3558 3559 3560 3561 3562 3563 3564 3565 3566 3567 3568 3569 3570 3571 3572 3573 3574 3575 3576 3577 3578 3579 3580 3581 3582 3583 3584 3585 3586 3587 3588 3589 3590 3591 3592 3593 3594 3595 3596 3597 3598 3599 3600 3601 3602 3603 3604 3605 3606 3607 3608 3609 3610 3611 3612 3613 3614 3615 3616 3617 3618 3619 3620 3621 3622 3623 3624 3625 3626 3627 3628 3629 3630 3631 3632 3633 3634 3635 3636 3637 3638 3639 3640 3641 3642 3643 3644 3645 3646 3647 3648 3649 3650 3651 3652 3653 3654 3655 3656 3657 3658 3659 3660 3661 3662 3663 3664 3665 3666 3667 3668 3669 3670 3671 3672 3673 3674 3675 3676 3677 3678 3679 3680 3681 3682 3683 3684 3685 3686 3687 3688 3689 3690 3691 3692 3693 3694 3695 3696 3697 3698 3699 3700 3701 3702 3703 3704 3705 3706 3707 3708 3709 3710 3711 3712 3713 3714 3715 3716 3717 3718 3719 3720 3721 3722 3723 3724 3725 3726 3727 3728 3729 3730 3731 3732 3733 3734 3735 3736 3737 3738 3739 3740 3741 3742 3743 3744 3745 3746 3747 3748 3749 3750 3751 3752 3753 3754 3755 3756 3757 3758 3759 3760 3761 3762 3763 3764 3765 3766 3767 3768 3769 3770 3771 3772 3773 3774 3775 3776 3777 3778 3779 3780 3781 3782 3783 3784 3785 3786 3787 3788 3789 3790 3791 3792 3793 3794 3795 3796 3797 3798 3799 3800 3801 3802 3803 3804 3805 3806 3807 3808 3809 3810 3811 3812 3813 3814 3815 3816 3817 3818 3819 3820 3821 3822 3823 3824 3825 3826 3827 3828 3829 3830 3831 3832 3833 3834 3835 3836 3837 3838 3839 3840 3841 3842 3843 3844 3845 3846 3847 3848 3849 3850 3851 3852 3853 3854 3855 3856 3857 3858 3859 3860 3861 3862 3863 3864 3865 3866 3867 3868 3869 3870 3871 3872 3873 3874 3875 3876 3877 3878 3879 3880 3881 3882 3883 3884 3885 3886 3887 3888 3889 3890 3891 3892 3893 3894 3895 3896 3897 3898 3899 3900 3901 3902 3903 3904 3905 3906 3907 3908 3909 3910 3911 3912 3913 3914 3915 3916 3917 3918 3919 3920 3921 3922 3923 3924 3925 3926 3927 3928 3929 3930 3931 3932 3933 3934 3935 3936 3937 3938 3939 3940 3941 3942 3943 3944 3945 3946 3947 3948 3949 3950 3951 3952 3953 3954 3955 3956 3957 3958 3959 3960 3961 3962 3963 3964 3965 3966 3967 3968 3969 3970 3971 3972 3973 3974 3975 3976 3977 3978 3979 3980 3981 3982 3983 3984 3985 3986 3987 3988 3989 3990 3991 3992 3993 3994 3995 3996 3997 3998 3999 4000 4001 4002 4003 4004 4005 4006 4007 4008 4009 4010 4011 4012 4013 4014 4015 4016 4017 4018 4019 4020 4021 4022 4023 4024 4025 4026 4027 4028 4029 4030 4031 4032 4033 4034 4035 4036 4037 4038 4039 4040 4041 4042 4043 4044 4045 4046 4047 4048 4049 4050 4051 4052 4053 4054 4055 4056 4057 4058 4059 4060 4061 4062 4063 4064 4065 4066 4067 4068 4069 4070 4071 4072 4073 4074 4075 4076 4077 4078 4079 4080 4081 4082 4083 4084 4085 4086 4087 4088 4089 4090 4091 4092 4093 4094 4095 4096 4097 4098 4099 4100 4101 4102 4103 4104 4105 4106 4107 4108 4109 4110 4111 4112 4113 4114 4115 4116 4117 4118 4119 4120 4121 4122 4123 4124 4125 4126 4127 4128 4129 4130 4131 4132 4133 4134 4135 4136 4137 4138 4139 4140 4141 4142 4143 4144 4145 4146 4147 4148 4149 4150 4151 4152 4153 4154 4155 4156 4157 4158 4159 4160 4161 4162 4163 4164 4165 4166 4167 4168 4169 4170 4171 4172 4173 4174 4175 4176 4177 4178 4179 4180 4181 4182 4183 4184 4185 4186 4187 4188 4189 4190 4191 4192 4193 4194 4195 4196 4197 4198 4199 4200 4201 4202 4203 4204 4205 4206 4207 4208 4209 4210 4211 4212 4213 4214 4215 4216 4217 4218 4219 4220 4221 4222 4223 4224 4225 4226 4227 4228 4229 4230 4231 4232 4233 4234 4235 4236 4237 4238 4239 4240 4241 4242 4243 4244 4245 4246 4247 4248 4249 4250 4251 4252 4253 4254 4255 4256 4257 4258 4259 4260 4261 4262 4263 4264 4265 4266 4267 4268 4269 4270 4271 4272 4273 4274 4275 4276 4277 4278 4279 4280 4281 4282 4283 4284 4285 4286 4287 4288 4289 4290 4291 4292 4293 4294 4295 4296 4297 4298 4299 4300 4301 4302 4303 4304 4305 4306 4307 4308 4309 4310 4311 4312 4313 4314 4315 4316 4317 4318 4319 4320 4321 4322 4323 4324 4325 4326 4327 4328 4329 4330 4331 4332 4333 4334 4335 4336 4337 4338 4339 4340 4341 4342 4343 4344 4345 4346 4347 4348 4349 4350 4351 4352 4353 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4368 4369 4370 4371 4372 4373 4374 4375 4376 4377 4378 4379 4380 4381 4382 4383 4384 4385 4386 4387 4388 4389 4390 4391 4392 4393 4394 4395 4396 4397 4398 4399 4400 4401 4402 4403 4404 4405 4406 4407 4408 4409 4410 4411 4412 4413 4414 4415 4416 4417 4418 4419 4420 4421 4422 4423 4424 4425 4426 4427 4428 4429 4430 4431 4432 4433 4434 4435 4436 4437 4438 4439 4440 4441 4442 4443 4444 4445 4446 4447 4448 4449 4450 4451 4452 4453 4454 4455 4456 4457 4458 4459 4460 4461 4462 4463 4464 4465 4466 4467 4468 4469 4470 4471 4472 4473 4474 4475 4476 4477 4478 4479 4480 4481 4482 4483 4484 4485 4486 4487 4488 4489 4490 4491 4492 4493 4494 4495 4496 4497 4498 4499 4500 4501 4502 4503 4504 4505 4506 4507 4508 4509 4510 4511 4512 4513 4514 4515 4516 4517 4518 4519 4520 4521 4522 4523 4524 4525 4526 4527 4528 4529 4530 4531 4532 4533 4534 4535 4536 4537 4538 4539 4540 4541 4542 4543 4544 4545 4546 4547 4548 4549 4550 4551 4552 4553 4554 4555 4556 4557 4558 4559 4560 4561 4562 4563 4564 4565 4566 4567 4568 4569 4570 4571 4572 4573 4574 4575 4576 4577 4578 4579 4580 4581 4582 4583 4584 4585 4586 4587 4588 4589 4590 4591 4592 4593 4594 4595 4596 4597 4598 4599 4600 4601 4602 4603 4604 4605 4606 4607 4608 4609 4610 4611 4612 4613 4614 4615 4616 4617 4618 4619 4620 4621 4622 4623 4624 4625 4626 4627 4628 4629 4630 4631 4632 4633 4634 4635 4636 4637 4638 4639 4640 4641 4642 4643 4644 4645 4646 4647 4648 4649 4650 4651 4652 4653 4654 4655 4656 4657 4658 4659 4660 4661 4662 4663 4664 4665 4666 4667 4668 4669 4670 4671 4672 4673 4674 4675 4676 4677 4678 4679 4680 4681 4682 4683 4684 4685 4686 4687 4688 4689 4690 4691 4692 4693 4694 4695 4696 4697 4698 4699 4700 4701 4702 4703 4704 4705 4706 4707 4708 4709 4710 4711 4712 4713 4714 4715 4716 4717 4718 4719 4720 4721 4722 4723 4724 4725 4726 4727 4728 4729 4730 4731 4732 4733 4734 4735 4736 4737 4738 4739 4740 4741 4742 4743 4744 4745 4746 4747 4748 4749 4750 4751 4752 4753 4754 4755 4756 4757 4758 4759 4760 4761 4762 4763 4764 4765 4766 4767 4768 4769 4770 4771 4772 4773 4774 4775 4776 4777 4778 4779 4780 4781 4782 4783 4784 4785 4786 4787 4788 4789 4790 4791 4792 4793 4794 4795 4796 4797 4798 4799 4800 4801 4802 4803 4804 4805 4806 4807 4808 4809 4810 4811 4812 4813 4814 4815 4816 4817 4818 4819 4820 4821 4822 4823 4824 4825 4826 4827 4828 4829 4830 4831 4832 4833 4834 4835 4836 4837 4838 4839 4840 4841 4842 4843 4844 4845 4846 4847 4848 4849 4850 4851 4852 4853 4854 4855 4856 4857 4858 4859 4860 4861 4862 4863 4864 4865 4866 4867 4868 4869 4870 4871 4872 4873 4874 4875 4876 4877 4878 4879 4880 4881 4882 4883 4884 4885 4886 4887 4888 4889 4890 4891 4892 4893 4894 4895 4896 4897 4898 4899 4900 4901 4902 4903 4904 4905 4906 4907 4908 4909 4910 4911 4912 4913 4914 4915 4916 4917 4918 4919 4920 4921 4922 4923 4924 4925 4926 4927 4928 4929 4930 4931 4932 4933 4934 4935 4936 4937 4938 4939 4940 4941 4942 4943 4944 4945 4946 4947 4948 4949 4950 4951 4952 4953 4954 4955 4956 4957 4958 4959 4960 4961 4962 4963 4964 4965 4966 4967 4968 4969 4970 4971 4972 4973 4974 4975 4976 4977 4978 4979 4980 4981 4982 4983 4984 4985 4986 4987 4988 4989 4990 4991 4992 4993 4994 4995 4996 4997 4998 4999 5000 5001 5002 5003 5004 5005 5006 5007 5008 5009 5010 5011 5012 5013 5014 5015 5016 5017 5018 5019 5020 5021 5022 5023 5024 5025 5026 5027 5028 5029 5030 5031 5032 5033 5034 5035 5036 5037 5038 5039 5040 5041 5042 5043 5044 5045 5046 5047 5048 5049 5050 5051 5052 5053 5054 5055 5056 5057 5058 5059 5060 5061 5062 5063 5064 5065 5066 5067 5068 5069 5070 5071 5072 5073 5074 5075 5076 5077 5078 5079 5080 5081 5082 5083 5084 5085 5086 5087 5088 5089 5090 5091 5092 5093 5094 5095 5096 5097 5098 5099 5100 5101 5102 5103 5104 5105 5106 5107 5108 5109 5110 5111 5112 5113 5114 5115 5116 5117 5118 5119 5120 5121 5122 5123 5124 5125 5126 5127 5128 5129 5130 5131 5132 5133 5134 5135 5136 5137 5138 5139 5140 5141 5142 5143 5144 5145 5146 5147 5148 5149 5150 5151 5152 5153 5154 5155 5156 5157 5158 5159 5160 5161 5162 5163 5164 5165 5166 5167 5168 5169 5170 5171 5172 5173 5174 5175 5176 5177 5178 5179 5180 5181 5182 5183 5184 5185 5186 5187 5188 5189 5190 5191 5192 5193 5194 5195 5196 5197 5198 5199 5200 5201 5202 5203 5204 5205 5206 5207 5208 5209 5210 5211 5212 5213 5214 5215 5216 5217 5218 5219 5220 5221 5222 5223 5224 5225 5226 5227 5228 5229 5230 5231 5232 5233 5234 5235 5236 5237 5238 5239 5240 5241 5242 5243 5244 5245 5246 5247 5248 5249 5250 5251 5252 5253 5254 5255 5256 5257 5258 5259 5260 5261 5262 5263 5264 5265 5266 5267 5268 5269 5270 5271 5272 5273 5274 5275 5276 5277 5278 5279 5280 5281 5282 5283 5284 5285 5286 5287 5288 5289 5290 5291 5292 5293 5294 5295 5296 5297 5298 5299 5300 5301 5302 5303 5304 5305 5306 5307 5308 5309 5310 5311 5312 5313 5314 5315 5316 5317 5318 5319 5320 5321 5322 5323 5324 5325 5326 5327 5328 5329 5330 5331 5332 5333 5334 5335 5336 5337 5338 5339 5340 5341 5342 5343 5344 5345 5346 5347 5348 5349 5350 5351 5352 5353 5354 5355 5356 5357 5358 5359 5360 5361 5362 5363 5364 5365 5366 5367 5368 5369 5370 5371 5372 5373 5374 5375 5376 5377 5378 5379 5380 5381 5382 5383 5384 5385 5386 5387 5388 5389 5390 5391 5392 5393 5394 5395 5396 5397 5398 5399 5400 5401 5402 5403 5404 5405 5406 5407 5408 5409 5410 5411 5412 5413 5414 5415 5416 5417 5418 5419 5420 5421 5422 5423 5424 5425 5426 5427 5428 5429 5430 5431 5432 5433 5434 5435 5436 5437 5438 5439 5440 5441 5442 5443 5444 5445 5446 5447 5448 5449 5450 5451 5452 5453 5454 5455 5456 5457 5458 5459 5460 5461 5462 5463 5464 5465 5466 5467 5468 5469 5470 5471 5472 5473 5474 5475 5476 5477 5478 5479 5480 5481 5482 5483 5484 5485 5486 5487 5488 5489 5490 5491 5492 5493 5494 5495 5496 5497 5498 5499 5500 5501 5502 5503 5504 5505 5506 5507 5508 5509 5510 5511 5512 5513 5514 5515 5516 5517 5518 5519 5520 5521 5522 5523 5524 5525 5526 5527 5528 5529 5530 5531 5532 5533 5534 5535 5536 5537 5538 5539 5540 5541 5542 5543 5544 5545 5546 5547 5548 5549 5550 5551 5552 5553 5554 5555 5556 5557 5558 5559 5560 5561 5562 5563 5564 5565 5566 5567 5568 5569 5570 5571 5572 5573 5574 5575 5576 5577 5578 5579 5580 5581 5582 5583 5584 5585 5586 5587 5588 5589 5590 5591 5592 5593 5594 5595 5596 5597 5598 5599 5600 5601 5602 5603 5604 5605 5606 5607 5608 5609 5610 5611 5612 5613 5614 5615 5616 5617 5618 5619 5620 5621 5622 5623 5624 5625 5626 5627 5628 5629 5630 5631 5632 5633 5634 5635 5636 5637 5638 5639 5640 5641 5642 5643 5644 5645 5646 5647 5648 5649 5650 5651 5652 5653 5654 5655 5656 5657 5658 5659 5660 5661 5662 5663 5664 5665 5666 5667 5668 5669 5670 5671 5672 5673 5674 5675 5676 5677 5678 5679 5680 5681 5682 5683 5684 5685 5686 5687 5688 5689 5690 5691 5692 5693 5694 5695 5696 5697 5698 5699 5700 5701 5702 5703 5704 5705 5706 5707 5708 5709 5710 5711 5712 5713 5714 5715 5716 5717 5718 5719 5720 5721 5722 5723 5724 5725 5726 5727 5728 5729 5730 5731 5732 5733 5734 5735 5736 5737 5738 5739 5740 5741 5742 5743 5744 5745 5746 5747 5748 5749 5750 5751 5752 5753 5754 5755 5756 5757 5758 5759 5760 5761 5762 5763 5764 5765 5766 5767 5768 5769 5770 5771 5772 5773 5774 5775 5776 5777 5778 5779 5780 5781 5782 5783 5784 5785 5786 5787 5788 5789 5790 5791 5792 5793 5794 5795 5796 5797 5798 5799 5800 5801 5802 5803 5804 5805 5806 5807 5808 5809 5810 5811 5812 5813 5814 5815 5816 5817 5818 5819 5820 5821 5822 5823 5824 5825 5826 5827 5828 5829 5830 5831 5832 5833 5834 5835 5836 5837 5838 5839 5840 5841 5842 5843 5844 5845 5846 5847 5848 5849 5850 5851 5852 5853 5854 5855 5856 5857 5858 5859 5860 5861 5862 5863 5864 5865 5866 5867 5868 5869 5870 5871 5872 5873 5874 5875 5876 5877 5878 5879 5880 5881 5882 5883 5884 5885 5886 5887 5888 5889 5890 5891 5892 5893 5894 5895 5896 5897 5898 5899 5900 5901 5902 5903 5904 5905 5906 5907 5908 5909 5910 5911 5912 5913 5914 5915 5916 5917 5918 5919 5920 5921 5922 5923 5924 5925 5926 5927 5928 5929 5930 5931 5932 5933 5934 5935 5936 5937 5938 5939 5940 5941 5942 5943 5944 5945 5946 5947 5948 5949 5950 5951 5952 5953 5954 5955 5956 5957 5958 5959 5960 5961 5962 5963 5964 5965 5966 5967 5968 5969 5970 5971 5972 5973 5974 5975 5976 5977 5978 5979 5980 5981 5982 5983 5984 5985 5986 5987 5988 5989 5990 5991 5992 5993 5994 5995 5996 5997 5998 5999 6000 6001 6002 6003 6004 6005 6006 6007 6008 6009 6010 6011 6012 6013 6014 6015 6016 6017 6018 6019 6020 6021 6022 6023 6024 6025 6026 6027 6028 6029 6030 6031 6032 6033 6034 6035 6036 6037 6038 6039 6040 6041 6042 6043 6044 6045 6046 6047 6048 6049 6050 6051 6052 6053 6054 6055 6056 6057 6058 6059 6060 6061 6062 6063 6064 6065 6066 6067 6068 6069 6070 6071 6072 6073 6074 6075 6076 6077 6078 6079 6080 6081 6082 6083 6084 6085 6086 6087 6088 6089 6090 6091 6092 6093 6094 6095 6096 6097 6098 6099 6100 6101 6102 6103 6104 6105 6106 6107 6108 6109 6110 6111 6112 6113 6114 6115 6116 6117 6118 6119 6120 6121 6122 6123 6124 6125 6126 6127 6128 6129 6130 6131 6132 6133 6134 6135 6136 6137 6138 6139 6140 6141 6142 6143 6144 6145 6146 6147 6148 6149 6150 6151 6152 6153 6154 6155 6156 6157 6158 6159 6160 6161 6162 6163 6164 6165 6166 6167 6168 6169 6170 6171 6172 6173 6174 6175 6176 6177 6178 6179 6180 6181 6182 6183 6184 6185 6186 6187 6188 6189 6190 6191 6192 6193 6194 6195 6196 6197 6198 6199 6200 6201 6202 6203 6204 6205 6206 6207 6208 6209 6210 6211 6212 6213 6214 6215 6216 6217 6218 6219 6220 6221 6222 6223 6224 6225 6226 6227 6228 6229 6230 6231 6232 6233 6234 6235 6236 6237 6238 6239 6240 6241 6242 6243 6244 6245 6246 6247 6248 6249 6250 6251 6252 6253 6254 6255 6256 6257 6258 6259 6260 6261 6262 6263 6264 6265 6266 6267 6268 6269 6270 6271 6272 6273 6274 6275 6276 6277 6278 6279 6280 6281 6282 6283 6284 6285 6286 6287 6288 6289 6290 6291 6292 6293 6294 6295 6296 6297 6298 6299 6300 6301 6302 6303 6304 6305 6306 6307 6308 6309 6310 6311 6312 6313 6314 6315 6316 6317 6318 6319 6320 6321 6322 6323 6324 6325 6326 6327 6328 6329 6330 6331 6332 6333 6334 6335 6336 6337 6338 6339 6340 6341 6342 6343 6344 6345 6346 6347 6348 6349 6350 6351 6352 6353 6354 6355 6356 6357 6358 6359 6360 6361 6362 6363 6364 6365 6366 6367 6368 6369 6370 6371 6372 6373 6374 6375 6376 6377 6378 6379 6380 6381 6382 6383 6384 6385 6386 6387 6388 6389 6390 6391 6392 6393 6394 6395 6396 6397 6398 6399 6400 6401 6402 6403 6404 6405 6406 6407 6408 6409 6410 6411 6412 6413 6414 6415 6416 6417 6418 6419 6420 6421 6422 6423 6424 6425 6426 6427 6428 6429 6430 6431 6432 6433 6434 6435 6436 6437 6438 6439 6440 6441 6442 6443 6444 6445 6446 6447 6448 6449 6450 6451 6452 6453 6454 6455 6456 6457 6458 6459 6460 6461 6462 6463 6464 6465 6466 6467 6468 6469 6470 6471 6472 6473 6474 6475 6476 6477 6478 6479 6480 6481 6482 6483 6484 6485 6486 6487 6488 6489 6490 6491 6492 6493 6494 6495 6496 6497 6498 6499 6500 6501 6502 6503 6504 6505 6506 6507 6508 6509 6510 6511 6512 6513 6514 6515 6516 6517 6518 6519 6520 6521 6522 6523 6524 6525 6526 6527 6528 6529 6530 6531 6532 6533 6534 6535 6536 6537 6538 6539 6540 6541 6542 6543 6544 6545 6546 6547 6548 6549 6550 6551 6552 6553 6554 6555 6556 6557 6558 6559 6560 6561 6562 6563 6564 6565 6566 6567 6568 6569 6570 6571 6572 6573 6574 6575 6576 6577 6578 6579 6580 6581 6582 6583 6584 6585 6586 6587 6588 6589 6590 6591 6592 6593 6594 6595 6596 6597 6598 6599 6600 6601 6602 6603 6604 6605 6606 6607 6608 6609 6610 6611 6612 6613 6614 6615 6616 6617 6618 6619 6620 6621 6622 6623 6624 6625 6626 6627 6628 6629 6630 6631 6632 6633 6634 6635 6636 6637 6638 6639 6640 6641 6642 6643 6644 6645 6646 6647 6648 6649 6650 6651 6652 6653 6654 6655 6656 6657 6658 6659 6660 6661 6662 6663 6664 6665 6666 6667 6668 6669 6670 6671 6672 6673 6674 6675 6676 6677 6678 6679 6680 6681 6682 6683 6684 6685 6686 6687 6688 6689 6690 6691 6692 6693 6694 6695 6696 6697 6698 6699 6700 6701 6702 6703 6704 6705 6706 6707 6708 6709 6710 6711 6712 6713 6714 6715 6716 6717 6718 6719 6720 6721 6722 6723 6724 6725 6726 6727 6728 6729 6730 6731 6732 6733 6734 6735 6736 6737 6738 6739 6740 6741 6742 6743 6744 6745 6746 6747 6748 6749 6750 6751 6752 6753 6754 6755 6756 6757 6758 6759 6760 6761 6762 6763 6764 6765 6766 6767 6768 6769 6770 6771 6772 6773 6774 6775 6776 6777 6778 6779 6780 6781 6782 6783 6784 6785 6786 6787 6788 6789 6790 6791 6792 6793 6794 6795 6796 6797 6798 6799 6800 6801 6802 6803 6804 6805 6806 6807 6808 6809 6810 6811 6812 6813 6814 6815 6816 6817 6818 6819 6820 6821 6822 6823 6824 6825 6826 6827 6828 6829 6830 6831 6832 6833 6834 6835 6836 6837 6838 6839 6840 6841 6842 6843 6844 6845 6846 6847 6848 6849 6850 6851 6852 6853 6854 6855 6856 6857 6858 6859 6860 6861 6862 6863 6864 6865 6866 6867 6868 6869 6870 6871 6872 6873 6874 6875 6876 6877 6878 6879 6880 6881 6882 6883 6884 6885 6886 6887 6888 6889 6890 6891 6892 6893 6894 6895 6896 6897 6898 6899 6900 6901 6902 6903 6904 6905 6906 6907 6908 6909 6910 6911 6912 6913 6914 6915 6916 6917 6918 6919 6920 6921 6922 6923 6924 6925 6926 6927 6928 6929 6930 6931 6932 6933 6934 6935 6936 6937 6938 6939 6940 6941 6942 6943 6944 6945 6946 6947 6948 6949 6950 6951 6952 6953 6954 6955 6956 6957 6958 6959 6960 6961 6962 6963 6964 6965 6966 6967 6968 6969 6970 6971 6972 6973 6974 6975 6976 6977 6978 6979 6980 6981 6982 6983 6984 6985 6986 6987 6988 6989 6990 6991 6992 6993 6994 6995 6996 6997 6998 6999 7000 7001 7002 7003 7004 7005 7006 7007 7008 7009 7010 7011 7012 7013 7014 7015 7016 7017 7018 7019 7020 7021 7022 7023 7024 7025 7026 7027 7028 7029 7030 7031 7032 7033 7034 7035 7036 7037 7038 7039 7040 7041 7042 7043 7044 7045 7046 7047 7048 7049 7050 7051 7052 7053 7054 7055 7056 7057 7058 7059 7060 7061 7062 7063 7064 7065 7066 7067 7068 7069 7070 7071 7072 7073 7074 7075 7076 7077 7078 7079 7080 7081 7082 7083 7084 7085 7086 7087 7088 7089 7090 7091 7092 7093 7094 7095 7096 7097 7098 7099 7100 7101 7102 7103 7104 7105 7106 7107 7108 7109 7110 7111 7112 7113 7114 7115 7116 7117 7118 7119 7120 7121 7122 7123 7124 7125 7126 7127 7128 7129 7130 7131 7132 7133 7134 7135 7136 7137 7138 7139 7140 7141 7142 7143 7144 7145 7146 7147 7148 7149 7150 7151 7152 7153 7154 7155 7156 7157 7158 7159 7160 7161 7162 7163 7164 7165 7166 7167 7168 7169 7170 7171 7172 7173 7174 7175 7176 7177 7178 7179 7180 7181 7182 7183 7184 7185 7186 7187 7188 7189 7190 7191 7192 7193 7194 7195 7196 7197 7198 7199 7200 7201 7202 7203 7204 7205 7206 7207 7208 7209 7210 7211 7212 7213 7214 7215 7216 7217 7218 7219 7220 7221 7222 7223 7224 7225 7226 7227 7228 7229 7230 7231 7232 7233 7234 7235 7236 7237 7238 7239 7240 7241 7242 7243 7244 7245 7246 7247 7248 7249 7250 7251 7252 7253 7254 7255 7256 7257 7258 7259 7260 7261 7262 7263 7264 7265 7266 7267 7268 7269 7270 7271 7272 7273 7274 7275 7276 7277 7278 7279 7280 7281 7282 7283 7284 7285 7286 7287 7288 7289 7290 7291 7292 7293 7294 7295 7296 7297 7298 7299 7300 7301 7302 7303 7304 7305 7306 7307 7308 7309 7310 7311 7312 7313 7314 7315 7316 7317 7318 7319 7320 7321 7322 7323 7324 7325 7326 7327 7328 7329 7330 7331 7332 7333 7334 7335 7336 7337 7338 7339 7340 7341 7342 7343 7344 7345 7346 7347 7348 7349 7350 7351 7352 7353 7354 7355 7356 7357 7358 7359 7360 7361 7362 7363 7364 7365 7366 7367 7368 7369 7370 7371 7372 7373 7374 7375 7376 7377 7378 7379 7380 7381 7382 7383 7384 7385 7386 7387 7388 7389 7390 7391 7392 7393 7394 7395 7396 7397 7398 7399 7400 7401 7402 7403 7404 7405 7406 7407 7408 7409 7410 7411 7412 7413 7414 7415 7416 7417 7418 7419 7420 7421 7422 7423 7424 7425 7426 7427 7428 7429 7430 7431 7432 7433 7434 7435 7436 7437 7438 7439 7440 7441 7442 7443 7444 7445 7446 7447 7448 7449 7450 7451 7452 7453 7454 7455 7456 7457 7458 7459 7460 7461 7462 7463 7464 7465 7466 7467 7468 7469 7470 7471 7472 7473 7474 7475 7476 7477 7478 7479 7480 7481 7482 7483 7484 7485 7486 7487 7488 7489 7490 7491 7492 7493 7494 7495 7496 7497 7498 7499 7500 7501 7502 7503 7504 7505 7506 7507 7508 7509 7510 7511 7512 7513 7514 7515 7516 7517 7518 7519 7520 7521 7522 7523 7524 7525 7526 7527 7528 7529 7530 7531 7532 7533 7534 7535 7536 7537 7538 7539 7540 7541 7542 7543 7544 7545 7546 7547 7548 7549 7550 7551 7552 7553 7554 7555 7556 7557 7558 7559 7560 7561 7562 7563 7564 7565 7566 7567 7568 7569 7570 7571 7572 7573 7574 7575 7576 7577 7578 7579 7580 7581 7582 7583 7584 7585 7586 7587 7588 7589 7590 7591 7592 7593 7594 7595 7596 7597 7598 7599 7600 7601 7602 7603 7604 7605 7606 7607 7608 7609 7610 7611 7612 7613 7614 7615 7616 7617 7618 7619 7620 7621 7622 7623 7624 7625 7626 7627 7628 7629 7630 7631 7632 7633 7634 7635 7636 7637 7638 7639 7640 7641 7642 7643 7644 7645 7646 7647 7648 7649 7650 7651 7652 7653 7654 7655 7656 7657 7658 7659 7660 7661 7662 7663 7664 7665 7666 7667 7668 7669 7670 7671 7672 7673 7674 7675 7676 7677 7678 7679 7680 7681 7682 7683 7684 7685 7686 7687 7688 7689 7690 7691 7692 7693 7694 7695 7696 7697 7698 7699 7700 7701 7702 7703 7704 7705 7706 7707 7708 7709 7710 7711 7712 7713 7714 7715 7716 7717 7718 7719 7720 7721 7722 7723 7724 7725 7726 7727 7728 7729 7730 7731 7732 7733 7734 7735 7736 7737 7738 7739 7740 7741 7742 7743 7744 7745 7746 7747 7748 7749 7750 7751 7752 7753 7754 7755 7756 7757 7758 7759 7760 7761 7762 7763 7764 7765 7766 7767 7768 7769 7770 7771 7772 7773 7774 7775 7776 7777 7778 7779 7780 7781 7782 7783 7784 7785 7786 7787 7788 7789 7790 7791 7792 7793 7794 7795 7796 7797 7798 7799 7800 7801 7802 7803 7804 7805 7806 7807 7808 7809 7810 7811 7812 7813 7814 7815 7816 7817 7818 7819 7820 7821 7822 7823 7824 7825 7826 7827 7828 7829 7830 7831 7832 7833 7834 7835 7836 7837 7838 7839 7840 7841 7842 7843 7844 7845 7846 7847 7848 7849 7850 7851 7852 7853 7854 7855 7856 7857 7858 7859 7860 7861 7862 7863 7864 7865 7866 7867 7868 7869 7870 7871 7872 7873 7874 7875 7876 7877 7878 7879 7880 7881 7882 7883 7884 7885 7886 7887 7888 7889 7890 7891 7892 7893 7894 7895 7896 7897 7898 7899 7900 7901 7902 7903 7904 7905 7906 7907 7908 7909 7910 7911 7912 7913 7914 7915 7916 7917 7918 7919 7920 7921 7922 7923 7924 7925 7926 7927 7928 7929 7930 7931 7932 7933 7934 7935 7936 7937 7938 7939 7940 7941 7942 7943 7944 7945 7946 7947 7948 7949 7950 7951 7952 7953 7954 7955 7956 7957 7958 7959 7960 7961 7962 7963 7964 7965 7966 7967 7968 7969 7970 7971 7972 7973 7974 7975 7976 7977 7978 7979 7980 7981 7982 7983 7984 7985 7986 7987 7988 7989 7990 7991 7992 7993 7994 7995 7996 7997 7998 7999 8000 8001 8002 8003 8004 8005 8006 8007 8008 8009 8010 8011 8012 8013 8014 8015 8016 8017 8018 8019 8020 8021 8022 8023 8024 8025 8026 8027 8028 8029 8030 8031 8032 8033 8034 8035 8036 8037 8038 8039 8040 8041 8042 8043 8044 8045 8046 8047 8048 8049 8050 8051 8052 8053 8054 8055 8056 8057 8058 8059 8060 8061 8062 8063 8064 8065 8066 8067 8068 8069 8070 8071 8072 8073 8074 8075 8076 8077 8078 8079 8080 8081 8082 8083 8084 8085 8086 8087 8088 8089 8090 8091 8092 8093 8094 8095 8096 8097 8098 8099 8100 8101 8102 8103 8104 8105 8106 8107 8108 8109 8110 8111 8112 8113 8114 8115 8116 8117 8118 8119 8120 8121 8122 8123 8124 8125 8126 8127 8128 8129 8130 8131 8132 8133 8134 8135 8136 8137 8138 8139 8140 8141 8142 8143 8144 8145 8146 8147 8148 8149 8150 8151 8152 8153 8154 8155 8156 8157 8158 8159 8160 8161 8162 8163 8164 8165 8166 8167 8168 8169 8170 8171 8172 8173 8174 8175 8176 8177 8178 8179 8180 8181 8182 8183 8184 8185 8186 8187 8188 8189 8190 8191 8192 8193 8194 8195 8196 8197 8198 8199 8200 8201 8202 8203 8204 8205 8206 8207 8208 8209 8210 8211 8212 8213 8214 8215 8216 8217 8218 8219 8220 8221 8222 8223 8224 8225 8226 8227 8228 8229 8230 8231 8232 8233 8234 8235 8236 8237 8238 8239 8240 8241 8242 8243 8244 8245 8246 8247 8248 8249 8250 8251 8252 8253 8254 8255 8256 8257 8258 8259 8260 8261 8262 8263 8264 8265 8266 8267 8268 8269 8270 8271 8272 8273 8274 8275 8276 8277 8278 8279 8280 8281 8282 8283 8284 8285 8286 8287 8288 8289 8290 8291 8292 8293 8294 8295 8296 8297 8298 8299 8300 8301 8302 8303 8304 8305 8306 8307 8308 8309 8310 8311 8312 8313 8314 8315 8316 8317 8318 8319 8320 8321 8322 8323 8324 8325 8326 8327 8328 8329 8330 8331 8332 8333 8334 8335 8336 8337 8338 8339 8340 8341 8342 8343 8344 8345 8346 8347 8348 8349 8350 8351 8352 8353 8354 8355 8356 8357 8358 8359 8360 8361 8362 8363 8364 8365 8366 8367 8368 8369 8370 8371 8372 8373 8374 8375 8376 8377 8378 8379 8380 8381 8382 8383 8384 8385 8386 8387 8388 8389 8390 8391 8392 8393 8394 8395 8396 8397 8398 8399 8400 8401 8402 8403 8404 8405 8406 8407 8408 8409 8410 8411 8412 8413 8414 8415 8416 8417 8418 8419 8420 8421 8422 8423 8424 8425 8426 8427 8428 8429 8430 8431 8432 8433 8434 8435 8436 8437 8438 8439 8440 8441 8442 8443 8444 8445 8446 8447 8448 8449 8450 8451 8452 8453 8454 8455 8456 8457 8458 8459 8460 8461 8462 8463 8464 8465 8466 8467 8468 8469 8470 8471 8472 8473 8474 8475 8476 8477 8478 8479 8480 8481 8482 8483 8484 8485 8486 8487 8488 8489 8490 8491 8492 8493 8494 8495 8496 8497 8498 8499 8500 8501 8502 8503 8504 8505 8506 8507 8508 8509 8510 8511 8512 8513 8514 8515 8516 8517 8518 8519 8520 8521 8522 8523 8524 8525 8526 8527 8528 8529 8530 8531 8532 8533 8534 8535 8536 8537 8538 8539 8540 8541 8542 8543 8544 8545 8546 8547 8548 8549 8550 8551 8552 8553 8554 8555 8556 8557 8558 8559 8560 8561 8562 8563 8564 8565 8566 8567 8568 8569 8570 8571 8572 8573 8574 8575 8576 8577 8578 8579 8580 8581 8582 8583 8584 8585 8586 8587 8588 8589 8590 8591 8592 8593 8594 8595 8596 8597 8598 8599 8600 8601 8602 8603 8604 8605 8606 8607 8608 8609 8610 8611 8612 8613 8614 8615 8616 8617 8618 8619 8620 8621 8622 8623 8624 8625 8626 8627 8628 8629 8630 8631 8632 8633 8634 8635 8636 8637 8638 8639 8640 8641 8642 8643 8644 8645 8646 8647 8648 8649 8650 8651 8652 8653 8654 8655 8656 8657 8658 8659 8660 8661 8662 8663 8664 8665 8666 8667 8668 8669 8670 8671 8672 8673 8674 8675 8676 8677 8678 8679 8680 8681 8682 8683 8684 8685 8686 8687 8688 8689 8690 8691 8692 8693 8694 8695 8696 8697 8698 8699 8700 8701 8702 8703 8704 8705 8706 8707 8708 8709 8710 8711 8712 8713 8714 8715 8716 8717 8718 8719 8720 8721 8722 8723 8724 8725 8726 8727 8728 8729 8730 8731 8732 8733 8734 8735 8736 8737 8738 8739 8740 8741 8742 8743 8744 8745 8746 8747 8748 8749 8750 8751 8752 8753 8754 8755 8756 8757 8758 8759 8760 8761 8762 8763 8764 8765 8766 8767 8768 8769 8770 8771 8772 8773 8774 8775 8776 8777 8778 8779 8780 8781 8782 8783 8784 8785 8786 8787 8788 8789 8790 8791 8792 8793 8794 8795 8796 8797 8798 8799 8800 8801 8802 8803 8804 8805 8806 8807 8808 8809 8810 8811 8812 8813 8814 8815 8816 8817 8818 8819 8820 8821 8822 8823 8824 8825 8826 8827 8828 8829 8830 8831 8832 8833 8834 8835 8836 8837 8838 8839 8840 8841 8842 8843 8844 8845 8846 8847 8848 8849 8850 8851 8852 8853 8854 8855 8856 8857 8858 8859 8860 8861 8862 8863 8864 8865 8866 8867 8868 8869 8870 8871 8872 8873 8874 8875 8876 8877 8878 8879 8880 8881 8882 8883 8884 8885 8886 8887 8888 8889 8890 8891 8892 8893 8894 8895 8896 8897 8898 8899 8900 8901 8902 8903 8904 8905 8906 8907 8908 8909 8910 8911 8912 8913 8914 8915 8916 8917 8918 8919 8920 8921 8922 8923 8924 8925 8926 8927 8928 8929 8930 8931 8932 8933 8934 8935 8936 8937 8938 8939 8940 8941 8942 8943 8944 8945 8946 8947 8948 8949 8950 8951 8952 8953 8954 8955 8956 8957 8958 8959 8960 8961 8962 8963 8964 8965 8966 8967 8968 8969 8970 8971 8972 8973 8974 8975 8976 8977 8978 8979 8980 8981 8982 8983 8984 8985 8986 8987 8988 8989 8990 8991 8992 8993 8994 8995 8996 8997 8998 8999 9000 9001 9002 9003 9004 9005 9006 9007 9008 9009 9010 9011 9012 9013 9014 9015 9016 9017 9018 9019 9020 9021 9022 9023 9024 9025 9026 9027 9028 9029 9030 9031 9032 9033 9034 9035 9036 9037 9038 9039 9040 9041 9042 9043 9044 9045 9046 9047 9048 9049 9050 9051 9052 9053 9054 9055 9056 9057 9058 9059 9060 9061 9062 9063 9064 9065 9066 9067 9068 9069 9070 9071 9072 9073 9074 9075 9076 9077 9078 9079 9080 9081 9082 9083 9084 9085 9086 9087 9088 9089 9090 9091 9092 9093 9094 9095 9096 9097 9098 9099 9100 9101 9102 9103 9104 9105 9106 9107 9108 9109 9110 9111 9112 9113 9114 9115 9116 9117 9118 9119 9120 9121 9122 9123 9124 9125 9126 9127 9128 9129 9130 9131 9132 9133 9134 9135 9136 9137 9138 9139 9140 9141 9142 9143 9144 9145 9146 9147 9148 9149 9150 9151 9152 9153 9154 9155 9156 9157 9158 9159 9160 9161 9162 9163 9164 9165 9166 9167 9168 9169 9170 9171 9172 9173 9174 9175 9176 9177 9178 9179 9180 9181 9182 9183 9184 9185 9186 9187 9188 9189 9190 9191 9192 9193 9194 9195 9196 9197 9198 9199 9200 9201 9202 9203 9204 9205 9206 9207 9208 9209 9210 9211 9212 9213 9214 9215 9216 9217 9218 9219 9220 9221 9222 9223 9224 9225 9226 9227 9228 9229 9230 9231 9232 9233 9234 9235 9236 9237 9238 9239 9240 9241 9242 9243 9244 9245 9246 9247 9248 9249 9250 9251 9252 9253 9254 9255 9256 9257 9258 9259 9260 9261 9262 9263 9264 9265 9266 9267 9268 9269 9270 9271 9272 9273 9274 9275 9276 9277 9278 9279 9280 9281 9282 9283 9284 9285 9286 9287 9288 9289 9290 9291 9292 9293 9294 9295 9296 9297 9298 9299 9300 9301 9302 9303 9304 9305 9306 9307 9308 9309 9310 9311 9312 9313 9314 9315 9316 9317 9318 9319 9320 9321 9322 9323 9324 9325 9326 9327 9328 9329 9330 9331 9332 9333 9334 9335 9336 9337 9338 9339 9340 9341 9342 9343 9344 9345 9346 9347 9348 9349 9350 9351 9352 9353 9354 9355 9356 9357 9358 9359 9360 9361 9362 9363 9364 9365 9366 9367 9368 9369 9370 9371 9372 9373 9374 9375 9376 9377 9378 9379 9380 9381 9382 9383 9384 9385 9386 9387 9388 9389 9390 9391 9392 9393 9394 9395 9396 9397 9398 9399 9400 9401 9402 9403 9404 9405 9406 9407 9408 9409 9410 9411 9412 9413 9414 9415 9416 9417 9418 9419 9420 9421 9422 9423 9424 9425 9426 9427 9428 9429 9430 9431 9432 9433 9434 9435 9436 9437 9438 9439 9440 9441 9442 9443 9444 9445 9446 9447 9448 9449 9450 9451 9452 9453 9454 9455 9456 9457 9458 9459 9460 9461 9462 9463 9464 9465 9466 9467 9468 9469 9470 9471 9472 9473 9474 9475 9476 9477 9478 9479 9480 9481 9482 9483 9484 9485 9486 9487 9488 9489 9490 9491 9492 9493 9494 9495 9496 9497 9498 9499 9500 9501 9502 9503 9504 9505 9506 9507 9508 9509 9510 9511 9512 9513 9514 9515 9516 9517 9518 9519 9520 9521 9522 9523 9524 9525 9526 9527 9528 9529 9530 9531 9532 9533 9534 9535 9536 9537 9538 9539 9540 9541 9542 9543 9544 9545 9546 9547 9548 9549 9550 9551 9552 9553 9554 9555 9556 9557 9558 9559 9560 9561 9562 9563 9564 9565 9566 9567 9568 9569 9570 9571 9572 9573 9574 9575 9576 9577 9578 9579 9580 9581 9582 9583 9584 9585 9586 9587 9588 9589 9590 9591 9592 9593 9594 9595 9596 9597 9598 9599 9600 9601 9602 9603 9604 9605 9606 9607 9608 9609 9610 9611 9612 9613 9614 9615 9616 9617 9618 9619 9620 9621 9622 9623 9624 9625 9626 9627 9628 9629 9630 9631 9632 9633 9634 9635 9636 9637 9638 9639 9640 9641 9642 9643 9644 9645 9646 9647 9648 9649 9650 9651 9652 9653 9654 9655 9656 9657 9658 9659 9660 9661 9662 9663 9664 9665 9666 9667 9668 9669 9670 9671 9672 9673 9674 9675 9676 9677 9678 9679 9680 9681 9682 9683 9684 9685 9686 9687 9688 9689 9690 9691 9692 9693 9694 9695 9696 9697 9698 9699 9700 9701 9702 9703 9704 9705 9706 9707 9708 9709 9710 9711 9712 9713 9714 9715 9716 9717 9718 9719 9720 9721 9722 9723 9724 9725 9726 9727 9728 9729 9730 9731 9732 9733 9734 9735 9736 9737 9738 9739 9740 9741 9742 9743 9744 9745 9746 9747 9748 9749 9750 9751 9752 9753 9754 9755 9756 9757 9758 9759 9760 9761 9762 9763 9764 9765 9766 9767 9768 9769 9770 9771 9772 9773 9774 9775 9776 9777 9778 9779 9780 9781 9782 9783 9784 9785 9786 9787 9788 9789 9790 9791 9792 9793 9794 9795 9796 9797 9798 9799 9800 9801 9802 9803 9804 9805 9806 9807 9808 9809 9810 9811 9812 9813 9814 9815 9816 9817 9818 9819 9820 9821 9822 9823 9824 9825 9826 9827 9828 9829 9830 9831 9832 9833 9834 9835 9836 9837 9838 9839 9840 9841 9842 9843 9844 9845 9846 9847 9848 9849 9850 9851 9852 9853 9854 9855 9856 9857 9858 9859 9860 9861 9862 9863 9864 9865 9866 9867 9868 9869 9870 9871 9872 9873 9874 9875 9876 9877 9878 9879 9880 9881 9882 9883 9884 9885 9886 9887 9888 9889 9890 9891 9892 9893 9894 9895 9896 9897 9898 9899 9900 9901 9902 9903 9904 9905 9906 9907 9908 9909 9910 9911 9912 9913 9914 9915 9916 9917 9918 9919 9920 9921 9922 9923 9924 9925 9926 9927 9928 9929 9930 9931 9932 9933 9934 9935 9936 9937 9938 9939 9940 9941 9942 9943 9944 9945 9946 9947 9948 9949 9950 9951 9952 9953 9954 9955 9956 9957 9958 9959 9960 9961 9962 9963 9964 9965 9966 9967 9968 9969 9970 9971 9972 9973 9974 9975 9976 9977 9978 9979 9980 9981 9982 9983 9984 9985 9986 9987 9988 9989 9990 9991 9992 9993 9994 9995 9996 9997 9998 9999 10000 10001 10002 10003 10004 10005 10006 10007 10008 10009 10010 10011 10012 10013 10014 10015 10016 10017 10018 10019 10020 10021 10022 10023 10024 10025 10026 10027 10028 10029 10030 10031 10032 10033 10034 10035 10036 10037 10038 10039 10040 10041 10042 10043 10044 10045 10046 10047 10048 10049 10050 10051 10052 10053 10054 10055 10056 10057 10058 10059 10060 10061 10062 10063 10064 10065 10066 10067 10068 10069 10070 10071 10072 10073 10074 10075 10076 10077 10078 10079 10080 10081 10082 10083 10084 10085 10086 10087 10088 10089 10090 10091 10092 10093 10094 10095 10096 10097 10098 10099 10100 10101 10102 10103 10104 10105 10106 10107 10108 10109 10110 10111 10112 10113 10114 10115 10116 10117 10118 10119 10120 10121 10122 10123 10124 10125 10126 10127 10128 10129 10130 10131 10132 10133 10134 10135 10136 10137 10138 10139 10140 10141 10142 10143 10144 10145 10146 10147 10148 10149 10150 10151 10152 10153 10154 10155 10156 10157 10158 10159 10160 10161 10162 10163 10164 10165 10166 10167 10168 10169 10170 10171 10172 10173 10174 10175 10176 10177 10178 10179 10180 10181 10182 10183 10184 10185 10186 10187 10188 10189 10190 10191 10192 10193 10194 10195 10196 10197 10198 10199 10200 10201 10202 10203 10204 10205 10206 10207 10208 10209 10210 10211 10212 10213 10214 10215 10216 10217 10218 10219 10220 10221 10222 10223 10224 10225 10226 10227 10228 10229 10230 10231 10232 10233 10234 10235 10236 10237 10238 10239 10240 10241 10242 10243 10244 10245 10246 10247 10248 10249 10250 10251 10252 10253 10254 10255 10256 10257 10258 10259 10260 10261 10262 10263 10264 10265 10266 10267 10268 10269 10270 10271 10272 10273 10274 10275 10276 10277 10278 10279 10280 10281 10282 10283 10284 10285 10286 10287 10288 10289 10290 10291 10292 10293 10294 10295 10296 10297 10298 10299 10300 10301 10302 10303 10304 10305 10306 10307 10308 10309 10310 10311 10312 10313 10314 10315 10316 10317 10318 10319 10320 10321 10322 10323 10324 10325 10326 10327 10328 10329 10330 10331 10332 10333 10334 10335 10336 10337 10338 10339 10340 10341 10342 10343 10344 10345 10346 10347 10348 10349 10350 10351 10352 10353 10354 10355 10356 10357 10358 10359 10360 10361 10362 10363 10364 10365 10366 10367 10368 10369 10370 10371 10372 10373 10374 10375 10376 10377 10378 10379 10380 10381 10382 10383 10384 10385 10386 10387 10388 10389 10390 10391 10392 10393 10394 10395 10396 10397 10398 10399 10400 10401 10402 10403 10404 10405 10406 10407 10408 10409 10410 10411 10412 10413 10414 10415 10416 10417 10418 10419 10420 10421 10422 10423 10424 10425 10426 10427 10428 10429 10430 10431 10432 10433 10434 10435 10436 10437 10438 10439 10440 10441 10442 10443 10444 10445 10446 10447 10448 10449 10450 10451 10452 10453 10454 10455 10456 10457 10458 10459 10460 10461 10462 10463 10464 10465 10466 10467 10468 10469 10470 10471 10472 10473 10474 10475 10476 10477 10478 10479 10480 10481 10482 10483 10484 10485 10486 10487 10488 10489 10490 10491 10492 10493 10494 10495 10496 10497 10498 10499 10500 10501 10502 10503 10504 10505 10506 10507 10508 10509 10510 10511 10512 10513 10514 10515 10516 10517 10518 10519 10520 10521 10522 10523 10524 10525 10526 10527 10528 10529 10530 10531 10532 10533 10534 10535 10536 10537 10538 10539 10540 10541 10542 10543 10544 10545 10546 10547 10548 10549 10550 10551 10552 10553 10554 10555 10556 10557 10558 10559 10560 10561 10562 10563 10564 10565 10566 10567 10568 10569 10570 10571 10572 10573 10574 10575 10576 10577 10578 10579 10580 10581 10582 10583 10584 10585 10586 10587 10588 10589 10590 10591 10592 10593 10594 10595 10596 10597 10598 10599 10600 10601 10602 10603 10604 10605 10606 10607 10608 10609 10610 10611 10612 10613 10614 10615 10616 10617 10618 10619 10620 10621 10622 10623 10624 10625 10626 10627 10628 10629 10630 10631 10632 10633 10634 10635 10636 10637 10638 10639 10640 10641 10642 10643 10644 10645 10646 10647 10648 10649 10650 10651 10652 10653 10654 10655 10656 10657 10658 10659 10660 10661 10662 10663 10664 10665 10666 10667 10668 10669 10670 10671 10672 10673 10674 10675 10676 10677 10678 10679 10680 10681 10682 10683 10684 10685 10686 10687 10688 10689 10690 10691 10692 10693 10694 10695 10696 10697 10698 10699 10700 10701 10702 10703 10704 10705 10706 10707 10708 10709 10710 10711 10712 10713 10714 10715 10716 10717 10718 10719 10720 10721 10722 10723 10724 10725 10726 10727 10728 10729 10730 10731 10732 10733 10734 10735 10736 10737 10738 10739 10740 10741 10742 10743 10744 10745 10746 10747 10748 10749 10750 10751 10752 10753 10754 10755 10756 10757 10758 10759 10760 10761 10762 10763 10764 10765 10766 10767 10768 10769 10770 10771 10772 10773 10774 10775 10776 10777 10778 10779 10780 10781 10782 10783 10784 10785 10786 10787 10788 10789 10790 10791 10792 10793 10794 10795 10796 10797 10798 10799 10800 10801 10802 10803 10804 10805 10806 10807 10808 10809 10810 10811 10812 10813 10814 10815 10816 10817 10818 10819 10820 10821 10822 10823 10824 10825 10826 10827 10828 10829 10830 10831 10832 10833 10834 10835 10836 10837 10838 10839 10840 10841 10842 10843 10844 10845 10846 10847 10848 10849 10850 10851 10852 10853 10854 10855 10856 10857 10858 10859 10860 10861 10862 10863 10864 10865 10866 10867 10868 10869 10870 10871 10872 10873 10874 10875 10876 10877 10878 10879 10880 10881 10882 10883 10884 10885 10886 10887 10888 10889 10890 10891 10892 10893 10894 10895 10896 10897 10898 10899 10900 10901 10902 10903 10904 10905 10906 10907 10908 10909 10910 10911 10912 10913 10914 10915 10916 10917 10918 10919 10920 10921 10922 10923 10924 10925 10926 10927 10928 10929 10930 10931 10932 10933 10934 10935 10936 10937 10938 10939 10940 10941 10942 10943 10944 10945 10946 10947 10948 10949 10950 10951 10952 10953 10954 10955 10956 10957 10958 10959 10960 10961 10962 10963 10964 10965 10966 10967 10968 10969 10970 10971 10972 10973 10974 10975 10976 10977 10978 10979 10980 10981 10982 10983 10984 10985 10986 10987 10988 10989 10990 10991 10992 10993 10994 10995 10996 10997 10998 10999 11000 11001 11002 11003 11004 11005 11006 11007 11008 11009 11010 11011 11012 11013 11014 11015 11016 11017 11018 11019 11020 11021 11022 11023 11024 11025 11026 11027 11028 11029 11030 11031 11032 11033 11034 11035 11036 11037 11038 11039 11040 11041 11042 11043 11044 11045 11046 11047 11048 11049 11050 11051 11052 11053 11054 11055 11056 11057 11058 11059 11060 11061 11062 11063 11064 11065 11066 11067 11068 11069 11070 11071 11072 11073 11074 11075 11076 11077 11078 11079 11080 11081 11082 11083 11084 11085 11086 11087 11088 11089 11090 11091 11092 11093 11094 11095 11096 11097 11098 11099 11100 11101 11102 11103 11104 11105 11106 11107 11108 11109 11110 11111 11112 11113 11114 11115 11116 11117 11118 11119 11120 11121 11122 11123 11124 11125 11126 11127 11128 11129 11130 11131 11132 11133 11134 11135 11136 11137 11138 11139 11140 11141 11142 11143 11144 11145 11146 11147 11148 11149 11150 11151 11152 11153 11154 11155 11156 11157 11158 11159 11160 11161 11162 11163 11164 11165 11166 11167 11168 11169 11170 11171 11172 11173 11174 11175 11176 11177 11178 11179 11180 11181 11182 11183 11184 11185 11186 11187 11188 11189 11190 11191 11192 11193 11194 11195 11196 11197 11198 11199 11200 11201 11202 11203 11204 11205 11206 11207 11208 11209 11210 11211 11212 11213 11214 11215 11216 11217 11218 11219 11220 11221 11222 11223 11224 11225 11226 11227 11228 11229 11230 11231 11232 11233 11234 11235 11236 11237 11238 11239 11240 11241 11242 11243 11244 11245 11246 11247 11248 11249 11250 11251 11252 11253 11254 11255 11256 11257 11258 11259 11260 11261 11262 11263 11264 11265 11266 11267 11268 11269 11270 11271 11272 11273 11274 11275 11276 11277 11278 11279 11280 11281 11282 11283 11284 11285 11286 11287 11288 11289 11290 11291 11292 11293 11294 11295 11296 11297 11298 11299 11300 11301 11302 11303 11304 11305 11306 11307 11308 11309 11310 11311 11312 11313 11314 11315 11316 11317 11318 11319 11320 11321 11322 11323 11324 11325 11326 11327 11328 11329 11330 11331 11332 11333 11334 11335 11336 11337 11338 11339 11340 11341 11342 11343 11344 11345 11346 11347 11348 11349 11350 11351 11352 11353 11354 11355 11356 11357 11358 11359 11360 11361 11362 11363 11364 11365 11366 11367 11368 11369 11370 11371 11372 11373 11374 11375 11376 11377 11378 11379 11380 11381 11382 11383 11384 11385 11386 11387 11388 11389 11390 11391 11392 11393 11394 11395 11396 11397 11398 11399 11400 11401 11402 11403 11404 11405 11406 11407 11408 11409 11410 11411 11412 11413 11414 11415 11416 11417 11418 11419 11420 11421 11422 11423 11424 11425 11426 11427 11428 11429 11430 11431 11432 11433 11434 11435 11436 11437 11438 11439 11440 11441 11442 11443 11444 11445 11446 11447 11448 11449 11450 11451 11452 11453 11454 11455 11456 11457 11458 11459 11460 11461 11462 11463 11464 11465 11466 11467 11468 11469 11470 11471 11472 11473 11474 11475 11476 11477 11478 11479 11480 11481 11482 11483 11484 11485 11486 11487 11488 11489 11490 11491 11492 11493 11494 11495 11496 11497 11498 11499 11500 11501 11502 11503 11504 11505 11506 11507 11508 11509 11510 11511 11512 11513 11514 11515 11516 11517 11518 11519 11520 11521 11522 11523 11524 11525 11526 11527 11528 11529 11530 11531 11532 11533 11534 11535 11536 11537 11538 11539 11540 11541 11542 11543 11544 11545 11546 11547 11548 11549 11550 11551 11552 11553 11554 11555 11556 11557 11558 11559 11560 11561 11562 11563 11564 11565 11566 11567 11568 11569 11570 11571 11572 11573 11574 11575 11576 11577 11578 11579 11580 11581 11582 11583 11584 11585 11586 11587 11588 11589 11590 11591 11592 11593 11594 11595 11596 11597 11598 11599 11600 11601 11602 11603 11604 11605 11606 11607 11608 11609 11610 11611 11612 11613 11614 11615 11616 11617 11618 11619 11620 11621 11622 11623 11624 11625 11626 11627 11628 11629 11630 11631 11632 11633 11634 11635 11636 11637 11638 11639 11640 11641 11642 11643 11644 11645 11646 11647 11648 11649 11650 11651 11652 11653 11654 11655 11656 11657 11658 11659 11660 11661 11662 11663 11664 11665 11666 11667 11668 11669 11670 11671 11672 11673 11674 11675 11676 11677 11678 11679 11680 11681 11682 11683 11684 11685 11686 11687 11688 11689 11690 11691 11692 11693 11694 11695 11696 11697 11698 11699 11700 11701 11702 11703 11704 11705 11706 11707 11708 11709 11710 11711 11712 11713 11714 11715 11716 11717 11718 11719 11720 11721 11722 11723 11724 11725 11726 11727 11728 11729 11730 11731 11732 11733 11734 11735 11736 11737 11738 11739 11740 11741 11742 11743 11744 11745 11746 11747 11748 11749 11750 11751 11752 11753 11754 11755 11756 11757 11758 11759 11760 11761 11762 11763 11764 11765 11766 11767 11768 11769 11770 11771 11772 11773 11774 11775 11776 11777 11778 11779 11780 11781 11782 11783 11784 11785 11786 11787 11788 11789 11790 11791 11792 11793 11794 11795 11796 11797 11798 11799 11800 11801 11802 11803 11804 11805 11806 11807 11808 11809 11810 11811 11812 11813 11814 11815 11816 11817 11818 11819 11820 11821 11822 11823 11824 11825 11826 11827 11828 11829 11830 11831 11832 11833 11834 11835 11836 11837 11838 11839 11840 11841 11842 11843 11844 11845 11846 11847 11848 11849 11850 11851 11852 11853 11854 11855 11856 11857 11858 11859 11860 11861 11862 11863 11864 11865 11866 11867 11868 11869 11870 11871 11872 11873 11874 11875 11876 11877 11878 11879 11880 11881 11882 11883 11884 11885 11886 11887 11888 11889 11890 11891 11892 11893 11894 11895 11896 11897 11898 11899 11900 11901 11902 11903 11904 11905 11906 11907 11908 11909 11910 11911 11912 11913 11914 11915 11916 11917 11918 11919 11920 11921 11922 11923 11924 11925 11926 11927 11928 11929 11930 11931 11932 11933 11934 11935 11936 11937 11938 11939 11940 11941 11942 11943 11944 11945 11946 11947 11948 11949 11950 11951 11952 11953 11954 11955 11956 11957 11958 11959 11960 11961 11962 11963 11964 11965 11966 11967 11968 11969 11970 11971 11972 11973 11974 11975 11976 11977 11978 11979 11980 11981 11982 11983 11984 11985 11986 11987 11988 11989 11990 11991 11992 11993 11994 11995 11996 11997 11998 11999 12000 12001 12002 12003 12004 12005 12006 12007 12008 12009 12010 12011 12012 12013 12014 12015 12016 12017 12018 12019 12020 12021 12022 12023 12024 12025 12026 12027 12028 12029 12030 12031 12032 12033 12034 12035 12036 12037 12038 12039 12040 12041 12042 12043 12044 12045 12046 12047 12048 12049 12050 12051 12052 12053 12054 12055 12056 12057 12058 12059 12060 12061 12062 12063 12064 12065 12066 12067 12068 12069 12070 12071 12072 12073 12074 12075 12076 12077 12078 12079 12080 12081 12082 12083 12084 12085 12086 12087 12088 12089 12090 12091 12092 12093 12094 12095 12096 12097 12098 12099 12100 12101 12102 12103 12104 12105 12106 12107 12108 12109 12110 12111 12112 12113 12114 12115 12116 12117 12118 12119 12120 12121 12122 12123 12124 12125 12126 12127 12128 12129 12130 12131 12132 12133 12134 12135 12136 12137 12138 12139 12140 12141 12142 12143 12144 12145 12146 12147 12148 12149 12150 12151 12152 12153 12154 12155 12156 12157 12158 12159 12160 12161 12162 12163 12164 12165 12166 12167 12168 12169 12170 12171 12172 12173 12174 12175 12176 12177 12178 12179 12180 12181 12182 12183 12184 12185 12186 12187 12188 12189 12190 12191 12192 12193 12194 12195 12196 12197 12198 12199 12200 12201 12202 12203 12204 12205 12206 12207 12208 12209 12210 12211 12212 12213 12214 12215 12216 12217 12218 12219 12220 12221 12222 12223 12224 12225 12226 12227 12228 12229 12230 12231 12232 12233 12234 12235 12236 12237 12238 12239 12240 12241 12242 12243 12244 12245 12246 12247 12248 12249 12250 12251 12252 12253 12254 12255 12256 12257 12258 12259 12260 12261 12262 12263 12264 12265 12266 12267 12268 12269 12270 12271 12272 12273 12274 12275 12276 12277 12278 12279 12280 12281 12282 12283 12284 12285 12286 12287 12288 12289 12290 12291 12292 12293 12294 12295 12296 12297 12298 12299 12300 12301 12302 12303 12304 12305 12306 12307 12308 12309 12310 12311 12312 12313 12314 12315 12316 12317 12318 12319 12320 12321 12322 12323 12324 12325 12326 12327 12328 12329 12330 12331 12332 12333 12334 12335 12336 12337 12338 12339 12340 12341 12342 12343 12344 12345 12346 12347 12348 12349 12350 12351 12352 12353 12354 12355 12356 12357 12358 12359 12360 12361 12362 12363 12364 12365 12366 12367 12368 12369 12370 12371 12372 12373 12374 12375 12376 12377 12378 12379 12380 12381 12382 12383 12384 12385 12386 12387 12388 12389 12390 12391 12392 12393 12394 12395 12396 12397 12398 12399 12400 12401 12402 12403 12404 12405 12406 12407 12408 12409 12410 12411 12412 12413 12414 12415 12416 12417 12418 12419 12420 12421 12422 12423 12424 12425 12426 12427 12428 12429 12430 12431 12432 12433 12434 12435 12436 12437 12438 12439 12440 12441 12442 12443 12444 12445 12446 12447 12448 12449 12450 12451 12452 12453 12454 12455 12456 12457 12458 12459 12460 12461 12462 12463 12464 12465 12466 12467 12468 12469 12470 12471 12472 12473 12474 12475 12476 12477 12478 12479 12480 12481 12482 12483 12484 12485 12486 12487 12488 12489 12490 12491 12492 12493 12494 12495 12496 12497 12498 12499 12500 12501 12502 12503 12504 12505 12506 12507 12508 12509 12510 12511 12512 12513 12514 12515 12516 12517 12518 12519 12520 12521 12522 12523 12524 12525 12526 12527 12528 12529 12530 12531 12532 12533 12534 12535 12536 12537 12538 12539 12540 12541 12542 12543 12544 12545 12546 12547 12548 12549 12550 12551 12552 12553 12554 12555 12556 12557 12558 12559 12560 12561 12562 12563 12564 12565 12566 12567 12568 12569 12570 12571 12572 12573 12574 12575 12576 12577 12578 12579 12580 12581 12582 12583 12584 12585 12586 12587 12588 12589 12590 12591 12592 12593 12594 12595 12596 12597 12598 12599 12600 12601 12602 12603 12604 12605 12606 12607 12608 12609 12610 12611 12612 12613 12614 12615 12616 12617 12618 12619 12620 12621 12622 12623 12624 12625 12626 12627 12628 12629 12630 12631 12632 12633 12634 12635 12636 12637 12638 12639 12640 12641 12642 12643 12644 12645 12646 12647 12648 12649 12650 12651 12652 12653 12654 12655 12656 12657 12658 12659 12660 12661 12662 12663 12664 12665 12666 12667 12668 12669 12670 12671 12672 12673 12674 12675 12676 12677 12678 12679 12680 12681 12682 12683 12684 12685 12686 12687 12688 12689 12690 12691 12692 12693 12694 12695 12696 12697 12698 12699 12700 12701 12702 12703 12704 12705 12706 12707 12708 12709 12710 12711 12712 12713 12714 12715 12716 12717 12718 12719 12720 12721 12722 12723 12724 12725 12726 12727 12728 12729 12730 12731 12732 12733 12734 12735 12736 12737 12738 12739 12740 12741 12742 12743 12744 12745 12746 12747 12748 12749 12750 12751 12752 12753 12754 12755 12756 12757 12758 12759 12760 12761 12762 12763 12764 12765 12766 12767 12768 12769 12770 12771 12772 12773 12774 12775 12776 12777 12778 12779 12780 12781 12782 12783 12784 12785 12786 12787 12788 12789 12790 12791 12792 12793 12794 12795 12796 12797 12798 12799 12800 12801 12802 12803 12804 12805 12806 12807 12808 12809 12810 12811 12812 12813 12814 12815 12816 12817 12818 12819 12820 12821 12822 12823 12824 12825 12826 12827 12828 12829 12830 12831 12832 12833 12834 12835 12836 12837 12838 12839 12840 12841 12842 12843 12844 12845 12846 12847 12848 12849 12850 12851 12852 12853 12854 12855 12856 12857 12858 12859 12860 12861 12862 12863 12864 12865 12866 12867 12868 12869 12870 12871 12872 12873 12874 12875 12876 12877 12878 12879 12880 12881 12882 12883 12884 12885 12886 12887 12888 12889 12890 12891 12892 12893 12894 12895 12896 12897 12898 12899 12900 12901 12902 12903 12904 12905 12906 12907 12908 12909 12910 12911 12912 12913 12914 12915 12916 12917 12918 12919 12920 12921 12922 12923 12924 12925 12926 12927 12928 12929 12930 12931 12932 12933 12934 12935 12936 12937 12938 12939 12940 12941 12942 12943 12944 12945 12946 12947 12948 12949 12950 12951 12952 12953 12954 12955 12956 12957 12958 12959 12960 12961 12962 12963 12964 12965 12966 12967 12968 12969 12970 12971 12972 12973 12974 12975 12976 12977 12978 12979 12980 12981 12982 12983 12984 12985 12986 12987 12988 12989 12990 12991 12992 12993 12994 12995 12996 12997 12998 12999 13000 13001 13002 13003 13004 13005 13006 13007 13008 13009 13010 13011 13012 13013 13014 13015 13016 13017 13018 13019 13020 13021 13022 13023 13024 13025 13026 13027 13028 13029 13030 13031 13032 13033 13034 13035 13036 13037 13038 13039 13040 13041 13042 13043 13044 13045 13046 13047 13048 13049 13050 13051 13052 13053 13054 13055 13056 13057 13058 13059 13060 13061 13062 13063 13064 13065 13066 13067 13068 13069 13070 13071 13072 13073 13074 13075 13076 13077 13078 13079 13080 13081 13082 13083 13084 13085 13086 13087 13088 13089 13090 13091 13092 13093 13094 13095 13096 13097 13098 13099 13100 13101 13102 13103 13104 13105 13106 13107 13108 13109 13110 13111 13112 13113 13114 13115 13116 13117 13118 13119 13120 13121 13122 13123 13124 13125 13126 13127 13128 13129 13130 13131 13132 13133 13134 13135 13136 13137 13138 13139 13140 13141 13142 13143 13144 13145 13146 13147 13148 13149 13150 13151 13152 13153 13154 13155 13156 13157 13158 13159 13160 13161 13162 13163 13164 13165 13166 13167 13168 13169 13170 13171 13172 13173 13174 13175 13176 13177 13178 13179 13180 13181 13182 13183 13184 13185 13186 13187 13188 13189 13190 13191 13192 13193 13194 13195 13196 13197 13198 13199 13200 13201 13202 13203 13204 13205 13206 13207 13208 13209 13210 13211 13212 13213 13214 13215 13216 13217 13218 13219 13220 13221 13222 13223 13224 13225 13226 13227 13228 13229 13230 13231 13232 13233 13234 13235 13236 13237 13238 13239 13240 13241 13242 13243 13244 13245 13246 13247 13248 13249 13250 13251 13252 13253 13254 13255 13256 13257 13258 13259 13260 13261 13262 13263 13264 13265 13266 13267 13268 13269 13270 13271 13272 13273 13274 13275 13276 13277 13278 13279 13280 13281 13282 13283 13284 13285 13286 13287 13288 13289 13290 13291 13292 13293 13294 13295 13296 13297 13298 13299 13300 13301 13302 13303 13304 13305 13306 13307 13308 13309 13310 13311 13312 13313 13314 13315 13316 13317 13318 13319 13320 13321 13322 13323 13324 13325 13326 13327 13328 13329 13330 13331 13332 13333 13334 13335 13336 13337 13338 13339 13340 13341 13342 13343 13344 13345 13346 13347 13348 13349 13350 13351 13352 13353 13354 13355 13356 13357 13358 13359 13360 13361 13362 13363 13364 13365 13366 13367 13368 13369 13370 13371 13372 13373 13374 13375 13376 13377 13378 13379 13380 13381 13382 13383 13384 13385 13386 13387 13388 13389 13390 13391 13392 13393 13394 13395 13396 13397 13398 13399 13400 13401 13402 13403 13404 13405 13406 13407 13408 13409 13410 13411 13412 13413 13414 13415 13416 13417 13418 13419 13420 13421 13422 13423 13424 13425 13426 13427 13428 13429 13430 13431 13432 13433 13434 13435 13436 13437 13438 13439 13440 13441 13442 13443 13444 13445 13446 13447 13448 13449 13450 13451 13452 13453 13454 13455 13456 13457 13458 13459 13460 13461 13462 13463 13464 13465 13466 13467 13468 13469 13470 13471 13472 13473 13474 13475 13476 13477 13478 13479 13480 13481 13482 13483 13484 13485 13486 13487 13488 13489 13490 13491 13492 13493 13494 13495 13496 13497 13498 13499 13500 13501 13502 13503 13504 13505 13506 13507 13508 13509 13510 13511 13512 13513 13514 13515 13516 13517 13518 13519 13520 13521 13522 13523 13524 13525 13526 13527 13528 13529 13530 13531 13532 13533 13534 13535 13536 13537 13538 13539 13540 13541 13542 13543 13544 13545 13546 13547 13548 13549 13550 13551 13552 13553 13554 13555 13556 13557 13558 13559 13560 13561 13562 13563 13564 13565 13566 13567 13568 13569 13570 13571 13572 13573 13574 13575 13576 13577 13578 13579 13580 13581 13582 13583 13584 13585 13586 13587 13588 13589 13590 13591 13592 13593 13594 13595 13596 13597 13598 13599 13600 13601 13602 13603 13604 13605 13606 13607 13608 13609 13610 13611 13612 13613 13614 13615 13616 13617 13618 13619 13620 13621 13622 13623 13624 13625 13626 13627 13628 13629 13630 13631 13632 13633 13634 13635 13636 13637 13638 13639 13640 13641 13642 13643 13644 13645 13646 13647 13648 13649 13650 13651 13652 13653 13654 13655 13656 13657 13658 13659 13660 13661 13662 13663 13664 13665 13666 13667 13668 13669 13670 13671 13672 13673 13674 13675 13676 13677 13678 13679 13680 13681 13682 13683 13684 13685 13686 13687 13688 13689 13690 13691 13692 13693 13694 13695 13696 13697 13698 13699 13700 13701 13702 13703 13704 13705 13706 13707 13708 13709 13710 13711 13712 13713 13714 13715 13716 13717 13718 13719 13720 13721 13722 13723 13724 13725 13726 13727 13728 13729 13730 13731 13732 13733 13734 13735 13736 13737 13738 13739 13740 13741 13742 13743 13744 13745 13746 13747 13748 13749 13750 13751 13752 13753 13754 13755 13756 13757 13758 13759 13760 13761 13762 13763 13764 13765 13766 13767 13768 13769 13770 13771 13772 13773 13774 13775 13776 13777 13778 13779 13780 13781 13782 13783 13784 13785 13786 13787 13788 13789 13790 13791 13792 13793 13794 13795 13796 13797 13798 13799 13800 13801 13802 13803 13804 13805 13806 13807 13808 13809 13810 13811 13812 13813 13814 13815 13816 13817 13818 13819 13820 13821 13822 13823 13824 13825 13826 13827 13828 13829 13830 13831 13832 13833 13834 13835 13836 13837 13838 13839 13840 13841 13842 13843 13844 13845 13846 13847 13848 13849 13850 13851 13852 13853 13854 13855 13856 13857 13858 13859 13860 13861 13862 13863 13864 13865 13866 13867 13868 13869 13870 13871 13872 13873 13874 13875 13876 13877 13878 13879 13880 13881 13882 13883 13884 13885 13886 13887 13888 13889 13890 13891 13892 13893 13894 13895 13896 13897 13898 13899 13900 13901 13902 13903 13904 13905 13906 13907 13908 13909 13910 13911 13912 13913 13914 13915 13916 13917 13918 13919 13920 13921 13922 13923 13924 13925 13926 13927 13928 13929 13930 13931 13932 13933 13934 13935 13936 13937 13938 13939 13940 13941 13942 13943 13944 13945 13946 13947 13948 13949 13950 13951 13952 13953 13954 13955 13956 13957 13958 13959 13960 13961 13962 13963 13964 13965 13966 13967 13968 13969 13970 13971 13972 13973 13974 13975 13976 13977 13978 13979 13980 13981 13982 13983 13984 13985 13986 13987 13988 13989 13990 13991 13992 13993 13994 13995 13996 13997 13998 13999 14000 14001 14002 14003 14004 14005 14006 14007 14008 14009 14010 14011 14012 14013 14014 14015 14016 14017 14018 14019 14020 14021 14022 14023 14024 14025 14026 14027 14028 14029 14030 14031 14032 14033 14034 14035 14036 14037 14038 14039 14040 14041 14042 14043 14044 14045 14046 14047 14048 14049 14050 14051 14052 14053 14054 14055 14056 14057 14058 14059 14060 14061 14062 14063 14064 14065 14066 14067 14068 14069 14070 14071 14072 14073 14074 14075 14076 14077 14078 14079 14080 14081 14082 14083 14084 14085 14086 14087 14088 14089 14090 14091 14092 14093 14094 14095 14096 14097 14098 14099 14100 14101 14102 14103 14104 14105 14106 14107 14108 14109 14110 14111 14112 14113 14114 14115 14116 14117 14118 14119 14120 14121 14122 14123 14124 14125 14126 14127 14128 14129 14130 14131 14132 14133 14134 14135 14136 14137 14138 14139 14140 14141 14142 14143 14144 14145 14146 14147 14148 14149 14150 14151 14152 14153 14154 14155 14156 14157 14158 14159 14160 14161 14162 14163 14164 14165 14166 14167 14168 14169 14170 14171 14172 14173 14174 14175 14176 14177 14178 14179 14180 14181 14182 14183 14184 14185 14186 14187 14188 14189 14190 14191 14192 14193 14194 14195 14196 14197 14198 14199 14200 14201 14202 14203 14204 14205 14206 14207 14208 14209 14210 14211 14212 14213 14214 14215 14216 14217 14218 14219 14220 14221 14222 14223 14224 14225 14226 14227 14228 14229 14230 14231 14232 14233 14234 14235 14236 14237 14238 14239 14240 14241 14242 14243 14244 14245 14246 14247 14248 14249 14250 14251 14252 14253 14254 14255 14256 14257 14258 14259 14260 14261 14262 14263 14264 14265 14266 14267 14268 14269 14270 14271 14272 14273 14274 14275 14276 14277 14278 14279 14280 14281 14282 14283 14284 14285 14286 14287 14288 14289 14290 14291 14292 14293 14294 14295 14296 14297 14298 14299 14300 14301 14302 14303 14304 14305 14306 14307 14308 14309 14310 14311 14312 14313 14314 14315 14316 14317 14318 14319 14320 14321 14322 14323 14324 14325 14326 14327 14328 14329 14330 14331 14332 14333 14334 14335 14336 14337 14338 14339 14340 14341 14342 14343 14344 14345 14346 14347 14348 14349 14350 14351 14352 14353 14354 14355 14356 14357 14358 14359 14360 14361 14362 14363 14364 14365 14366 14367 14368 14369 14370 14371 14372 14373 14374 14375 14376 14377 14378 14379 14380 14381 14382 14383 14384 14385 14386 14387 14388 14389 14390 14391 14392 14393 14394 14395 14396 14397 14398 14399 14400 14401 14402 14403 14404 14405 14406 14407 14408 14409 14410 14411 14412 14413 14414 14415 14416 14417 14418 14419 14420 14421 14422 14423 14424 14425 14426 14427 14428 14429 14430 14431 14432 14433 14434 14435 14436 14437 14438 14439 14440 14441 14442 14443 14444 14445 14446 14447 14448 14449 14450 14451 14452 14453 14454 14455 14456 14457 14458 14459 14460 14461 14462 14463 14464 14465 14466 14467 14468 14469 14470 14471 14472 14473 14474 14475 14476 14477 14478 14479 14480 14481 14482 14483 14484 14485 14486 14487 14488 14489 14490 14491 14492 14493 14494 14495 14496 14497 14498 14499 14500 14501 14502 14503 14504 14505 14506 14507 14508 14509 14510 14511 14512 14513 14514 14515 14516 14517 14518 14519 14520 14521 14522 14523 14524 14525 14526 14527 14528 14529 14530 14531 14532 14533 14534 14535 14536 14537 14538 14539 14540 14541 14542 14543 14544 14545 14546 14547 14548 14549 14550 14551 14552 14553 14554 14555 14556 14557 14558 14559 14560 14561 14562 14563 14564 14565 14566 14567 14568 14569 14570 14571 14572 14573 14574 14575 14576 14577 14578 14579 14580 14581 14582 14583 14584 14585 14586 14587 14588 14589 14590 14591 14592 14593 14594 14595 14596 14597 14598 14599 14600 14601 14602 14603 14604 14605 14606 14607 14608 14609 14610 14611 14612 14613 14614 14615 14616 14617 14618 14619 14620 14621 14622 14623 14624 14625 14626 14627 14628 14629 14630 14631 14632 14633 14634 14635 14636 14637 14638 14639 14640 14641 14642 14643 14644 14645 14646 14647 14648 14649 14650 14651 14652 14653 14654 14655 14656 14657 14658 14659 14660 14661 14662 14663 14664 14665 14666 14667 14668 14669 14670 14671 14672 14673 14674 14675 14676 14677 14678 14679 14680 14681 14682 14683 14684 14685 14686 14687 14688 14689 14690 14691 14692 14693 14694 14695 14696 14697 14698 14699 14700 14701 14702 14703 14704 14705 14706 14707 14708 14709 14710 14711 14712 14713 14714 14715 14716 14717 14718 14719 14720 14721 14722 14723 14724 14725 14726 14727 14728 14729 14730 14731 14732 14733 14734 14735 14736 14737 14738 14739 14740 14741 14742 14743 14744 14745 14746 14747 14748 14749 14750 14751 14752 14753 14754 14755 14756 14757 14758 14759 14760 14761 14762 14763 14764 14765 14766 14767 14768 14769 14770 14771 14772 14773 14774 14775 14776 14777 14778 14779 14780 14781 14782 14783 14784 14785 14786 14787 14788 14789 14790 14791 14792 14793 14794 14795 14796 14797 14798 14799 14800 14801 14802 14803 14804 14805 14806 14807 14808 14809 14810 14811 14812 14813 14814 14815 14816 14817 14818 14819 14820 14821 14822 14823 14824 14825 14826 14827 14828 14829 14830 14831 14832 14833 14834 14835 14836 14837 14838 14839 14840 14841 14842 14843 14844 14845 14846 14847 14848 14849 14850 14851 14852 14853 14854 14855 14856 14857 14858 14859 14860 14861 14862 14863 14864 14865 14866 14867 14868 14869 14870 14871 14872 14873 14874 14875 14876 14877 14878 14879 14880 14881 14882 14883 14884 14885 14886 14887 14888 14889 14890 14891 14892 14893 14894 14895 14896 14897 14898 14899 14900 14901 14902 14903 14904 14905 14906 14907 14908 14909 14910 14911 14912 14913 14914 14915 14916 14917 14918 14919 14920 14921 14922 14923 14924 14925 14926 14927 14928 14929 14930 14931 14932 14933 14934 14935 14936 14937 14938 14939 14940 14941 14942 14943 14944 14945 14946 14947 14948 14949 14950 14951 14952 14953 14954 14955 14956 14957 14958 14959 14960 14961 14962 14963 14964 14965 14966 14967 14968 14969 14970 14971 14972 14973 14974 14975 14976 14977 14978 14979 14980 14981 14982 14983 14984 14985 14986 14987 14988 14989 14990 14991 14992 14993 14994 14995 14996 14997 14998 14999 15000 15001 15002 15003 15004 15005 15006 15007 15008 15009 15010 15011 15012 15013 15014 15015 15016 15017 15018 15019 15020 15021 15022 15023 15024 15025 15026 15027 15028 15029 15030 15031 15032 15033 15034 15035 15036 15037 15038 15039 15040 15041 15042 15043 15044 15045 15046 15047 15048 15049 15050 15051 15052 15053 15054 15055 15056 15057 15058 15059 15060 15061 15062 15063 15064 15065 15066 15067 15068 15069 15070 15071 15072 15073 15074 15075 15076 15077 15078 15079 15080 15081 15082 15083 15084 15085 15086 15087 15088 15089 15090 15091 15092 15093 15094 15095 15096 15097 15098 15099 15100 15101 15102 15103 15104 15105 15106 15107 15108 15109 15110 15111 15112 15113 15114 15115 15116 15117 15118 15119 15120 15121 15122 15123 15124 15125 15126 15127 15128 15129 15130 15131 15132 15133 15134 15135 15136 15137 15138 15139 15140 15141 15142 15143 15144 15145 15146 15147 15148 15149 15150 15151 15152 15153 15154 15155 15156 15157 15158 15159 15160 15161 15162 15163 15164 15165 15166 15167 15168 15169 15170 15171 15172 15173 15174 15175 15176 15177 15178 15179 15180 15181 15182 15183 15184 15185 15186 15187 15188 15189 15190 15191 15192 15193 15194 15195 15196 15197 15198 15199 15200 15201 15202 15203 15204 15205 15206 15207 15208 15209 15210 15211 15212 15213 15214 15215 15216 15217 15218 15219 15220 15221 15222 15223 15224 15225 15226 15227 15228 15229 15230 15231 15232 15233 15234 15235 15236 15237 15238 15239 15240 15241 15242 15243 15244 15245 15246 15247 15248 15249 15250 15251 15252 15253 15254 15255 15256 15257 15258 15259 15260 15261 15262 15263 15264 15265 15266 15267 15268 15269 15270 15271 15272 15273 15274 15275 15276 15277 15278 15279 15280 15281 15282 15283 15284 15285 15286 15287 15288 15289 15290 15291 15292 15293 15294 15295 15296 15297 15298 15299 15300 15301 15302 15303 15304 15305 15306 15307 15308 15309 15310 15311 15312 15313 15314 15315 15316 15317 15318 15319 15320 15321 15322 15323 15324 15325 15326 15327 15328 15329 15330 15331 15332 15333 15334 15335 15336 15337 15338 15339 15340 15341 15342 15343 15344 15345 15346 15347 15348 15349 15350 15351 15352 15353 15354 15355 15356 15357 15358 15359 15360 15361 15362 15363 15364 15365 15366 15367 15368 15369 15370 15371 15372 15373 15374 15375 15376 15377 15378 15379 15380 15381 15382 15383 15384 15385 15386 15387 15388 15389 15390 15391 15392 15393 15394 15395 15396 15397 15398 15399 15400 15401 15402 15403 15404 15405 15406 15407 15408 15409 15410 15411 15412 15413 15414 15415 15416 15417 15418 15419 15420 15421 15422 15423 15424 15425 15426 15427 15428 15429 15430 15431 15432 15433 15434 15435 15436 15437 15438 15439 15440 15441 15442 15443 15444 15445 15446 15447 15448 15449 15450 15451 15452 15453 15454 15455 15456 15457 15458 15459 15460 15461 15462 15463 15464 15465 15466 15467 15468 15469 15470 15471 15472 15473 15474 15475 15476 15477 15478 15479 15480 15481 15482 15483 15484 15485 15486 15487 15488 15489 15490 15491 15492 15493 15494 15495 15496 15497 15498 15499 15500 15501 15502 15503 15504 15505 15506 15507 15508 15509 15510 15511 15512 15513 15514 15515 15516 15517 15518 15519 15520 15521 15522 15523 15524 15525 15526 15527 15528 15529 15530 15531 15532 15533 15534 15535 15536 15537 15538 15539 15540 15541 15542 15543 15544 15545 15546 15547 15548 15549 15550 15551 15552 15553 15554 15555 15556 15557 15558 15559 15560 15561 15562 15563 15564 15565 15566 15567 15568 15569 15570 15571 15572 15573 15574 15575 15576 15577 15578 15579 15580 15581 15582 15583 15584 15585 15586 15587 15588 15589 15590 15591 15592 15593 15594 15595 15596 15597 15598 15599 15600 15601 15602 15603 15604 15605 15606 15607 15608 15609 15610 15611 15612 15613 15614 15615 15616 15617 15618 15619 15620 15621 15622 15623 15624 15625 15626 15627 15628 15629 15630 15631 15632 15633 15634 15635 15636 15637 15638 15639 15640 15641 15642 15643 15644 15645 15646 15647 15648 15649 15650 15651 15652 15653 15654 15655 15656 15657 15658 15659 15660 15661 15662 15663 15664 15665 15666 15667 15668 15669 15670 15671 15672 15673 15674 15675 15676 15677 15678 15679 15680 15681 15682 15683 15684 15685 15686 15687 15688 15689 15690 15691 15692 15693 15694 15695 15696 15697 15698 15699 15700 15701 15702 15703 15704 15705 15706 15707 15708 15709 15710 15711 15712 15713 15714 15715 15716 15717 15718 15719 15720 15721 15722 15723 15724 15725 15726 15727 15728 15729 15730 15731 15732 15733 15734 15735 15736 15737 15738 15739 15740 15741 15742 15743 15744 15745 15746 15747 15748 15749 15750 15751 15752 15753 15754 15755 15756 15757 15758 15759 15760 15761 15762 15763 15764 15765 15766 15767 15768 15769 15770 15771 15772 15773 15774 15775 15776 15777 15778 15779 15780 15781 15782 15783 15784 15785 15786 15787 15788 15789 15790 15791 15792 15793 15794 15795 15796 15797 15798 15799 15800 15801 15802 15803 15804 15805 15806 15807 15808 15809 15810 15811 15812 15813 15814 15815 15816 15817 15818 15819 15820 15821 15822 15823 15824 15825 15826 15827 15828 15829 15830 15831 15832 15833 15834 15835 15836 15837 15838 15839 15840 15841 15842 15843 15844 15845 15846 15847 15848 15849 15850 15851 15852 15853 15854 15855 15856 15857 15858 15859 15860 15861 15862 15863 15864 15865 15866 15867 15868 15869 15870 15871 15872 15873 15874 15875 15876 15877 15878 15879 15880 15881 15882 15883 15884 15885 15886 15887 15888 15889 15890 15891 15892 15893 15894 15895 15896 15897 15898 15899 15900 15901 15902 15903 15904 15905 15906 15907 15908 15909 15910 15911 15912 15913 15914 15915 15916 15917 15918 15919 15920 15921 15922 15923 15924 15925 15926 15927 15928 15929 15930 15931 15932 15933 15934 15935 15936 15937 15938 15939 15940 15941 15942 15943 15944 15945 15946 15947 15948 15949 15950 15951 15952 15953 15954 15955 15956 15957 15958 15959 15960 15961 15962 15963 15964 15965 15966 15967 15968 15969 15970 15971 15972 15973 15974 15975 15976 15977 15978 15979 15980 15981 15982 15983 15984 15985 15986 15987 15988 15989 15990 15991 15992 15993 15994 15995 15996 15997 15998 15999 16000 16001 16002 16003 16004 16005 16006 16007 16008 16009 16010 16011 16012 16013 16014 16015 16016 16017 16018 16019 16020 16021 16022 16023 16024 16025 16026 16027 16028 16029 16030 16031 16032 16033 16034 16035 16036 16037 16038 16039 16040 16041 16042 16043 16044 16045 16046 16047 16048 16049 16050 16051 16052 16053 16054 16055 16056 16057 16058 16059 16060 16061 16062 16063 16064 16065 16066 16067 16068 16069 16070 16071 16072 16073 16074 16075 16076 16077 16078 16079 16080 16081 16082 16083 16084 16085 16086 16087 16088 16089 16090 16091 16092 16093 16094 16095 16096 16097 16098 16099 16100 16101 16102 16103 16104 16105 16106 16107 16108 16109 16110 16111 16112 16113 16114 16115 16116 16117 16118 16119 16120 16121 16122 16123 16124 16125 16126 16127 16128 16129 16130 16131 16132 16133 16134 16135 16136 16137 16138 16139 16140 16141 16142 16143 16144 16145 16146 16147 16148 16149 16150 16151 16152 16153 16154 16155 16156 16157 16158 16159 16160 16161 16162 16163 16164 16165 16166 16167 16168 16169 16170 16171 16172 16173 16174 16175 16176 16177 16178 16179 16180 16181 16182 16183 16184 16185 16186 16187 16188 16189 16190 16191 16192 16193 16194 16195 16196 16197 16198 16199 16200 16201 16202 16203 16204 16205 16206 16207 16208 16209 16210 16211 16212 16213 16214 16215 16216 16217 16218 16219 16220 16221 16222 16223 16224 16225 16226 16227 16228 16229 16230 16231 16232 16233 16234 16235 16236 16237 16238 16239 16240 16241 16242 16243 16244 16245 16246 16247 16248 16249 16250 16251 16252 16253 16254 16255 16256 16257 16258 16259 16260 16261 16262 16263 16264 16265 16266 16267 16268 16269 16270 16271 16272 16273 16274 16275 16276 16277 16278 16279 16280 16281 16282 16283 16284 16285 16286 16287 16288 16289 16290 16291 16292 16293 16294 16295 16296 16297 16298 16299 16300 16301 16302 16303 16304 16305 16306 16307 16308 16309 16310 16311 16312 16313 16314 16315 16316 16317 16318 16319 16320 16321 16322 16323 16324 16325 16326 16327 16328 16329 16330 16331 16332 16333 16334 16335 16336 16337 16338 16339 16340 16341 16342 16343 16344 16345 16346 16347 16348 16349 16350 16351 16352 16353 16354 16355 16356 16357 16358 16359 16360 16361 16362 16363 16364 16365 16366 16367 16368 16369 16370 16371 16372 16373 16374 16375 16376 16377 16378 16379 16380 16381 16382 16383 16384 16385 16386 16387 16388 16389 16390 16391 16392 16393 16394 16395 16396 16397 16398 16399 16400 16401 16402 16403 16404 16405 16406 16407 16408 16409 16410 16411 16412 16413 16414 16415 16416 16417 16418 16419 16420 16421 16422 16423 16424 16425 16426 16427 16428 16429 16430 16431 16432 16433 16434 16435 16436 16437 16438 16439 16440 16441 16442 16443 16444 16445 16446 16447 16448 16449 16450 16451 16452 16453 16454 16455 16456 16457 16458 16459 16460 16461 16462 16463 16464 16465 16466 16467 16468 16469 16470 16471 16472 16473 16474 16475 16476 16477 16478 16479 16480 16481 16482 16483 16484 16485 16486 16487 16488 16489 16490 16491 16492 16493 16494 16495 16496 16497 16498 16499 16500 16501 16502 16503 16504 16505 16506 16507 16508 16509 16510 16511 16512 16513 16514 16515 16516 16517 16518 16519 16520 16521 16522 16523 16524 16525 16526 16527 16528 16529 16530 16531 16532 16533 16534 16535 16536 16537 16538 16539 16540 16541 16542 16543 16544 16545 16546 16547 16548 16549 16550 16551 16552 16553 16554 16555 16556 16557 16558 16559 16560 16561 16562 16563 16564 16565 16566 16567 16568 16569 16570 16571 16572 16573 16574 16575 16576 16577 16578 16579 16580 16581 16582 16583 16584 16585 16586 16587 16588 16589 16590 16591 16592 16593 16594 16595 16596 16597 16598 16599 16600 16601 16602 16603 16604 16605 16606 16607 16608 16609 16610 16611 16612 16613 16614 16615 16616 16617 16618 16619 16620 16621 16622 16623 16624 16625 16626 16627 16628 16629 16630 16631 16632 16633 16634 16635 16636 16637 16638 16639 16640 16641 16642 16643 16644 16645 16646 16647 16648 16649 16650 16651 16652 16653 16654 16655 16656 16657 16658 16659 16660 16661 16662 16663 16664 16665 16666 16667 16668 16669 16670 16671 16672 16673 16674 16675 16676 16677 16678 16679 16680 16681 16682 16683 16684 16685 16686 16687 16688 16689 16690 16691 16692 16693 16694 16695 16696 16697 16698 16699 16700 16701 16702 16703 16704 16705 16706 16707 16708 16709 16710 16711 16712 16713 16714 16715 16716 16717 16718 16719 16720 16721 16722 16723 16724 16725 16726 16727 16728 16729 16730 16731 16732 16733 16734 16735 16736 16737 16738 16739 16740 16741 16742 16743 16744 16745 16746 16747 16748 16749 16750 16751 16752 16753 16754 16755 16756 16757 16758 16759 16760 16761 16762 16763 16764 16765 16766 16767 16768 16769 16770 16771 16772 16773 16774 16775 16776 16777 16778 16779 16780 16781 16782 16783 16784 16785 16786 16787 16788 16789 16790 16791 16792 16793 16794 16795 16796 16797 16798 16799 16800 16801 16802 16803 16804 16805 16806 16807 16808 16809 16810 16811 16812 16813 16814 16815 16816 16817 16818 16819 16820 16821 16822 16823 16824 16825 16826 16827 16828 16829 16830 16831 16832 16833 16834 16835 16836 16837 16838 16839 16840 16841 16842 16843 16844 16845 16846 16847 16848 16849 16850 16851 16852 16853 16854 16855 16856 16857 16858 16859 16860 16861 16862 16863 16864 16865 16866 16867 16868 16869 16870 16871 16872 16873 16874 16875 16876 16877 16878 16879 16880 16881 16882 16883 16884 16885 16886 16887 16888 16889 16890 16891 16892 16893 16894 16895 16896 16897 16898 16899 16900 16901 16902 16903 16904 16905 16906 16907 16908 16909 16910 16911 16912 16913 16914 16915 16916 16917 16918 16919 16920 16921 16922 16923 16924 16925 16926 16927 16928 16929 16930 16931 16932 16933 16934 16935 16936 16937 16938 16939 16940 16941 16942 16943 16944 16945 16946 16947 16948 16949 16950 16951 16952 16953 16954 16955 16956 16957 16958 16959 16960 16961 16962 16963 16964 16965 16966 16967 16968 16969 16970 16971 16972 16973 16974 16975 16976 16977 16978 16979 16980 16981 16982 16983 16984 16985 16986 16987 16988 16989 16990 16991 16992 16993 16994 16995 16996 16997 16998 16999 17000 17001 17002 17003 17004 17005 17006 17007 17008 17009 17010 17011 17012 17013 17014 17015 17016 17017 17018 17019 17020 17021 17022 17023 17024 17025 17026 17027 17028 17029 17030 17031 17032 17033 17034 17035 17036 17037 17038 17039 17040 17041 17042 17043 17044 17045 17046 17047 17048 17049 17050 17051 17052 17053 17054 17055 17056 17057 17058 17059 17060 17061 17062 17063 17064 17065 17066 17067 17068 17069 17070 17071 17072 17073 17074 17075 17076 17077 17078 17079 17080 17081 17082 17083 17084 17085 17086 17087 17088 17089 17090 17091 17092 17093 17094 17095 17096 17097 17098 17099 17100 17101 17102 17103 17104 17105 17106 17107 17108 17109 17110 17111 17112 17113 17114 17115 17116 17117 17118 17119 17120 17121 17122 17123 17124 17125 17126 17127 17128 17129 17130 17131 17132 17133 17134 17135 17136 17137 17138 17139 17140 17141 17142 17143 17144 17145 17146 17147 17148 17149 17150 17151 17152 17153 17154 17155 17156 17157 17158 17159 17160 17161 17162 17163 17164 17165 17166 17167 17168 17169 17170 17171 17172 17173 17174 17175 17176 17177 17178 17179 17180 17181 17182 17183 17184 17185 17186 17187 17188 17189 17190 17191 17192 17193 17194 17195 17196 17197 17198 17199 17200 17201 17202 17203 17204 17205 17206 17207 17208 17209 17210 17211 17212 17213 17214 17215 17216 17217 17218 17219 17220 17221 17222 17223 17224 17225 17226 17227 17228 17229 17230 17231 17232 17233 17234 17235 17236 17237 17238 17239 17240 17241 17242 17243 17244 17245 17246 17247 17248 17249 17250 17251 17252 17253 17254 17255 17256 17257 17258 17259 17260 17261 17262 17263 17264 17265 17266 17267 17268 17269 17270 17271 17272 17273 17274 17275 17276 17277 17278 17279 17280 17281 17282 17283 17284 17285 17286 17287 17288 17289 17290 17291 17292 17293 17294 17295 17296 17297 17298 17299 17300 17301 17302 17303 17304 17305 17306 17307 17308 17309 17310 17311 17312 17313 17314 17315 17316 17317 17318 17319 17320 17321 17322 17323 17324 17325 17326 17327 17328 17329 17330 17331 17332 17333 17334 17335 17336 17337 17338 17339 17340 17341 17342 17343 17344 17345 17346 17347 17348 17349 17350 17351 17352 17353 17354 17355 17356 17357 17358 17359 17360 17361 17362 17363 17364 17365 17366 17367 17368 17369 17370 17371 17372 17373 17374 17375 17376 17377 17378 17379 17380 17381 17382 17383 17384 17385 17386 17387 17388 17389 17390 17391 17392 17393 17394 17395 17396 17397 17398 17399 17400 17401 17402 17403 17404 17405 17406 17407 17408 17409 17410 17411 17412 17413 17414 17415 17416 17417 17418 17419 17420 17421 17422 17423 17424 17425 17426 17427 17428 17429 17430 17431 17432 17433 17434 17435 17436 17437 17438 17439 17440 17441 17442 17443 17444 17445 17446 17447 17448 17449 17450 17451 17452 17453 17454 17455 17456 17457 17458 17459 17460 17461 17462 17463 17464 17465 17466 17467 17468 17469 17470 17471 17472 17473 17474 17475 17476 17477 17478 17479 17480 17481 17482 17483 17484 17485 17486 17487 17488 17489 17490 17491 17492 17493 17494 17495 17496 17497 17498 17499 17500 17501 17502 17503 17504 17505 17506 17507 17508 17509 17510 17511 17512 17513 17514 17515 17516 17517 17518 17519 17520 17521 17522 17523 17524 17525 17526 17527 17528 17529 17530 17531 17532 17533 17534 17535 17536 17537 17538 17539 17540 17541 17542 17543 17544 17545 17546 17547 17548 17549 17550 17551 17552 17553 17554 17555 17556 17557 17558 17559 17560 17561 17562 17563 17564 17565 17566 17567 17568 17569 17570 17571 17572 17573 17574 17575 17576 17577 17578 17579 17580 17581 17582 17583 17584 17585 17586 17587 17588 17589 17590 17591 17592 17593 17594 17595 17596 17597 17598 17599 17600 17601 17602 17603 17604 17605 17606 17607 17608 17609 17610 17611 17612 17613 17614 17615 17616 17617 17618 17619 17620 17621 17622 17623 17624 17625 17626 17627 17628 17629 17630 17631 17632 17633 17634 17635 17636 17637 17638 17639 17640 17641 17642 17643 17644 17645 17646 17647 17648 17649 17650 17651 17652 17653 17654 17655 17656 17657 17658 17659 17660 17661 17662 17663 17664 17665 17666 17667 17668 17669 17670 17671 17672 17673 17674 17675 17676 17677 17678 17679 17680 17681 17682 17683 17684 17685 17686 17687 17688 17689 17690 17691 17692 17693 17694 17695 17696 17697 17698 17699 17700 17701 17702 17703 17704 17705 17706 17707 17708 17709 17710 17711 17712 17713 17714 17715 17716 17717 17718 17719 17720 17721 17722 17723 17724 17725 17726 17727 17728 17729 17730 17731 17732 17733 17734 17735 17736 17737 17738 17739 17740 17741 17742 17743 17744 17745 17746 17747 17748 17749 17750 17751 17752 17753 17754 17755 17756 17757 17758 17759 17760 17761 17762 17763 17764 17765 17766 17767 17768 17769 17770 17771 17772 17773 17774 17775 17776 17777 17778 17779 17780 17781 17782 17783 17784 17785 17786 17787 17788 17789 17790 17791 17792 17793 17794 17795 17796 17797 17798 17799 17800 17801 17802 17803 17804 17805 17806 17807 17808 17809 17810 17811 17812 17813 17814 17815 17816 17817 17818 17819 17820 17821 17822 17823 17824 17825 17826 17827 17828 17829 17830 17831 17832 17833 17834 17835 17836 17837 17838 17839 17840 17841 17842 17843 17844 17845 17846 17847 17848 17849 17850 17851 17852 17853 17854 17855 17856 17857 17858 17859 17860 17861 17862 17863 17864 17865 17866 17867 17868 17869 17870 17871 17872 17873 17874 17875 17876 17877 17878 17879 17880 17881 17882 17883 17884 17885 17886 17887 17888 17889 17890 17891 17892 17893 17894 17895 17896 17897 17898 17899 17900 17901 17902 17903 17904 17905 17906 17907 17908 17909 17910 17911 17912 17913 17914 17915 17916 17917 17918 17919 17920 17921 17922 17923 17924 17925 17926 17927 17928 17929 17930 17931 17932 17933 17934 17935 17936 17937 17938 17939 17940 17941 17942 17943 17944 17945 17946 17947 17948 17949 17950 17951 17952 17953 17954 17955 17956 17957 17958 17959 17960 17961 17962 17963 17964 17965 17966 17967 17968 17969 17970 17971 17972 17973 17974 17975 17976 17977 17978 17979 17980 17981 17982 17983 17984 17985 17986 17987 17988 17989 17990 17991 17992 17993 17994 17995 17996 17997 17998 17999 18000 18001 18002 18003 18004 18005 18006 18007 18008 18009 18010 18011 18012 18013 18014 18015 18016 18017 18018 18019 18020 18021 18022 18023 18024 18025 18026 18027 18028 18029 18030 18031 18032 18033 18034 18035 18036 18037 18038 18039 18040 18041 18042 18043 18044 18045 18046 18047 18048 18049 18050 18051 18052 18053 18054 18055 18056 18057 18058 18059 18060 18061 18062 18063 18064 18065 18066 18067 18068 18069 18070 18071 18072 18073 18074 18075 18076 18077 18078 18079 18080 18081 18082 18083 18084 18085 18086 18087 18088 18089 18090 18091 18092 18093 18094 18095 18096 18097 18098 18099 18100 18101 18102 18103 18104 18105 18106 18107 18108 18109 18110 18111 18112 18113 18114 18115 18116 18117 18118 18119 18120 18121 18122 18123 18124 18125 18126 18127 18128 18129 18130 18131 18132 18133 18134 18135 18136 18137 18138 18139 18140 18141 18142 18143 18144 18145 18146 18147 18148 18149 18150 18151 18152 18153 18154 18155 18156 18157 18158 18159 18160 18161 18162 18163 18164 18165 18166 18167 18168 18169 18170 18171 18172 18173 18174 18175 18176 18177 18178 18179 18180 18181 18182 18183 18184 18185 18186 18187 18188 18189 18190 18191 18192 18193 18194 18195 18196 18197 18198 18199 18200 18201 18202 18203 18204 18205 18206 18207 18208 18209 18210 18211 18212 18213 18214 18215 18216 18217 18218 18219 18220 18221 18222 18223 18224 18225 18226 18227 18228 18229 18230 18231 18232 18233 18234 18235 18236 18237 18238 18239 18240 18241 18242 18243 18244 18245 18246 18247 18248 18249 18250 18251 18252 18253 18254 18255 18256 18257 18258 18259 18260 18261 18262 18263 18264 18265 18266 18267 18268 18269 18270 18271 18272 18273 18274 18275 18276 18277 18278 18279 18280 18281 18282 18283 18284 18285 18286 18287 18288 18289 18290 18291 18292 18293 18294 18295 18296 18297 18298 18299 18300 18301 18302 18303 18304 18305 18306 18307 18308 18309 18310 18311 18312 18313 18314 18315 18316 18317 18318 18319 18320 18321 18322 18323 18324 18325 18326 18327 18328 18329 18330 18331 18332 18333 18334 18335 18336 18337 18338 18339 18340 18341 18342 18343 18344 18345 18346 18347 18348 18349 18350 18351 18352 18353 18354 18355 18356 18357 18358 18359 18360 18361 18362 18363 18364 18365 18366 18367 18368 18369 18370 18371 18372 18373 18374 18375 18376 18377 18378 18379 18380 18381 18382 18383 18384 18385 18386 18387 18388 18389 18390 18391 18392 18393 18394 18395 18396 18397 18398 18399 18400 18401 18402 18403 18404 18405 18406 18407 18408 18409 18410 18411 18412 18413 18414 18415 18416 18417 18418 18419 18420 18421 18422 18423 18424 18425 18426 18427 18428 18429 18430 18431 18432 18433 18434 18435 18436 18437 18438 18439 18440 18441 18442 18443 18444 18445 18446 18447 18448 18449 18450 18451 18452 18453 18454 18455 18456 18457 18458 18459 18460 18461 18462 18463 18464 18465 18466 18467 18468 18469 18470 18471 18472 18473 18474 18475 18476 18477 18478 18479 18480 18481 18482 18483 18484 18485 18486 18487 18488 18489 18490 18491 18492 18493 18494 18495 18496 18497 18498 18499 18500 18501 18502 18503 18504 18505 18506 18507 18508 18509 18510 18511 18512 18513 18514 18515 18516 18517 18518 18519 18520 18521 18522 18523 18524 18525 18526 18527 18528 18529 18530 18531 18532 18533 18534 18535 18536 18537 18538 18539 18540 18541 18542 18543 18544 18545 18546 18547 18548 18549 18550 18551 18552 18553 18554 18555 18556 18557 18558 18559 18560 18561 18562 18563 18564 18565 18566 18567 18568 18569 18570 18571 18572 18573 18574 18575 18576 18577 18578 18579 18580 18581 18582 18583 18584 18585 18586 18587 18588 18589 18590 18591 18592 18593 18594 18595 18596 18597 18598 18599 18600 18601 18602 18603 18604 18605 18606 18607 18608 18609 18610 18611 18612 18613 18614 18615 18616 18617 18618 18619 18620 18621 18622 18623 18624 18625 18626 18627 18628 18629 18630 18631 18632 18633 18634 18635 18636 18637 18638 18639 18640 18641 18642 18643 18644 18645 18646 18647 18648 18649 18650 18651 18652 18653 18654 18655 18656 18657 18658 18659 18660 18661 18662 18663 18664 18665 18666 18667 18668 18669 18670 18671 18672 18673 18674 18675 18676 18677 18678 18679 18680 18681 18682 18683 18684 18685 18686 18687 18688 18689 18690 18691 18692 18693 18694 18695 18696 18697 18698 18699 18700 18701 18702 18703 18704 18705 18706 18707 18708 18709 18710 18711 18712 18713 18714 18715 18716 18717 18718 18719 18720 18721 18722 18723 18724 18725 18726 18727 18728 18729 18730 18731 18732 18733 18734 18735 18736 18737 18738 18739 18740 18741 18742 18743 18744 18745 18746 18747 18748 18749 18750 18751 18752 18753 18754 18755 18756 18757 18758 18759 18760 18761 18762 18763 18764 18765 18766 18767 18768 18769 18770 18771 18772 18773 18774 18775 18776 18777 18778 18779 18780 18781 18782 18783 18784 18785 18786 18787 18788 18789 18790 18791 18792 18793 18794 18795 18796 18797 18798 18799 18800 18801 18802 18803 18804 18805 18806 18807 18808 18809 18810 18811 18812 18813 18814 18815 18816 18817 18818 18819 18820 18821 18822 18823 18824 18825 18826 18827 18828 18829 18830 18831 18832 18833 18834 18835 18836 18837 18838 18839 18840 18841 18842 18843 18844 18845 18846 18847 18848 18849 18850 18851 18852 18853 18854 18855 18856 18857 18858 18859 18860 18861 18862 18863 18864 18865 18866 18867 18868 18869 18870 18871 18872 18873 18874 18875 18876 18877 18878 18879 18880 18881 18882 18883 18884 18885 18886 18887 18888 18889 18890 18891 18892 18893 18894 18895 18896 18897 18898 18899 18900 18901 18902 18903 18904 18905 18906 18907 18908 18909 18910 18911 18912 18913 18914 18915 18916 18917 18918 18919 18920 18921 18922 18923 18924 18925 18926 18927 18928 18929 18930 18931 18932 18933 18934 18935 18936 18937 18938 18939 18940 18941 18942 18943 18944 18945 18946 18947 18948 18949 18950 18951 18952 18953 18954 18955 18956 18957 18958 18959 18960 18961 18962 18963 18964 18965 18966 18967 18968 18969 18970 18971 18972 18973 18974 18975 18976 18977 18978 18979 18980 18981 18982 18983 18984 18985 18986 18987 18988 18989 18990 18991 18992 18993 18994 18995 18996 18997 18998 18999 19000 19001 19002 19003 19004 19005 19006 19007 19008 19009 19010 19011 19012 19013 19014 19015 19016 19017 19018 19019 19020 19021 19022 19023 19024 19025 19026 19027 19028 19029 19030 19031 19032 19033 19034 19035 19036 19037 19038 19039 19040 19041 19042 19043 19044 19045 19046 19047 19048 19049 19050 19051 19052 19053 19054 19055 19056 19057 19058 19059 19060 19061 19062 19063 19064 19065 19066 19067 19068 19069 19070 19071 19072 19073 19074 19075 19076 19077 19078 19079 19080 19081 19082 19083 19084 19085 19086 19087 19088 19089 19090 19091 19092 19093 19094 19095 19096 19097 19098 19099 19100 19101 19102 19103 19104 19105 19106 19107 19108 19109 19110 19111 19112 19113 19114 19115 19116 19117 19118 19119 19120 19121 19122 19123 19124 19125 19126 19127 19128 19129 19130 19131 19132 19133 19134 19135 19136 19137 19138 19139 19140 19141 19142 19143 19144 19145 19146 19147 19148 19149 19150 19151 19152 19153 19154 19155 19156 19157 19158 19159 19160 19161 19162 19163 19164 19165 19166 19167 19168 19169 19170 19171 19172 19173 19174 19175 19176 19177 19178 19179 19180 19181 19182 19183 19184 19185 19186 19187 19188 19189 19190 19191 19192 19193 19194 19195 19196 19197 19198 19199 19200 19201 19202 19203 19204 19205 19206 19207 19208 19209 19210 19211 19212 19213 19214 19215 19216 19217 19218 19219 19220 19221 19222 19223 19224 19225 19226 19227 19228 19229 19230 19231 19232 19233 19234 19235 19236 19237 19238 19239 19240 19241 19242 19243 19244 19245 19246 19247 19248 19249 19250 19251 19252 19253 19254 19255 19256 19257 19258 19259 19260 19261 19262 19263 19264 19265 19266 19267 19268 19269 19270 19271 19272 19273 19274 19275 19276 19277 19278 19279 19280 19281 19282 19283 19284 19285 19286 19287 19288 19289 19290 19291 19292 19293 19294 19295 19296 19297 19298 19299 19300 19301 19302 19303 19304 19305 19306 19307 19308 19309 19310 19311 19312 19313 19314 19315 19316 19317 19318 19319 19320 19321 19322 19323 19324 19325 19326 19327 19328 19329 19330 19331 19332 19333 19334 19335 19336 19337 19338 19339 19340 19341 19342 19343 19344 19345 19346 19347 19348 19349 19350 19351 19352 19353 19354 19355 19356 19357 19358 19359 19360 19361 19362 19363 19364 19365 19366 19367 19368 19369 19370 19371 19372 19373 19374 19375 19376 19377 19378 19379 19380 19381 19382 19383 19384 19385 19386 19387 19388 19389 19390 19391 19392 19393 19394 19395 19396 19397 19398 19399 19400 19401 19402 19403 19404 19405 19406 19407 19408 19409 19410 19411 19412 19413 19414 19415 19416 19417 19418 19419 19420 19421 19422 19423 19424 19425 19426 19427 19428 19429 19430 19431 19432 19433 19434 19435 19436 19437 19438 19439 19440 19441 19442 19443 19444 19445 19446 19447 19448 19449 19450 19451 19452 19453 19454 19455 19456 19457 19458 19459 19460 19461 19462 19463 19464 19465 19466 19467 19468 19469 19470 19471 19472 19473 19474 19475 19476 19477 19478 19479 19480 19481 19482 19483 19484 19485 19486 19487 19488 19489 19490 19491 19492 19493 19494 19495 19496 19497 19498 19499 19500 19501 19502 19503 19504 19505 19506 19507 19508 19509 19510 19511 19512 19513 19514 19515 19516 19517 19518 19519 19520 19521 19522 19523 19524 19525 19526 19527 19528 19529 19530 19531 19532 19533 19534 19535 19536 19537 19538 19539 19540 19541 19542 19543 19544 19545 19546 19547 19548 19549 19550 19551 19552 19553 19554 19555 19556 19557 19558 19559 19560 19561 19562 19563 19564 19565 19566 19567 19568 19569 19570 19571 19572 19573 19574 19575 19576 19577 19578 19579 19580 19581 19582 19583 19584 19585 19586 19587 19588 19589 19590 19591 19592 19593 19594 19595 19596 19597 19598 19599 19600 19601 19602 19603 19604 19605 19606 19607 19608 19609 19610 19611 19612 19613 19614 19615 19616 19617 19618 19619 19620 19621 19622 19623 19624 19625 19626 19627 19628 19629 19630 19631 19632 19633 19634 19635 19636 19637 19638 19639 19640 19641 19642 19643 19644 19645 19646 19647 19648 19649 19650 19651 19652 19653 19654 19655 19656 19657 19658 19659 19660 19661 19662 19663 19664 19665 19666 19667 19668 19669 19670 19671 19672 19673 19674 19675 19676 19677 19678 19679 19680 19681 19682 19683 19684 19685 19686 19687 19688 19689 19690 19691 19692 19693 19694 19695 19696 19697 19698 19699 19700 19701 19702 19703 19704 19705 19706 19707 19708 19709 19710 19711 19712 19713 19714 19715 19716 19717 19718 19719 19720 19721 19722 19723 19724 19725 19726 19727 19728 19729 19730 19731 19732 19733 19734 19735 19736 19737 19738 19739 19740 19741 19742 19743 19744 19745 19746 19747 19748 19749 19750 19751 19752 19753 19754 19755 19756 19757 19758 19759 19760 19761 19762 19763 19764 19765 19766 19767 19768 19769 19770 19771 19772 19773 19774 19775 19776 19777 19778 19779 19780 19781 19782 19783 19784 19785 19786 19787 19788 19789 19790 19791 19792 19793 19794 19795 19796 19797 19798 19799 19800 19801 19802 19803 19804 19805 19806 19807 19808 19809 19810 19811 19812 19813 19814 19815 19816 19817 19818 19819 19820 19821 19822 19823 19824 19825 19826 19827 19828 19829 19830 19831 19832 19833 19834 19835 19836 19837 19838 19839 19840 19841 19842 19843 19844 19845 19846 19847 19848 19849 19850 19851 19852 19853 19854 19855 19856 19857 19858 19859 19860 19861 19862 19863 19864 19865 19866 19867 19868 19869 19870 19871 19872 19873 19874 19875 19876 19877 19878 19879 19880 19881 19882 19883 19884 19885 19886 19887 19888 19889 19890 19891 19892 19893 19894 19895 19896 19897 19898 19899 19900 19901 19902 19903 19904 19905 19906 19907 19908 19909 19910 19911 19912 19913 19914 19915 19916 19917 19918 19919 19920 19921 19922 19923 19924 19925 19926 19927 19928 19929 19930 19931 19932 19933 19934 19935 19936 19937 19938 19939 19940 19941 19942 19943 19944 19945 19946 19947 19948 19949 19950 19951 19952 19953 19954 19955 19956 19957 19958 19959 19960 19961 19962 19963 19964 19965 19966 19967 19968 19969 19970 19971 19972 19973 19974 19975 19976 19977 19978 19979 19980 19981 19982 19983 19984 19985 19986 19987 19988 19989 19990 19991 19992 19993 19994 19995 19996 19997 19998 19999 20000 20001 20002 20003 20004 20005 20006 20007 20008 20009 20010 20011 20012 20013 20014 20015 20016 20017 20018 20019 20020 20021 20022 20023 20024 20025 20026 20027 20028 20029 20030 20031 20032 20033 20034 20035 20036 20037 20038 20039 20040 20041 20042 20043 20044 20045 20046 20047 20048 20049 20050 20051 20052 20053 20054 20055 20056 20057 20058 20059 20060 20061 20062 20063 20064 20065 20066 20067 20068 20069 20070 20071 20072 20073 20074 20075 20076 20077 20078 20079 20080 20081 20082 20083 20084 20085 20086 20087 20088 20089 20090 20091 20092 20093 20094 20095 20096 20097 20098 20099 20100 20101 20102 20103 20104 20105 20106 20107 20108 20109 20110 20111 20112 20113 20114 20115 20116 20117 20118 20119 20120 20121 20122 20123 20124 20125 20126 20127 20128 20129 20130 20131 20132 20133 20134 20135 20136 20137 20138 20139 20140 20141 20142 20143 20144 20145 20146 20147 20148 20149 20150 20151 20152 20153 20154 20155 20156 20157 20158 20159 20160 20161 20162 20163 20164 20165 20166 20167 20168 20169 20170 20171 20172 20173 20174 20175 20176 20177 20178 20179 20180 20181 20182 20183 20184 20185 20186 20187 20188 20189 20190 20191 20192 20193 20194 20195 20196 20197 20198 20199 20200 20201 20202 20203 20204 20205 20206 20207 20208 20209 20210 20211 20212 20213 20214 20215 20216 20217 20218 20219 20220 20221 20222 20223 20224 20225 20226 20227 20228 20229 20230 20231 20232 20233 20234 20235 20236 20237 20238 20239 20240 20241 20242 20243 20244 20245 20246 20247 20248 20249 20250 20251 20252 20253 20254 20255 20256 20257 20258 20259 20260 20261 20262 20263 20264 20265 20266 20267 20268 20269 20270 20271 20272 20273 20274 20275 20276 20277 20278 20279 20280 20281 20282 20283 20284 20285 20286 20287 20288 20289 20290 20291 20292 20293 20294 20295 20296 20297 20298 20299 20300 20301 20302 20303 20304 20305 20306 20307 20308 20309 20310 20311 20312 20313 20314 20315 20316 20317 20318 20319 20320 20321 20322 20323 20324 20325 20326 20327 20328 20329 20330 20331 20332 20333 20334 20335 20336 20337 20338 20339 20340 20341 20342 20343 20344 20345 20346 20347 20348 20349 20350 20351 20352 20353 20354 20355 20356 20357 20358 20359 20360 20361 20362 20363 20364 20365 20366 20367 20368 20369 20370 20371 20372 20373 20374 20375 20376 20377 20378 20379 20380 20381 20382 20383 20384 20385 20386 20387 20388 20389 20390 20391 20392 20393 20394 20395 20396 20397 20398 20399 20400 20401 20402 20403 20404 20405 20406 20407 20408 20409 20410 20411 20412 20413 20414 20415 20416 20417 20418 20419 20420 20421 20422 20423 20424 20425 20426 20427 20428 20429 20430 20431 20432 20433 20434 20435 20436 20437 20438 20439 20440 20441 20442 20443 20444 20445 20446 20447 20448 20449 20450 20451 20452 20453 20454 20455 20456 20457 20458 20459 20460 20461 20462 20463 20464 20465 20466 20467 20468 20469 20470 20471 20472 20473 20474 20475 20476 20477 20478 20479 20480 20481 20482 20483 20484 20485 20486 20487 20488 20489 20490 20491 20492 20493 20494 20495 20496 20497 20498 20499 20500 20501 20502 20503 20504 20505 20506 20507 20508 20509 20510 20511 20512 20513 20514 20515 20516 20517 20518 20519 20520 20521 20522 20523 20524 20525 20526 20527 20528 20529 20530 20531 20532 20533 20534 20535 20536 20537 20538 20539 20540 20541 20542 20543 20544 20545 20546 20547 20548 20549 20550 20551 20552 20553 20554 20555 20556 20557 20558 20559 20560 20561 20562 20563 20564 20565 20566 20567 20568 20569 20570 20571 20572 20573 20574 20575 20576 20577 20578 20579 20580 20581 20582 20583 20584 20585 20586 20587 20588 20589 20590 20591 20592 20593 20594 20595 20596 20597 20598 20599 20600 20601 20602 20603 20604 20605 20606 20607 20608 20609 20610 20611 20612 20613 20614 20615 20616 20617 20618 20619 20620 20621 20622 20623 20624 20625 20626 20627 20628 20629 20630 20631 20632 20633 20634 20635 20636 20637 20638 20639 20640 20641 20642 20643 20644 20645 20646 20647 20648 20649 20650 20651 20652 20653 20654 20655 20656 20657 20658 20659 20660 20661 20662 20663 20664 20665 20666 20667 20668 20669 20670 20671 20672 20673 20674 20675 20676 20677 20678 20679 20680 20681 20682 20683 20684 20685 20686 20687 20688 20689 20690 20691 20692 20693 20694 20695 20696 20697 20698 20699 20700 20701 20702 20703 20704 20705 20706 20707 20708 20709 20710 20711 20712 20713 20714 20715 20716 20717 20718 20719 20720 20721 20722 20723 20724 20725 20726 20727 20728 20729 20730 20731 20732 20733 20734 20735 20736 20737 20738 20739 20740 20741 20742 20743 20744 20745 20746 20747 20748 20749 20750 20751 20752 20753 20754 20755 20756 20757 20758 20759 20760 20761 20762 20763 20764 20765 20766 20767 20768 20769 20770 20771 20772 20773 20774 20775 20776 20777 20778 20779 20780 20781 20782 20783 20784 20785 20786 20787 20788 20789 20790 20791 20792 20793 20794 20795 20796 20797 20798 20799 20800 20801 20802 20803 20804 20805 20806 20807 20808 20809 20810 20811 20812 20813 20814 20815 20816 20817 20818 20819 20820 20821 20822 20823 20824 20825 20826 20827 20828 20829 20830 20831 20832 20833 20834 20835 20836 20837 20838 20839 20840 20841 20842 20843 20844 20845 20846 20847 20848 20849 20850 20851 20852 20853 20854 20855 20856 20857 20858 20859 20860 20861 20862 20863 20864 20865 20866 20867 20868 20869 20870 20871 20872 20873 20874 20875 20876 20877 20878 20879 20880 20881 20882 20883 20884 20885 20886 20887 20888 20889 20890 20891 20892 20893 20894 20895 20896 20897 20898 20899 20900 20901 20902 20903 20904 20905 20906 20907 20908 20909 20910 20911 20912 20913 20914 20915 20916 20917 20918 20919 20920 20921 20922 20923 20924 20925 20926 20927 20928 20929 20930 20931 20932 20933 20934 20935 20936 20937 20938 20939 20940 20941 20942 20943 20944 20945 20946 20947 20948 20949 20950 20951 20952 20953 20954 20955 20956 20957 20958 20959 20960 20961 20962 20963 20964 20965 20966 20967 20968 20969 20970 20971 20972 20973 20974 20975 20976 20977 20978 20979 20980 20981 20982 20983 20984 20985 20986 20987 20988 20989 20990 20991 20992 20993 20994 20995 20996 20997 20998 20999 21000 21001 21002 21003 21004 21005 21006 21007 21008 21009 21010 21011 21012 21013 21014 21015 21016 21017 21018 21019 21020 21021 21022 21023 21024 21025 21026 21027 21028 21029 21030 21031 21032 21033 21034 21035 21036 21037 21038 21039 21040 21041 21042 21043 21044 21045 21046 21047 21048 21049 21050 21051 21052 21053 21054 21055 21056 21057 21058 21059 21060 21061 21062 21063 21064 21065 21066 21067 21068 21069 21070 21071 21072 21073 21074 21075 21076 21077 21078 21079 21080 21081 21082 21083 21084 21085 21086 21087 21088 21089 21090 21091 21092 21093 21094 21095 21096 21097 21098 21099 21100 21101 21102 21103 21104 21105 21106 21107 21108 21109 21110 21111 21112 21113 21114 21115 21116 21117 21118 21119 21120 21121 21122 21123 21124 21125 21126 21127 21128 21129 21130 21131 21132 21133 21134 21135 21136 21137 21138 21139 21140 21141 21142 21143 21144 21145 21146 21147 21148 21149 21150 21151 21152 21153 21154 21155 21156 21157 21158 21159 21160 21161 21162 21163 21164 21165 21166 21167 21168 21169 21170 21171 21172 21173 21174 21175 21176 21177 21178 21179 21180 21181 21182 21183 21184 21185 21186 21187 21188 21189 21190 21191 21192 21193 21194 21195 21196 21197 21198 21199 21200 21201 21202 21203 21204 21205 21206 21207 21208 21209 21210 21211 21212 21213 21214 21215 21216 21217 21218 21219 21220 21221 21222 21223 21224 21225 21226 21227 21228 21229 21230 21231 21232 21233 21234 21235 21236 21237 21238 21239 21240 21241 21242 21243 21244 21245 21246 21247 21248 21249 21250 21251 21252 21253 21254 21255 21256 21257 21258 21259 21260 21261 21262 21263 21264 21265 21266 21267 21268 21269 21270 21271 21272 21273 21274 21275 21276 21277 21278 21279 21280 21281 21282 21283 21284 21285 21286 21287 21288 21289 21290 21291 21292 21293 21294 21295 21296 21297 21298 21299 21300 21301 21302 21303 21304 21305 21306 21307 21308 21309 21310 21311 21312 21313 21314 21315 21316 21317 21318 21319 21320 21321 21322 21323 21324 21325 21326 21327 21328 21329 21330 21331 21332 21333 21334 21335 21336 21337 21338 21339 21340 21341 21342 21343 21344 21345 21346 21347 21348 21349 21350 21351 21352 21353 21354 21355 21356 21357 21358 21359 21360 21361 21362 21363 21364 21365 21366 21367 21368 21369 21370 21371 21372 21373 21374 21375 21376 21377 21378 21379 21380 21381 21382 21383 21384 21385 21386 21387 21388 21389 21390 21391 21392 21393 21394 21395 21396 21397 21398 21399 21400 21401 21402 21403 21404 21405 21406 21407 21408 21409 21410 21411 21412 21413 21414 21415 21416 21417 21418 21419 21420 21421 21422 21423 21424 21425 21426 21427 21428 21429 21430 21431 21432 21433 21434 21435 21436 21437 21438 21439 21440 21441 21442 21443 21444 21445 21446 21447 21448 21449 21450 21451 21452 21453 21454 21455 21456 21457 21458 21459 21460 21461 21462 21463 21464 21465 21466 21467 21468 21469 21470 21471 21472 21473 21474 21475 21476 21477 21478 21479 21480 21481 21482 21483 21484 21485 21486 21487 21488 21489 21490 21491 21492 21493 21494 21495 21496 21497 21498 21499
|
msgid ""
msgstr ""
"Content-Type: text/plain; charset=UTF-8\n"
"Project-Id-Version: Lazarus\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: \n"
"Last-Translator: Marcelo B Paula <marcelo.bp@netsite.com.br>\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"Content-Transfer-Encoding: 8bit\n"
"Language: pt_BR\n"
"X-Generator: Poedit 1.8.13\n"
#: lazarusidestrconsts.dbgbreakgroupdlgcaption
msgctxt "lazarusidestrconsts.dbgbreakgroupdlgcaption"
msgid "Select Groups"
msgstr "Selecionar grupos"
#: lazarusidestrconsts.dbgbreakgroupdlgheaderdisable
msgid "Select groups to disable when breakpoint is hit"
msgstr "Selecionar grupos à desabilitar quando o ponto de parada for atingido"
#: lazarusidestrconsts.dbgbreakgroupdlgheaderenable
msgid "Select groups to enable when breakpoint is hit"
msgstr "Selecionar grupos à habilitar quando o ponto de parada for atingido"
#: lazarusidestrconsts.dbgbreakpropertygroupnotfound
msgid "Some groups in the Enable/Disable list do not exist.%0:sCreate them?%0:s%0:s%1:s"
msgstr "Alguns grupos na lista Habilitar/Desabilitar não existem.%0:sCriá-los?%0:s%0:s%1:s"
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
msgid "Address Breakpoint %s"
msgstr "Endereço do ponto de parada %s"
#: lazarusidestrconsts.dbgeventbreakataddress
msgid "at $%s"
msgstr "na $%s"
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
msgid "at $%s: from origin %s line %d"
msgstr "na $%s: da origem %s linha %d"
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
msgid "at $%s: %s line %d"
msgstr "na $%s: %s linha %d"
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
msgid "Source Breakpoint %s"
msgstr "Ponto de parada origem %s"
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
msgid "Unknown Breakpoint %s"
msgstr "Ponto de parada desconhecido %s"
#: lazarusidestrconsts.dbgeventbreakwatchpoint
msgid "Watchpoint %s"
msgstr "Ponto de observação %s"
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
msgid "Unknown Watchpoint out of scope %s"
msgstr "Ponto de observação desconhecido fora do escopo %s"
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Ponto de observação desconhecido disparado %s. Valor anterior \"%s\", Novo valor \"%s\""
#: lazarusidestrconsts.dbgeventwatchscopeended
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr "Ponto de observação para \"%s\" fora do escopo %s"
#: lazarusidestrconsts.dbgeventwatchtriggered
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Ponto de observação para \"%s\" foi disparado %s. Valor anterior \"%s\", Novo valor \"%s\""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Usar esquema predefinido"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Redefinir todas configurações"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Redefinir todas configurações medianiz"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Redefinir todas configurações texto"
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Adicionar ponto de histórico"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Menu contexto"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Menu contexto (depuração)"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Menu contexto (tab)"
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Saltar para implementação"
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Saltar para implementação/outro final de bloco"
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Voltar histórico"
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Avançar histórico"
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr "Alternar cursor texto extra"
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Nada/Padrão"
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Colar"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Continuar %0:s (Delimitado por: %1:s)"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
msgid "Continue %0:s"
msgstr "Continuar %0:s"
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Selecionar texto"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Selecionar texto (linhas)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Selecionar texto (símbolos)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Selecionar texto (palavras)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Selecionar texto (modo coluna)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Selecionar texto (modo linha)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Definir marcador livre"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Selecionar linha atual (Completo)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Selecionar linha atual (Texto)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Selecionar parágrafo atual"
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Selecionar palavra atual"
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Redefinir zoom"
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Esta página não representa suas configurações atuais. Veja página avançada. Use esta página para redefinir quaisquer alterações avançadas."
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Geral"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Padrão, Todas ações (ponto parada, retração) no mouse abaixo"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Estendido, Ações (ponto parada, retração) no mouse acima. Seleção no mouse abaixo e movimento"
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr "Estender, Ações, apenas metade da medianiz direita"
#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr "Usar números de linha para selecioná-las"
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Medianiz"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right button click includes caret move"
msgstr "Clique botão direito inclui movimento cursor texto"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Texto"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl e Botão"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl e Roda"
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt e Botão"
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt e Roda"
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl e Botão"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Ctrl e Roda"
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Arrastar seleção (copiar/colar)"
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Botão Extra-1"
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Botão Extra-2"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt e Duplo"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl e Duplo"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Duplo"
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Shift e Duplo"
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Quádruplo"
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Triplo"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Botão Central"
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Meio"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Extra 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Extra 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Esquerda 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Esquerda 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Direita"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Roda"
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Botão Direito"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Shift-Alt-Ctrl e Botão"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Shift-Alt-Ctrl"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Shift-Alt e Botão"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Shift-Alt e Roda"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Shift-Ctrl e Botão"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Shift-Ctrl e Roda"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Shift e Botão"
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Roda"
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Shift e Roda"
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Você tem alterações não salvas. Ao usar esta página, todas alterações feitas na página avançado serão desfeitas"
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Rolagem horizontal (velocidade do sistema)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Rolagem horizontal (linha única)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Rolagem horizontal (página)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Rolagem horizontal (meia página)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Rolagem horizontal (página, menos uma linha)"
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Nada/Padrão"
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Rolagem (velocidade do sistema)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Rolagem (linha única)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Rolagem (página)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Rolagem (meia página)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Rolagem (página, menos uma linha)"
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Zoom"
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "<Nenhum>"
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Somente leitura"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Minúscula, primeira letra maiúscula"
#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr "ativo"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Adicionar operador de atribuição :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Realçar parênteses"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Árvore código retrátil"
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Texto Padrão"
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr "Texto padrão / Janela"
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Ponto de parada desativado"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Ponto de parada ativo"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Linha erro"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Ponto execução"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Marcador código retraído"
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr "Linha inicial retração"
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Global"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Medianiz"
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "\"IfDef\""
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Linha"
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr "Cores de contorno"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Edição Síncrona"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Edição Modelo"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Texto"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Separador Medianiz"
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr "Linha inicial ocultação"
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Outros Incrementais"
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr "Realçar prefixo"
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Realçar palavra atual"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Busca incremental"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Ponto de parada inválido"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Realce linha atual"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Número linha"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Linha modificada"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Vínculo \"mouse\""
#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
msgid "Level 10"
msgstr "Nível 10"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
msgid "Level 1"
msgstr "Nível 1"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
msgid "Level 2"
msgstr "Nível 2"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
msgid "Level 3"
msgstr "Nível 3"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
msgid "Level 4"
msgstr "Nível 4"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
msgid "Level 5"
msgstr "Nível 5"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
msgid "Level 6"
msgstr "Nível 6"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
msgid "Level 7"
msgstr "Nível 7"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
msgid "Level 8"
msgstr "Nível 8"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
msgid "Level 9"
msgstr "Nível 9"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Área selecionada"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Célula Ativa"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Outras Células"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Células sincronizadas"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Célula Ativa"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Outras Células"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Células Sincronizadas"
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Bloco texto"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Ponto de parada desconhecido"
#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr "Borda da janela"
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Palavra entre Parênteses"
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Caracteres especiais visualizados"
#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr "Adicionar novo modo"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Adicionar ponto e vírgula"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Ajustar linha superior devido ao comentário em frente"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Alfabeticamente"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always keep caret in visible area of editor"
msgstr "Sempre manter cursor texto na área visível do editor"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Ação ambígua de arquivos:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Aviso ao compilar"
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr "Um ícone para erro/aviso/dica é exibido na frente da mensagem. O mesmo ícone é exibido na medianiz do editor em qualquer caso."
#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr "Ansi (* *)"
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Configurações da aplicação"
#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Incluir código de afirmação"
#: lazarusidestrconsts.dlgassociateddebugdesktop
msgid "Associated debug desktop"
msgstr "Área de trabalho de depuração associada"
#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr "Se você selecionar a área de trabalho, a área de trabalho de depuração associada também será selecionada."
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Formulários auto. criados"
#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr "Unidade principal .lpr cria cada formulário com Application.CreateForm(). Estes são liberados automaticamente."
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "Auto-create new forms"
msgstr "Criar automaticamente novos formulários"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Auto excluir arquivos"
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Auto exibir protótipos de função"
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse pointer when typing"
msgstr "Ocultar ponteiro do \"mouse\" ao digitar"
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Auto identar"
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Configurar identação inteligente)"
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Auto identar"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Auto remover métodos vazios"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Auto renomear arquivo em minúsculas"
#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr "Auto salvar área de trabalho ativa"
#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end\n"
msgstr ""
"Salvar área de trabalho ativa ao fechar a IDE\n"
"Salvar área de trabalho de depuração ao fechar IDE e final da depuração\n"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Formulários disponíveis:"
#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr "Estes formulários devem ser criados e liberados no código do programa."
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr "Evitar saltos desnecessários"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Plano de fundo"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(sem subdiretório)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Mesmo nome (no subdiretório)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Antes de métodos"
#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Seleção"
#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr "Identação de bloco (espaços)"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Identação bloco"
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(teclas de edição)"
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Espaço/Tab. como linha anterior"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Posicionar somente"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Espaços"
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "Abas, cortar fora"
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Abas, depois espaços"
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Identação de bloco (tabs)"
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgstr "Espaço da borda pode ser definido no editor de âncoras. Uma linha vermelha é exibida se o espaçamento > 0."
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Realçar parênteses"
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket and quote pairs"
msgstr "Correspondendo a parênteses e pares de aspas"
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr "Você não pode usar área de trabalho ancorada em ambiente não ancorado e vice-versa."
#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Multi/2nd (NotXor)"
msgstr "Multi/2º (NotXor)"
#: lazarusidestrconsts.dlgcaretcolor
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret"
msgstr "Cursor Texto"
#: lazarusidestrconsts.dlgcaretforecolor
msgid "Color (NotXor)"
msgstr "Cor (NotXor)"
#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr "Cursor Texto"
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Sensível maiúsc./minúsc."
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Verificando opções do compilador"
#: lazarusidestrconsts.dlgccoorphanedfilefound
msgid "orphaned file found: %s"
msgstr "arquivo orfão encontrado: %s"
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Resultados"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Testar"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Teste: Verificando compilador ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Teste: Verificando configurações compilador ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Teste: Verificando data compilador ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Teste: Compilando um arquivo vazio ..."
#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr "Teste: Verificando unidades RTL ..."
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Teste: Verificando fontes no caminho de busca ppu fpc ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Teste: Compilando um arquivo vazio"
#: lazarusidestrconsts.dlgccousingconfigfile
msgid "using config file %s"
msgstr "usando arquivo de configuração %s"
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Ordem da Classe"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Por último"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "minúsculas"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Visualizar (Tam. máx. linha=1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Prefixo Ler"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Sufixo Armazenar"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "MAIÚSCULAS"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Prefixo Variável"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Prefixo Escrever"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Salvar como - Auto renomear arquivos Pascal em minúsculas"
#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Verificar e auto salvar arquivos"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Verificar pacotes na criação formulário"
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr "O formulário pode requerer um pacote para funcionar. Instalar tal pacote automaticamente."
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Escolha o arquivo de modelos de código (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Exibir botões de fechar no \"notebook\""
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Esquema de cores"
#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "Estilo de macros C (global)"
#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Usar sequências de caracteres Ansi"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Estilo assembler"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Mensagens"
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Verificações e afirmações"
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Comandos do compilador"
#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Estilo de operadores C (*=, +=, /= and -=)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Criar Makefile"
#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Depuração"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Caminho adicional do Depurador (nenhum):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Criação de código"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Ambos"
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Retrair"
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Ocultar"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Inverter ordem-retração no \"Popup\""
#: lazarusidestrconsts.dlgcogdb
msgid "Generate debugging info for GDB (slower / increases exe-size)"
msgstr "Gerar informações de depuração para GDB (mais lento / aumenta o tamanho do .exe)"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Usar a unidade Heaptrc (verifica vazamentos de memória)"
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Arquivos de inclusão (-Fi)"
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Info for GDB"
msgstr "Info para GDB"
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Bibliotecas (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Vinculação"
#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Opções do compilador podem ser salvas em um arquivo XML."
#: lazarusidestrconsts.dlgcolor
msgid "Color"
msgstr "Cor"
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Editar Cor)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Não modificado"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Cores"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parâmetros da linha de comando (sem nome da aplicação)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr "Máxima identação para nova linha se o prefixo for baseado no início do comentário da primeira linha comentada:"
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Limitar identação para"
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Prefixar comentários na quebra de linha"
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Comparar a linha atual"
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "Comparar texto incluindo \"*\" do símbolo \"(*\""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "Comparar a linha inteira"
#: lazarusidestrconsts.dlgcommentcontinuematchtext
msgid "Match text after token \"%s\""
msgstr "Comparar texto após o símbolo \"%s\""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
msgid "Match text including token \"%s\""
msgstr "Comparar texto incluindo o símbolo \"%s\""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Prefixar nova linha"
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Prefixo de alinhamento na identação da linha anterior"
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "Prefixo de alinhamento abaixo no ínicio do comentário na primeira linha de comentário"
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "Não prefixar a identação"
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments and Strings"
msgstr "Comentários e \"Strings\""
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend if matched or not matched"
msgstr "Estender, se coincidiu ou não"
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend if matched or not matched (not at EOL)"
msgstr "Estender, se coincidiu ou não (não no final de linha)"
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend if matched"
msgstr "Estender, se coincidiu"
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr "Estender, se coincidiu e o cursor texto estiver no meio do texto (não no final de linha)"
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Compilação e vinculação"
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Mensagens do compilador"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "Arquivo de idioma das mensagens do compilador (*.msg)"
#: lazarusidestrconsts.dlgcompileroptions
msgctxt "lazarusidestrconsts.dlgcompileroptions"
msgid "Compiler Options"
msgstr "Opções do compilador"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Completar Propriedades"
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr "Componente sobre o cursor do \"mouse\" é selecionado primeiro, para depois os comandos do menu de contexto funcionarem nele."
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Configuração e alvo"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Arquivos de configuração"
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Outras info. de depuração"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Transbordamento (Overflow)"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Análise"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Copiar/Colar com info. retração"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy current word when no selection exists"
msgstr "Copiar palavra atual quando não existir seleção"
#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Faixa"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Relocável"
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Definir opções do compilador como padrão"
#: lazarusidestrconsts.dlgcoshowerr
msgid "Show errors"
msgstr "Exibir erros"
#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "E&xibir opções"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Vinculação inteligente"
#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Outros fontes (arquivos .pp/.pas, usado somente pela IDE não pelo compilador)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Pilha (Stack)"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Remover símbolos do executável (STRIP)"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Tipo de informação de depuração"
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automático"
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf2"
msgstr "Dwarf2"
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf with sets"
msgstr "Dwarf com sets"
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf3 (beta)"
msgstr "Dwarf3 (beta)"
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Stabs"
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Variáveis lixo"
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Estilo de unidade"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Gerar código para valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Detalhes"
#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "INLINE estilo C++"
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr "Criar novas configurações dos parâmetros de execução"
#: lazarusidestrconsts.dlgctrlmiddletabcloseotherpages
msgid "Ctrl-middle-click on tab closes all others"
msgstr "Ctrl-clique-central na aba fecha todas as outras"
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Chaves { }"
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr "Atualmente respeitado pela janela de mensagens, histórico de salto e resultados de pesquisa."
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Cursor além fim de linha (EOL)"
#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr "Cursor texto esquerda/direita limpa seleção (sem movimento)"
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Caret skips selection"
msgstr "Cursor texto salta seleção"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Caret skips tabs"
msgstr "Cursor texto salta tabulações"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Extensão definida pelo usuário (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr "depuração"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Editor caminhos"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Caminho e tipo de depurador"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Fonte padrão do Editor"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Valor padrão"
#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr "Excluir modo"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Excluir modelo "
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Botões -"
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Dicas"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menus - "
#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr "Nome área de trabalho"
#: lazarusidestrconsts.dlgdesktopsexported
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr "%d área(s) de trabalho exportada(s) com sucesso para \"%s\""
#: lazarusidestrconsts.dlgdesktopsimported
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr "%d área(s) de trabalho importada(s) com sucesso de \"%s\""
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr "Plano de fundo de valores diferentes"
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Direção"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Desativar \"anti-aliasing\""
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr "Distância entre os pontos da grade é o menor espaço ao mover um controle."
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Usar cor margem direita"
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Desenhar nível divisor"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Cor linha aninhada"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Cor linha"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedimento/Função"
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Classe/Estrutura"
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Classe/Estrutura (local)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Seções unidade"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Cláusula \"Uses\""
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr "Desenhar o nome do componente abaixo dele."
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Voltar"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Negrito"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Subdiretório"
#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Modelos de código"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Adicionar instrução para fechar blocos Pascal"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Extensão definida pelo usuário"
#: lazarusidestrconsts.dlgeddelayinsec
msgid "(%s sec delay)"
msgstr "(atraso %s seg)"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Exibir"
#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Arquivos do editor"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Complemento identificador"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Inverter"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignorar bloqueios, usar editor em desuso por mais tempo"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignorar bloqueios, se o editor for o atual"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignorar bloqueios, se o editor estiver na janela atual"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Bloqueado, se o texto estiver em exibição"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Desbloqueado"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Desbloqueado, se o texto estiver em exibição centralizada"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Nova aba, existente ou nova janela"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Nova aba em nova janela"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Nova aba em janela existente"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Esta opção usará o editor em desuso por mais tempo para o arquivo, mesmo se estiver bloqueado e/ou precise de deslocamento. A determinação do editor em desuso por mais tempo não observa a ordem na qual as janelas foram focadas, mesmo que tenha sido definida pela opção \"mesma ordem de critério\". Esta opção sempre será bem sucedida, demais opções nunca serão testadas."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Esta opção irá verificar se o atual editor ativo tem o arquivo alvo e em caso positivo, irá usar o editor atual, mesmo se ele estiver bloqueado e/ou precise de deslocamento."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Esta opção irá verificar se existe um editor para o arquivo alvo na janela atual e se existir, irá usar este editor, mesmo se ele estiver bloqueado e/ou precise de deslocamento."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Esta opção irá usar um editor bloqueado (e somente um bloqueado), que não precise se deslocar a fim de mostrar o ponto se salto alvo (ponto de salto alvo já está na área visível da tela)."
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Esta opção irá usar qualquer Editor não bloqueado."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Esta opção irá usar um Editor não bloqueado, que não precise se deslocar a fim de mostrar o ponto de salto alvo (ponto de salto alvo já está na área visível da tela, excluindo 2-5 linhas superior/inferior)."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Esta opção irá abrir uma nova Aba em uma Janela existente ou nova, se nenhuma aba bloqueada for encontrada. Esta opção será sempre bem-sucedida, demais opções nunca serão testadas."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Se nenhuma aba desbloqueada for encontrada, esta opção irá abrir uma nova Aba em uma nova Janela (mesmo que outra janela existente possa ser usada para a nova aba). Esta opção será sempre bem-sucedida, demais opções nunca serão testadas."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr "Se nenhuma aba desbloqueada for encontrada, então esta opção irá abrir uma nova Aba em uma Janela existente (e somente em uma existente). Uma aba é aberta somente se a janela existir, e que ainda não tenha um editor para o arquivo alvo."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Itálico"
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Tamanho da fonte do editor"
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Opções do editor"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Esquemas globais"
#: lazarusidestrconsts.dlgedmisc
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Miscelânea"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Desligado"
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Ligado"
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Tabulação e Identação"
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Sublinhado"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Atributos elemento"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Tecla \"End\" salta para final mais próximo"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Perguntar"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Nota: Arquivos de projetos são todos os arquivos no diretório de projeto"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Cópia de segurança"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Arquivos"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Grade"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Idioma"
#: lazarusidestrconsts.dlgenvlanguagehint
msgid "Language of all IDE strings. Restart IDE after changing it for best result."
msgstr "Idioma de todas as \"strings\" da IDE. Reiniciar após alteração para melhor resultado."
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Guias de alinhamento componentes"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Miscelânea"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Nenhum"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Outros arquivos"
#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Tabulações para o projeto"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr "Mensagem focada na compilação"
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra character spacing"
msgstr "Espaço extra carac."
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Espaços extra linhas"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external gdb debug symbols file"
msgstr "Usar arquivo depuração externo gdb"
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Extensões de arquivo"
#: lazarusidestrconsts.dlgfiles
msgid "%s files"
msgstr "%s arquivos"
#: lazarusidestrconsts.dlgfilterall
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Todos os arquivos"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr "Arquivo modelo CodeTools"
#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr "Arquivo DCI"
#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr "Formulário Delphi"
#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Pacote Delphi"
#: lazarusidestrconsts.dlgfilterdelphiproject
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Projeto Delphi"
#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Unidade Delphi"
#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr "Executável"
#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr "Arquivo de mensagem FPC"
#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr "Arquivos HTML"
#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr "Imagens bitmap"
#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr "Imagens pixmap"
#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr "Imagens png"
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Configurações da Área de Trabalho do Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "Tipos arquivos Editor"
#: lazarusidestrconsts.dlgfilterlazarusfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Arquivo Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusform
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Formulário Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusinclude
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Arquivo de inclusões Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Outros arquivos Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruspackage
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Pacote Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusproject
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Projeto Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Fonte de Projeto Lazarus"
#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr "Sessão Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusunit
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Unidade Lazarus"
#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "Arquivo Pascal"
#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Programas"
#: lazarusidestrconsts.dlgfilterxml
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "Arquivos XML"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Localizar texto sob o cursor"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Fragmento"
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Seção fragmento"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Comentário"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Nó"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Item"
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Lista <>"
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Objeto (herdado, em linha)"
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Comentário (* *)"
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (aninhado)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Comentário { }"
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Classe/Objeto"
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "público/privado"
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"
#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr "For/Do"
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "If/Then/Else"
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Comentário aninhado"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procedimento)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedimento"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Programa"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Comentário //"
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unidade"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Seção unidade"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (global)"
#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr "While/Do"
#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr "With/Do"
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Comentário"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "TipoDoc"
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Nó"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Processando Instrução"
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr "Força dimensionamento DPI em tempo de projeto"
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr "Quando marcado, os ajustes de dimensionamento do projeto serão ignorados - apenas a propriedade \"Scaled\" de formulários/quadros/datamodule serão consideradas."
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr "A instância Lazarus sendo executada não aceita qualquer arquivo."
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Primeiro plano"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr "Altere conteúdo do Inspetor de Objetos clicando na barra de título do formulário"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr "Exibe propriedades de um formulário no Inspetor de Objetos clicando em sua barra de título."
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Regra inserção de procedimento"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Manter a ordem dos procedimentos"
#: lazarusidestrconsts.dlgfpcexecutable
msgid "Compiler executable (e.g. %s)"
msgstr "Executável do compilador (ex.%s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Diretório Fonte FPC"
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Marca-Texto"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Editor de Formulário"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "Do &início"
#: lazarusidestrconsts.dlgfromcursor
msgid "&From cursor"
msgstr "&Do cursor"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Global"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Gerar código para gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Cor dos esticadores"
#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr "Áreas de trabalho sombreadas são para ambientes ancorados."
#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr "Áreas de trabalho sombreadas são para ambientes não ancorados"
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Cor da Grade"
#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr "Grade consiste em pequenos pontos que ajudam a alinhar os controles."
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Tamanho X da Grade"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Espaçamento horizontal da grade"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Tamanho Y da Grade"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Espaçamento vertical da grade"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Explorador Código"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Ferramentas de código"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Depurador"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Editor"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Ambiente"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Desfazer Grupo"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Exibir Guias de Alinhamento"
#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr "Quando um controle é alinhado horizontal e verticalmente à outro, uma linha guia azul é exibida."
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Medianiz"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Retraido"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Cor da medianiz"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Cor borda medianiz"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Índice separador medianiz"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Rolar meia-página"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Tamanhos do \"Heap\" e pilha"
#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Tamanho do Heap"
#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr "Altura de uma propriedade na grade."
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Altura:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on run"
msgstr "Ocultar a janela da IDE ao executar"
#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr "Não exibir completamente a IDE quando um programa estiver executando."
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Ocultar aba de janelas em páginas únicas"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Cor de destaque"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Cor de destaque da fonte"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Caret"
msgstr "Esquerda do cursor texto"
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Caret"
msgstr "Direita do cursor texto"
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Exibir dicas para parâmetro \"Sender\" não usado"
#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Exibir dicas para unidades não utilizadas"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Tecla \"Home\" salta para ínicio mais próximo"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Aplicação servidora"
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Complemento identificador"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Regra para Identificadores"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Opções IDE"
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "Código $IFDEF ativo"
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "Código $IFDEF inativo"
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "Incluso código $IFDEF de estado misto"
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Nó $IFDEF ativo"
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Nó $IFDEF inativo"
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "Incluso nó $IFDEF de estado misto"
#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:\n"
msgstr ""
"Uma área de trabalho com o mesmo nome já existe.\n"
"Favor confirmar o nome da área de trabalho:\n"
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr "Incluir identificadores contendo prefixo"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Incluir variáveis de sistema"
#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr "Incluir palavras"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr "Não incluir"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr "de todas as unidades"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr "da unidade atual"
#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr "Identação"
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr "Tabulações"
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Na frente de métodos"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Nome do construtor precisa ser \"init\" (e o destrutor precisa ser \"done\")"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Inserir partes de classe"
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Implementation"
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Interface"
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr "Implementações do método de inserção"
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Inserir na Seção \"Uses\""
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Inserir espaço após"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Inserir espaço na frente de"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Invervalo em segundos"
#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr "Posição vertical para um salto de bloco de código em % (0=superior 100=inferior)"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Saltando (ex. Saltando Métodos)"
#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr "Posição vertical para um salto de uma linha em % (0=superior, 100=inferior)"
#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr "Saltar diretamente para o corpo do método"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep caret X position when navigating up/down"
msgstr "Manter posição X cursor texto ao navegar acima/abaixo"
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Teclas de Edição)"
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Teclas de acesso rápido"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Erros nas teclas de acesso rápido"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Regra para Palavras-Chaves"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Permitir LABEL e GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Idioma"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Por último (ex. no final do fonte)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Diretório Lazarus (padrão para todos os projetos)"
#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Linhas guia esquerda, superior"
#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly)"
msgstr "1 (rápido e amigável ao depurador)"
#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (-O1 + otimizações rápidas)"
#: lazarusidestrconsts.dlglevel3opt
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (-O2 + otimizações lentas)"
#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr "4 (-O3 + otimizações agressivas, cuidado)"
#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization)"
msgstr "0 (nenhuma otimização)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Separação de Linha"
#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Vínculo inteligente"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Exibir número de linhas nos erros de tempo de execução ao rastreá-los"
#: lazarusidestrconsts.dlgmainmenu
msgid "Main Menu"
msgstr "Menu Principal"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Exibir formulários do projeto"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Exibir bordas do projeto"
#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Exibir unidades do projeto"
#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "Executável \"Make\""
#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr "Gerenciar áreas de trabalho"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margem e medianiz"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Cor dos marcadores"
#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr "Marca vertical"
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight all occurrences of Word under Caret"
msgstr "Realçar todas as ocorrências da palavra sob o cursor texto"
#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr "Contorno"
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr "Aviso: Não há cores configuradas para a linguagem selecionada"
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Indicador definido pelo Usuário"
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Excluir"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
msgid "Delete list \"%s\"?"
msgstr "Excluir lista \"%s\"?"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term"
msgstr "Adicionar palavra ou termo"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term"
msgstr "Remover palavra ou termo"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term"
msgstr "Alternar palavra ou termo"
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Duplicar termo"
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "O termo %s já existe. Duplicatas serão removidas quando a lista for salva."
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Adicionar/Remover em todos os editores"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Excluir lista"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Nome"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Adicionar lista"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Sensível à maiúscula/minúscula"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Definir limite no final do termo"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Definir limite no início do termo"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Ignorar limites para termos maiores que"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "seleção"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "palavra atual"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Definições para termos adicionadas por chave"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "Seleção de limites de correspondência inteligente"
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Nova lista"
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "Nenhuma lista"
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Selecionar ..."
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key Settings"
msgstr "Definições chave"
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Definições principais"
#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr "Colchetes da palavra-chave no cursor texto (global)"
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match whole words, if length is less or equal to:"
msgstr "Comparar palavras inteiras, se o comprimento é menor ou igual a:"
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Ignorar palavras-chave"
#: lazarusidestrconsts.dlgmarkupwordnotimer
msgid "Disable timer for markup current word"
msgstr "Desativar cronômetro para indicador da palavra atual"
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Remover espaços (enquanto realçar seleção atual)"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Contador Máximo"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Comprimento máximo da linha:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Máximo de arquivos recentes"
#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr "Valor 0 significa ilimitado."
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Máximo de arquivos de projeto recentes"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mesclar métodos e propriedades"
#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr "Modo"
#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Ação do \"mouse\""
#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Único"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Duplo"
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Triplo"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Quádruplo"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Qualquer"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Extra 1"
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Extra 2"
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Esquerda"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Meio"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Retroceder"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Direita"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Roda abaixo"
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Roda acima"
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Capturar"
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Mover Cursor Texto (extra)"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Atuar no Mouse acima"
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Clique"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Editar Mouse"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Entrada Duplicada"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Esta entrada conflita com uma entrada existente"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Botão"
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr "Cursor Texto"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Contexto"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Clique"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Acima/Abaixo"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Opção"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Odernação"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Prioridade"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Mouse"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Avançado"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Comando IDE"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Y"
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Tudo"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Medianiz"
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr "Alterações linha"
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Árvore retrátil"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Retraído [+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Expandido [-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr "Visão geral"
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr "Marca visão geral"
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Números de linha"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Texto"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Seleção"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Opt"
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Outras ações usando o mesmo botão"
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Eles podem ser executados dependendo das teclas modificadoras, configurações \"Falltrough\", Simples/Duplo, Acima/Abaixo ..."
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtro Teclas-Mod."
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Prioridade"
#: lazarusidestrconsts.dlgmsgs
msgctxt "lazarusidestrconsts.dlgmsgs"
msgid "Messages"
msgstr "Mensagens"
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Depuração"
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Erro"
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr "Fatal"
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "Dica"
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr "Importante"
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr "Normal"
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr "Nota"
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr "Pânico"
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr "Tempo e estatísticas"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr "Detalhar"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr "Detalhar 2"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr "Detalhar 3"
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Aviso"
#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr "Teclas de navegação movem todos os cursores texto (seleção-coluna)"
#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr "Salta tecla de exclusão em final de linha (não junta linhas)"
#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr "Múltiplos cursores texto"
#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr "Teclas de navegação movimentam todos os cursores texto"
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr "Habilitar múltiplos cursores texto para seleção coluna"
#: lazarusidestrconsts.dlgmultipleinstances
msgid "Multiple Lazarus instances"
msgstr "Múltiplas instâncias Lazarus"
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr "sempre iniciar uma nova instância"
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr "não permitir múltiplas instâncias"
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr "abrir arquivos em uma instância sendo executada"
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Seleção múltipla"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Jump target priority between multiple editors"
msgstr "Prioridade do alvo do salto entre múltiplos editores"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Ordem à usar para editores correspondentes ao mesmo critério"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Mais recente editor focado para este arquivo"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Editor (para arquivo) na mais recente janela focada"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Lista de critérios prioritária para escolher um editor:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Páginas e Janelas"
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Abas \"Notebook\""
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Nomeação"
#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr "Nova área de trabalho ..."
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Sem renomeação automática"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Nenhuma unidade disponível à adicionar."
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Sem realce"
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Posição abas \"notebook\" fonte"
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Não dividir a linha após"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Não dividir linha na frente de"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inspetor de Objetos"
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height (0 = auto)"
msgstr "Altura do Item (0 = auto)"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Miscelânea"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Configurações rápidas"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Usar configurações Delphi padrão"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Usar configurações Lazarus padrão"
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Níveis de otimização"
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Outras otimizações"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Outros arquivos de unidade (-Fu):"
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Sobrescrever bloco"
#: lazarusidestrconsts.dlgoverwritedesktop
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?\n"
msgstr ""
"Área de trabalho com o nome \"%s\" encontrada.\n"
"Devo sobrescrever a área de trabalho antiga?\n"
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Dicas para a paleta de componentes"
#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Extensão Pascal padrão"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Realçar declarações de controle como palavras-chave"
#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr "Opções de palavras-chave Pascal Estendido"
#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr "Indicador (no cursor texto)"
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Palavras chave correspondentes"
#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr "Contorno"
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Enviar opções ao vinculador com \"-k\", espaço é o delimitador"
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr "Realçar palavra(s)-chave \"String\""
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Padrão"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Nenhum"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Apenas \"String\""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Bloco persistente"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Visible caret in unfocused editor"
msgstr "Cursor texto visível em editor fora de foco"
#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr "Cursor texto em editor fora de foco não pisca"
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Aplicação"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "chamador \"as\" (asInvoker)"
#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "&Limpar ícone"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Criar aplicação inclusa"
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Carregar &padrão"
#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr "A par do DPI"
#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr "desligado"
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr "Vista-8: desligado, 8.1+: por monitor"
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr "Vista-8: ligado, 8.1+: por monitor"
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr "Vista-8: ligado, 8.1/10+: por monitor/V2"
#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr "ligado"
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Nível de execução"
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Formulários"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "mais alto disponível (highestAvailable)"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Ícone:"
#: lazarusidestrconsts.dlgpoicondesc
msgid "(size: %d:%d, bpp: %d)"
msgstr "(tamanho: %d:%d, bpp: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(nenhum)"
#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "&Carregar ícone"
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Miscelânea"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "requer administrador (requireAdministrator)"
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Recursos"
#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "&Salvar ícone"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Sessão"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Título:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "Acesso IU (uiAccess)"
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr "Usar aplicação inclusa para execução e depuração (somente Darwin)"
#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr "Usar escalonamento LCL (DPI-Alto)"
#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest resource (and enable themes)"
msgstr "Usar recurso de manifesto (e habilitar temas)"
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Preferir duplo-clique sobre clique-único"
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Prioridades"
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Projeto"
#: lazarusidestrconsts.dlgprojectoptions
msgid "Project Options"
msgstr "Opções de projeto"
#: lazarusidestrconsts.dlgprojectoptionsfor
msgid "Options for Project: %s"
msgstr "Opções do Projeto: %s"
#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Arquivos do Projeto"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "&Perguntar antes de substituir"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Complemento propriedade"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Nome da propriedade"
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project and packages at start"
msgstr "Abrir o último projeto e pacotes ao iniciar"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Exibir espaçamento da borda"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Exibir grade"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Ajustar à grade"
#: lazarusidestrconsts.dlgreallydeletedesktop
msgid "Really delete desktop \"%s\"?"
msgstr "Excluir realmente a área de trabalho \"%s\"?"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Referência"
#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "E&xpressões regulares"
#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr "Renomear área de trabalho"
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Substituir &Tudo"
#: lazarusidestrconsts.dlgreplacewith
msgid "Replace wit&h"
msgstr "S&ubstituir com"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Relatório"
#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Linhas guia direita, inferior"
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Clique direito seleciona"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Margem Direita"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Diretório de trabalho"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Selecionar controle pai e seus filhos"
#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Criação Banda elástica"
#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Seleção Banda elástica"
#: lazarusidestrconsts.dlgrunninginstancemodalerror
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s\n"
msgstr ""
"A instância Lazarus sendo executada não aceita qualquer arquivo.\n"
"Deseja abrí-los em uma nova instância da IDE?\n"
"\n"
"%s\n"
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr "Instância Lazarus está executando mas não responde."
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Tela (não para win32, ex: 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Ambiente"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Local"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variáveis de sistema"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Usar tela"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Sobreposições de usuário"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Parâmetros de execução"
#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr "Salvar área de trabalho atual como"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Linha salva"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Salvar informações do editor para arquivos fechados"
#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr "Os arquivos estão disponíveis na lista histórica \"Abrir recente\""
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Salvar informações do editor somente para arquivos de projeto"
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr "Apenas arquivos que pertençam a este projeto."
#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr "Salvar em"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Rolar por um à menos"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Rolagem"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Exibir dicas de rolagem"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Rolar para o final do arquivo"
#: lazarusidestrconsts.dlgscrollpastendline
msgid "Allow caret to move past end of line"
msgstr "Permitir movimento cursor texto além do final de linha"
#: lazarusidestrconsts.dlgseachdirectorynotfound
msgid "Search directory \"%s\" not found."
msgstr "Diretório de busca \"%s\" não encontrado."
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Procura terminada pelo usuário."
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Procurando ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Caminhos"
#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr "Escopo localização"
#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr "Selecionar todos os controles filhos juntamente com seus pais."
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "Texto &selecionado"
#: lazarusidestrconsts.dlgsetactivedesktop
msgid "Set active"
msgstr "Ativar"
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Redefinir para o padrão"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Definir elemento para padrão"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Variável da propriedade \"Set\""
#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr "O nome do parâmetro para o procedimento configurador padrão."
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr "é prefixo"
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr "Se marcado, a \"Variável da propriedade Set\" é um prefixo. Do contrário é um nome fixo."
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr "usar const"
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr "Se marcado, o parâmetro configurador é marcado com \"const\"."
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Exibir todas as unidades"
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of nonvisual components"
msgstr "Exibir títulos dos componentes não visuais"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Exibir procedimentos compilados"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Exibir números de linha"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Exibir condicionais"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Exibir informações de depuração"
#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Exibir dicas de desenho"
#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr "Dica exibe a posição ou tamanho dos controles ao mover ou redimensioná-los."
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Exibir tudo"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Exibir info. executável (só Win32)"
#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr "Exibir nome de arquivo no título"
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Exibir informações gerais"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Exibir dicas medianiz"
#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Exibir dicas"
#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr "Janelas exibidas"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Exibir número de linhas"
#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr "Exibir ícones de mensagem"
#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Exibir notas"
#: lazarusidestrconsts.dlgshowsummary
msgid "Show summary"
msgstr "Exibir sumário"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Exibir arquivos provados"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Exibir arquivos usados"
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Exibir avisos"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Exibir um único botão na Barra de Tarefas"
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Ignonar declarações de classe situadas à frente"
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Barras //"
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Abas inteligentes"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Símbolo no final (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Contador (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Símbolo na frente (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Ajustar às Guias de Alinhamento"
#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr "Quando um controle está perto de alinhar à outro, ele encaixa na posição alinhada."
#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr "Abas multilinha"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Espaço"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Dicas para botões principais (abrir, salvar, ...)"
#: lazarusidestrconsts.dlgsrcedit
msgctxt "lazarusidestrconsts.dlgsrcedit"
msgid "Source Editor"
msgstr "Editor de Código"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Origem"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Tamanho da pilha"
#: lazarusidestrconsts.dlgstatickeyword
msgid "Static keyword in objects"
msgstr "Palavra-chave estática nos objetos"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Parar após números de erros:"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Acrescentar texto à string próxima"
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Prefixar string em nova linha"
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "String ''"
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Estender strings na quebra de linha"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Sub propriedades"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Opções de sintaxe"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "Tabulações identam blocos"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Exibir números abas no \"notebook\""
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulações para espaços"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Largura tabulações"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Família CPU alvo"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "SO alvo"
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Plataforma alvo"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Processador alvo"
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Opções específicas do alvo"
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Diretório para criação de projetos de teste"
#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr "Estilo-texto"
#: lazarusidestrconsts.dlgtexttofind
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "&Text to find"
msgstr "&Texto a localizar"
#: lazarusidestrconsts.dlgtoggledebugdesktop
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktop"
msgid "Toggle as debug desktop"
msgstr "Alternar como área de trabalho de depuração"
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Dica Classe/Proc atual"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Estilo de remoção de espaços"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Marca ou edição"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Linha editada"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Deixar linha"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Somente posicionar"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Eliminar espaços no final"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Desfazer após salvar"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Desfazer / Refazer"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limite Desfazer"
#: lazarusidestrconsts.dlgunitdepcaption
msgctxt "lazarusidestrconsts.dlgunitdepcaption"
msgid "Unit Dependencies"
msgstr "Dependências da unidade"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Atualizar"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Diretório de saída das unidades (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Linha não salva"
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Retração código"
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Usar arquivo adicional de configurações do compilador"
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Desenho do divisor"
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Usar arquivo padrão de configuração do compilador (fpc.cfg)"
#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr "Ícones na caixa de complemento de código"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Usar inicialização de aplicação"
#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr "IME manipulado pelo sistema"
#: lazarusidestrconsts.dlguserschemeerror
msgid "Failed to load user-scheme file %s"
msgstr "Falhou ao carregar esquema do usuário do arquivo %s"
#: lazarusidestrconsts.dlguseschemedefaults
msgid "Use (and edit) global scheme settings"
msgstr "Usar (e editar) o esquema global de configurações"
#: lazarusidestrconsts.dlguseschemelocal
msgid "Use local scheme settings"
msgstr "Usar esquema configuração local"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Usar realce de sintaxe"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Usar aba histórico quando fechando abas"
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Adicionar unidade à seção \"Uses\""
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Valor"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Detalhes durante a compilação:"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Medianiz visível"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Margem direita visível"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "&Somente palavras completas"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Largura:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Aplicação gráfica win32"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Janela"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Exceções"
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Palavras"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Visualizar"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "Escrever logotipo FPC"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Componentes multi-selecionados deverm estar num formulário único."
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Alinhamento ..."
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Excluir seleção"
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Espelho horizontal"
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Espelho vertical"
#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "Um atrás"
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "Um à frente"
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Mover para trás"
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Mover para frente"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Redefinir ..."
#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Salvar formulário como XML"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Escala ..."
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Escala"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Selecionar Tudo"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Tamanho ..."
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Tamanho"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Opção: Ajustar à grade"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Opção: Ajustar para linhas guias"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Ordem-Z"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Em ambos os lados"
#: lazarusidestrconsts.histdlgbtnclearhint
msgid "Clear all snapshots"
msgstr "Limpar todos instantâneos"
#: lazarusidestrconsts.histdlgbtnenablehint
msgid "Toggle view snapshot or current"
msgstr "Alternar exibição do instantâneo ou atual"
#: lazarusidestrconsts.histdlgbtnmakesnaphint
msgid "Take Snapshot"
msgstr "Tirar um instantâneo"
#: lazarusidestrconsts.histdlgbtnpowerhint
msgid "Switch on/off automatic snapshots"
msgstr "Ativar ou desativar instantâneos automáticos"
#: lazarusidestrconsts.histdlgbtnremovehint
msgid "Remove selected entry"
msgstr "Remover a entrada selecionada"
#: lazarusidestrconsts.histdlgbtnshowhisthint
msgid "View history"
msgstr "Exibir histórico"
#: lazarusidestrconsts.histdlgbtnshowsnaphint
msgid "View Snapshots"
msgstr "Exibir Instantâneos"
#: lazarusidestrconsts.histdlgcolumnloc
msgctxt "lazarusidestrconsts.histdlgcolumnloc"
msgid "Location"
msgstr "Local"
#: lazarusidestrconsts.histdlgcolumntime
msgid "Time"
msgstr "Hora"
#: lazarusidestrconsts.histdlgformname
msgctxt "lazarusidestrconsts.histdlgformname"
msgid "History"
msgstr "Histórico"
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = não, 1 = desenha linhas divisórias apenas para níveis altos, 2 = desenha linhas primeiros dois níveis, ..."
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Adicionar Arquivos"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Tipo Ancestral ambíguo"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nome da Classe ambíguo"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nome da Unidade Ambíguo"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor type"
msgstr "Tipo ancestral"
#: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Uma unidade Pascal deve ter extensão .pp ou .pas"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dependências Quebradas"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Nome da Classe já existe"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Criar novo componente"
#: lazarusidestrconsts.lisa2pcreatenewfile
msgid "Create New File"
msgstr "Criar novo arquivo"
#: lazarusidestrconsts.lisa2pcreatenewreq
msgid "Create New Requirement"
msgstr "Criar novo requerimento"
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dependência"
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr "Diretório para arquivo de unidade:"
#: lazarusidestrconsts.lisa2pexistingfile2
msgid "Existing file: \"%s\""
msgstr "Arquivo existente: \"%s\""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Arquivo já existe"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
msgid "File \"%s\" already exists in the package."
msgstr "Arquivo \"%s\" já existe no pacote."
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Arquivo está em uso"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename/URL"
msgstr "Nome do Arquivo/URL"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Arquivo nao é uma unidade"
#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr "Ícone 24x24:"
#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr "Ícone 36x36:"
#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr "Ícone 48x48:"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Tipo Ancestral inválido"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Dependência circular inválida"
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nome da Classe inválido"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Arquivo inválido"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nome de Arquivo Inválido"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nome de unidade inválido"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" não é um nome de unidade válido."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Novo nome de classe:"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Novo Arquivo"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Pacote não encontrado para a dependência \"%s\".%sFavor escolher um pacote existente."
#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr "Pacote/Projeto"
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nome da Página muito longo"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette page:"
msgstr "Página da paleta:"
#: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas
msgid "Pascal units must have the extension .pp or .pas"
msgstr "Unidades Pascal devem ter extensão .pp ou .pas"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Encolher ou expandir nome de arquivo"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Exibir tudo"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "O tipo ancestral \"%s\" tem o mesmo nome que%sa unidade \"%s\"."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "O tipo ancestral \"%s\" não é um identificador Pascal válido."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "O nome da classe \"%s\" e tipo ancestral \"%s\" são os mesmos."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "O nome da classe \"%s\" já existe no %sPacote %s%sArquivo: \"%s\""
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "O nome da classe \"%s\" tem o mesmo nome %sa unidade \"%s\"."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "O nome da classe \"%s\" não é um identificador Pascal válido."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "O arquivo \"%s\" faz parte do projeto atual.%sNão é uma boa ideia compartilhar arquivos entre projetos e pacotes."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "O nome de arquivo \"%s\" é ambíguo, porque o pacote ainda não tem diretório padrão.%sFavor especificar um nome de arquivo com caminho completo."
#: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "A Versão Máxima \"%s\" é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "A Versão Máxima é menor que a Versão Mínima."
#: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor
msgctxt "lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "A Versão Mínima \"%s\" é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
msgid "The package already has a dependency on the package \"%s\"."
msgstr "O pacote já tem uma dependência para o pacote \"%s\"."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "O nome da página \"%s\" é muito longo (max 100 caracteres)."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "O nome da unidade \"%s\" já existe no pacote:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
msgid "The unitname \"%s\" already exists in this package."
msgstr "O nome da unidade \"%s\" já existe neste pacote."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "O nome da unidade \"%s\"%se nome do arquivo \"%s\" diferem."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "O nome da unidade \"%s\" é o mesmo de um componente registrado.%sUsá-lo pode causar estranhas mensagens de erro."
#: lazarusidestrconsts.lisa2punitname
msgid "Unit name:"
msgstr "Nome da unidade:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Nome da unidade já existe"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Abandonar alterações?"
#: lazarusidestrconsts.lisabort
msgctxt "lazarusidestrconsts.lisabort"
msgid "Abort"
msgstr "Abortar"
#: lazarusidestrconsts.lisabortall
msgid "Abort all"
msgstr "Abortar tudo"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Abortar todo o carregamento"
#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Abortado"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Abortar carregamento do projeto"
#: lazarusidestrconsts.lisabortwholeloading
msgid "Abort whole loading"
msgstr "Abortar carregamento por completo"
#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "Sobre"
#: lazarusidestrconsts.lisabout2
msgid "About %s"
msgstr "Sobre %s"
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Documentação:"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Sobre IDE"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Sobre o Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgstr "Licença: GPL/LGPL. Veja os fontes Lazarus e Free Pascal para detalhes da licença.%sLazarus é uma IDE para criar aplicações gráficas e console com o Free Pascal. Free Pascal é um compilador Pascal e Object Pascal que roda em Windows, Linux, Mac OS X, FreeBSD e mais.%sLazarus é a peça que falta do quebra-cabeças que irá permitir a você desenvolver programas para todas as plataformas citadas em um ambiente semelhante ao Delphi. A IDE é uma ferramenta RAD que inclui um editor de formulários.%sNa medida que o Lazarus evolui nós precisamos de mais desenvolvedores."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Impossível encontrar a lista de colaboradores."
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Oficial:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "Um %s não pode conter TControls.%sVocê somente pode colocar componentes não-visuais nele."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Agradecimentos"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Ação:"
#: lazarusidestrconsts.lisactions
msgid "Actions:"
msgstr "Ações:"
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Ativar"
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Ativar a sintaxe de expressões regulares para texto e substituição (bem parecido com perl)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Ativar selecionado"
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Ativo"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Filtro Ativo"
#: lazarusidestrconsts.lisadd
msgctxt "lazarusidestrconsts.lisadd"
msgid "Add"
msgstr "Adicionar"
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr "Adicionar um novo separador acima do item selecionado"
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr "Adicionar um novo separador abaixo do item selecionado"
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Adicionar definições simulando Delphi7"
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Útil quando o código tiver verificações para as versões de compilador suportadas"
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
msgid "Added missing object \"%s\" to pascal source."
msgstr "Objeto perdido \"%s\" adicionado ao fonte pascal."
#: lazarusidestrconsts.lisaddedpropertysfors
msgid "Added property \"%s\" for %s."
msgstr "Propriedade \"%s\" adicionada para %s."
#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr "Adicionar -FcUTF8"
#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr "Pode ser necessário se os arquivos fonte tiverem literais string não ansi"
#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Adicionar Filtro ..."
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr "Adição não se encaixa na mensagem atual"
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr "Adição se encaixa na mensagem atual"
#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr "Adições"
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "Adicionar palavra-chave \"do\""
#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr "Adicionar modificador \"overload\""
#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr "Adicionar modificador \"override\""
#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr "Adicionar modificador \"reintroduce\""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Adiciona novo modo de construção, copiando configuração de \"%s\""
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Adicionar nova macro"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Adicionar novo conjunto"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Adicionar requisito pacote?"
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "adicionar pacote(s) à lista de pacotes instalados (combinar com --build-ide para reconstruir a IDE)."
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Adicionar pacote ao projeto"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Adicionar parênteses parâmetros"
#: lazarusidestrconsts.lisaddress
msgid "Address:"
msgstr "Endereço:"
#: lazarusidestrconsts.lisaddressbreakpoint
msgctxt "lazarusidestrconsts.lisaddressbreakpoint"
msgid "&Address Breakpoint ..."
msgstr "&Endereço do Ponto de Parada ..."
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Adicionar ao caminho de pesquisa de inclusões?"
#: lazarusidestrconsts.lisaddtoproject
msgid "Add %s to project?"
msgstr "Adicionar %s ao projeto?"
#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr "Adicionar aos componentes de inicialização?"
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Adicionar ao caminho de pesquisa de unidade?"
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Adicionar interfaces unidade"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Adicionar unidade (não recomendado)"
#: lazarusidestrconsts.lisaddvaluetomacro
msgid "Add value to macro %s"
msgstr "Adicionar valor para macro %s"
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Adicionar arquivo ao pacote"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Pacote de destino"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Tipo de arquivo"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Pacote Inválido"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
msgid "Invalid package ID: \"%s\""
msgstr "ID de Pacote inválida: \"%s\""
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Pacote é somente leitura"
#: lazarusidestrconsts.lisaf2ppackagenotfound
msgid "Package \"%s\" not found."
msgstr "Pacote \"%s\" não encontrado."
#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Exibir tudo"
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
msgid "The package %s is read only."
msgstr "O Pacote %s é somente leitura."
#: lazarusidestrconsts.lisafilealreadyexistsreplaceit
msgid "A file \"%s\" already exists.%sReplace it?"
msgstr "Um arquivo \"%s\" já existe.%sSubstituí-lo?"
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
msgid "A filter with the name \"%s\" already exists."
msgstr "Um filtro com o nome \"%s\" já existe."
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Após limpeza (limpar tudo ou limpar arquivos comuns), mudar para limpar automaticamente"
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Alinhamento"
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Todos os blocos parecem OK."
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Todos os modes de construção>"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Todas opções herdadas"
#: lazarusidestrconsts.lisalloptions
msgid "All Options"
msgstr "Todas as opções"
#: lazarusidestrconsts.lisallowfunctio
msgid "Allow Function Calls"
msgstr "Permitir Chamadas de Funções"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Permitir busca por múltiplas linhas"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Todos os parâmetros desta função já foram definidos nesta chamada. Nada a adicionar."
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "Todas as modificações para \"%s\"%sserão perdidas e o arquivo reaberto."
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Alpha"
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Tecla alternativa"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Tecla alternativa (ou sequência de 2 teclas)"
#: lazarusidestrconsts.lisalways
msgid "Always"
msgstr "Sempre"
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Sempre converter nome de arquivo padrão sugerido para minúsculas"
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "Sempre desenhar itens selecionados focados"
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Sempre ignorar"
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Uma macro com este nome já existe."
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Arquivo ambíguo encontrado"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Arquivo ambíguo encontrado: \"%s\"%sEste arquivo pode ser confundido com \"%s\"%sExcluir o arquivo ambíguo?"
#: lazarusidestrconsts.lisambiguousfilesfound
msgid "Ambiguous files found"
msgstr "Arquivos ambíguos encontrados"
#: lazarusidestrconsts.lisambiguousunitfound
msgid "Ambiguous unit found"
msgstr "Unidade ambígua encontrada"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
"Ancorar lado inferior ao lado superior do irmão.\n"
"Usar \"espaço da borda\" para definir a distância.\n"
"Espaçamento da borda do irmão é ignorado.\n"
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
"Ancorar lado inferior ao lado superior do irmão.\n"
"A distância mantida é definida por ambas as propriedades \"espaço da borda\" deste e do irmão.\n"
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Editor de âncora - nenhum controle selecionado"
#: lazarusidestrconsts.lisanchorenabledhint
msgid "Enabled = Include %s in Anchors"
msgstr "Ativo = Incluir %s nas Âncoras"
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
"Ancorar lado esquerdo ao lado esquerdo do irmão.\n"
"Usar \"espaço da borda\" para definir a distância.\n"
"Espaçamento da borda do irmão é ignorado.\n"
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
"Ancorar lado esquerdo ao lado direito do irmão.\n"
"A distância mantida é definida por ambas as propriedades \"espaço da borda\" deste e do irmão.\n"
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
"Ancorar lado direito ao lado esquerdo do irmão.\n"
"A distância mantida é definida por ambas as propriedades \"espaço da borda\" deste e do irmão.\n"
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
"Ancorar lado direito ao lado direito do irmão.\n"
"Usar \"espaço da borda\" para definir a distância.\n"
"Espaçamento da borda do irmão é ignorado.\n"
#: lazarusidestrconsts.lisanchorsof
msgid "Anchors of %s"
msgstr "Ãncoras de %s"
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Âncora dos controles selecionados"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr ""
"Ancorar lado superior ao lado inferior do irmão.\n"
"A distância mantida é definida por ambas as propriedades \"espaço da borda\" deste e do irmão.\n"
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr ""
"Ancorar lado superior ao lado superior do irmão.\n"
"Usar \"espaço da borda\" para definir a distância.\n"
"Espaçamento da borda do irmão é ignorado.\n"
#: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "Ocorreu um erro na última inicialização carregando %s!%sCarregar este projeto novamente?"
#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr "Aparência"
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Nome de classe da &Aplicação"
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Uma aplicação gráfica Free Pascal usando a biblioteca LCL cross-platform como sua GUI."
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Aplicar"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "apply build flags (-B) to dependencies too"
msgstr "Aplicar \"flags\" de contrução (-B) também para as dependências"
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Aplicar convenções"
#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr "Ajustar nome de extensão e caixa dos caracteres para a plataforma e tipo de arquivo."
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Uma unidade projeto não pode ser usada por outros pacotes/projetos"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr ""
"Espaço da borda em torno do controle.\n"
"Os outros quatro espaços da borda serão adicionados a esse valor.\n"
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Perguntar antes de substituir cada texto encontrado"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Perguntar antes de salvar a sessão do projeto"
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr "Perguntar pelo nome componente após colocá-lo num formulário"
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Perguntar nome de arquivo no comando 'novo arquivo' "
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Perguntar nome ao criar"
#: lazarusidestrconsts.lisausefulsettingonwindowssystemsislazarusdirmingwbin
msgid "A useful setting on Windows systems is: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
msgstr "Uma configuração útil em sistemas Windows é: $(LazarusDir)\\mingw\\bin\\$(TargetCPU)-$(TargetOS)\\gdb.exe"
#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr "Ajustar automaticamente a altura da janela principal da IDE"
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr "Exibir paleta de componentes completa"
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr "Se a paleta de componentes abranger mais linhas, mostre todas e não apenas uma."
#: lazarusidestrconsts.lisautocheckmodifiedfiles
msgid "Automatically check (select) modified files"
msgstr "Verificar (selecionar) automaticamente arquivos modificados"
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Auto completar: desligado"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Auto completar: ligado"
#: lazarusidestrconsts.lisautocontinueafter
msgid "Auto continue after:"
msgstr "Continuar autom. após:"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Indicadores e Correspondências"
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automático"
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Automatizada"
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr "Converte automaticamente arquivos .lfm em arquivos de recurso .lrs"
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "não completar a seleção"
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Auto invocar após ponto"
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "quebra de linha"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "espaço"
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "tab"
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "final palavra"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "não adicionar caractere"
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr "Usar automaticamente identificador único possível"
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Complementos e Dicas"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Auto exibir"
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Disponível para instalação"
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes:"
msgstr "Modos de construção de projeto disponíveis:"
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Fazer cópia de segurança dos arquivos modificados"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Arquivo cópia de segurança falhou"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Cria um diretório de cópia de segurança sob o diretório do projeto"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Alterar o nome ou versão do pacote quebra dependências. Essas dependências devem ser alteradas também?%sSelecionar Sim para alterar todas as dependências listadas.%sSelecionar Ignorar para quebrar as dependências e continuar."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "começa"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Relacionado anteriormente"
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "be less verbose, can be given multiple times"
msgstr "ser menos detalhado, pode ser dado múltiplas vezes"
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "be more verbose, can be given multiple times"
msgstr "ser mais detalhado, pode ser dado múltiplas vezes"
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "Melhor visualizado instalando um controle HTML como \"turbopowerprodsgn\""
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Sempre construir antes de executar"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Comando de construção"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Ao invés de construir o projeto, rodar o comando construir arquivo"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Ao invés de executar o projeto, rodar o comando executar arquivo"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Comando Executar"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Quando este arquivo estiver ativo no editor de código"
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Diretório de trabalho (deixar vazio para caminho de arquivo)"
#: lazarusidestrconsts.lisbinary
msgctxt "lazarusidestrconsts.lisbinary"
msgid "Binary"
msgstr "Binário"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Valores não padrão em negrito"
#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Espaço da borda"
#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Inferior"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr ""
"Espaço da borda inferior.\n"
"Este valor será adicionado ao espaço da borda base e\n"
"usado para o espaço abaixo do controle.\n"
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Ancoragem inferior"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Inferiores"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr ""
"Este é o controle irmão ao qual o lado inferior está ancorado.\n"
"Deixar vazio para ancorar ao pai no estilo Delphi (Espaçamento da borda e lado de referência não importam).\n"
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Justificar espaço inferior"
#: lazarusidestrconsts.lisbpsdisabled
msgctxt "lazarusidestrconsts.lisbpsdisabled"
msgid "Disabled"
msgstr "Desativado"
#: lazarusidestrconsts.lisbpsenabled
msgctxt "lazarusidestrconsts.lisbpsenabled"
msgid "Enabled"
msgstr "Ativo"
#: lazarusidestrconsts.lisbreak
msgctxt "lazarusidestrconsts.lisbreak"
msgid "Break"
msgstr "Interromper"
#: lazarusidestrconsts.lisbreakpointproperties
msgid "Breakpoint Properties"
msgstr "Propriedades Pontos de Paradas"
#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr "Navegar e selecionar um compilador (ex. ppcx64)"
#: lazarusidestrconsts.lisbtnadd
msgctxt "lazarusidestrconsts.lisbtnadd"
msgid "&Add"
msgstr "&Adicionar"
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Fechar"
#: lazarusidestrconsts.lisbtndelete
msgctxt "lazarusidestrconsts.lisbtndelete"
msgid "&Delete"
msgstr "&Excluir"
#: lazarusidestrconsts.lisbtndlgadd
msgid "&Add ..."
msgstr "&Adicionar ..."
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Substituir ..."
#: lazarusidestrconsts.lisbtnenabled
msgctxt "lazarusidestrconsts.lisbtnenabled"
msgid "&Enabled"
msgstr "&Ativo"
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Localizar"
#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "&Sair"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Remover"
#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr "&Renomear"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Substituir"
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Construir"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "build all files of project/package/IDE"
msgstr "construir todos arquivos do projeto/pacote/IDE"
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Construir"
#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "Construir a IDE"
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "build IDE with packages"
msgstr "construir IDE com pacotes"
#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr "Construindo"
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Construção Lazarus falhou"
#: lazarusidestrconsts.lisbuildmode
msgid "Build Mode: %s"
msgstr "Modo construção: %s"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Diferenças entre modos de construção"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Diferenças de outros modos de construção"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Modo:"
#: lazarusidestrconsts.lisbuildmodeintitleinexample
msgid "Title in taskbar shows for example: project1.lpi - Release - Lazarus"
msgstr "Título na barra de tarefas exibe por exemplo: project1.lpi - Lançamento - Lazarus"
#: lazarusidestrconsts.lisbuildmodes
msgid "Build modes"
msgstr "Modos de construção"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Construir novo projeto"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Número da construção"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Construir"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Ocupado"
#: lazarusidestrconsts.lisbyte
msgid "%s byte"
msgstr "%s byte"
#: lazarusidestrconsts.liscallingtocreatemakefilefromfailed
msgid "Calling %s to create Makefile from %s failed."
msgstr "Chamando %s para criar \"Makefile\" de %s falhou."
#: lazarusidestrconsts.liscallstacknotevaluated
msgid "Stack not evaluated"
msgstr "Pilha não avaliada"
#: lazarusidestrconsts.liscancel
msgctxt "lazarusidestrconsts.liscancel"
msgid "Cancel"
msgstr "Cancelar"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Cancelar carregamento deste componente"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Cancelar carregamento de Unidade"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Cancelar renomeação"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Impossível compilar projeto"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Impossível copiar o componente de nível superior."
#: lazarusidestrconsts.liscannotcreatefile
msgid "Cannot create file \"%s\""
msgstr "Impossível criar o arquivo \"%s\""
#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr "Impossível excluir último modo."
#: lazarusidestrconsts.liscannotexecute
msgid "cannot execute \"%s\""
msgstr "impossível executar \"%s\""
#: lazarusidestrconsts.liscannotfind
msgid "Cannot find %s"
msgstr "Impossível localizar %s"
#: lazarusidestrconsts.liscannotfindexecutable
msgid "cannot find executable \"%s\""
msgstr "impossível localizar executável \"%s\""
#: lazarusidestrconsts.liscannotfindlazarusstarter
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Impossível localizar o iniciador do Lazarus:%s%s"
#: lazarusidestrconsts.liscannotfindunit
msgid "Cannot find unit %s"
msgstr "Impossível localizar a unidade %s"
#: lazarusidestrconsts.liscannotopenform
msgid "Cannot open form \"%s\"."
msgstr "Impossível abrir o formulário \"%s\"."
#: lazarusidestrconsts.liscannotsaveform
msgid "Cannot save form \"%s\"."
msgstr "Impossível salvar o formulário \"%s\"."
#: lazarusidestrconsts.liscannotsubstitutemacros
msgid "Cannot substitute macro \"%s\"."
msgstr "Impossível substituir a macro \"%s\"."
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "Impossível testar o compilador enquanto estiver compilando ou depurando."
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Somente pode ser alterada a classe de TComponents."
#: lazarusidestrconsts.liscantfindavalidppu
msgid "Can't find a valid %s.ppu"
msgstr "Impossível localizar um %s.ppu válido"
#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "Compare arquivos (não para criar patches)"
#: lazarusidestrconsts.liscbpfiles
msgid "%s (%s files)"
msgstr "%s (%s arquivos)"
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
msgid "Really delete %s source files%s%s"
msgstr "Realmente excluir %s arquivos fontes%s%s"
#: lazarusidestrconsts.lisccdchangeclassof
msgid "Change Class of %s"
msgstr "Alterar Classe de %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "sem classe"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Compilador ambíguo"
#: lazarusidestrconsts.lisccochecktestdir
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Favor verificar o diretório Teste em %sFerramentas -> Opções -> Arquivos -> Diretório para criação de projetos de teste"
#: lazarusidestrconsts.lisccocompilernotanexe
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "O compilador \"%s\" não é um arquivo executável.%sDetalhes: %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "contém"
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Copiar saída para Área de Transferência"
#: lazarusidestrconsts.lisccodatesdiffer
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "As datas dos arquivos .ppu do FPC diferem em mais de uma hora.%sIsto pode significar que eles são de duas instalações diferentes.%sArquivo1: %s%sArquivo2: %s"
#: lazarusidestrconsts.lisccoerrorcaption
msgctxt "lazarusidestrconsts.lisccoerrorcaption"
msgid "Error"
msgstr "Erro"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ERRO: "
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Caminho de unidade FPC contém um fonte:"
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "Símbolos de nova linha"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "DICA: "
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Compilador inválido"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Caminho de busca inválido"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Diretório de teste inválido"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Unidade faltando"
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
msgid "RTL unit not found: %s"
msgstr "Unidade RTL não encontrada: %s"
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "Configurações múltiplas do compilador encontradas:"
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "\"fpc.cfg\" não encontrado"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "não é ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
msgid "ppu exists twice: %s, %s"
msgstr "ppu duplicado: %s, %s"
#: lazarusidestrconsts.lisccoppuolderthancompiler
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Há um arquivo .ppu mais antigo que o próprio compilador:%s%s"
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr "A unidade RTL %s não foi encontrada.%sIsto tipicamente significa que sua %s têm caminhos de unidade erradas. Ou sua instalação está danificada."
#: lazarusidestrconsts.lisccoseveralcompilers
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Há vários compiladores Free Pascal no caminho. %s%s%sTalvez você tenha esquecido de excluir um compilador antigo?"
#: lazarusidestrconsts.lisccoskip
msgid "Skip"
msgstr "Pular"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "caracteres especiais"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Sucesso em todos os testes"
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Incapaz de criar arquivo teste"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Incapaz de criar arquivo de teste Pascal \"%s\"."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "caracteres não usuais"
#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Aviso"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "AVISO: "
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "delimitador de caminho incorreto"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Categorias"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Complexidade"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Constantes"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Blocos vazios"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Seções de classe vazias"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Construções vazias"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Procedimentos vazios"
#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(Filtro)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Seguir cursor"
#: lazarusidestrconsts.liscein
msgid "%s in %s"
msgstr "%s no %s"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "É um controle raiz"
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "Núm. parâmetros tratados como \"muitos\""
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Procedimentos longos"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Núm. linhas de procedimentos tratados como \"longo\""
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Muitos procedimentos aninhados"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Muitos parâmetros"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Exibir Categorias"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Exibir Nós Fonte"
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "Núm. procedimentos aninhados tratados como \"muitos\""
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Centralizar uma janela perdida"
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr ""
"Centralizar controle horizontalmente em relação ao controle-irmão especificado.\n"
"Espaçamento da borda é ignorado.\n"
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr ""
"Centralizar controle verticalmente em relação ao controle-irmão especificado.\n"
"Espaçamento da borda é ignorado.\n"
#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Centralizar formulário"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centralizar na janela"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Centros"
#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Modo preferido de exibição"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Categoria"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Fonte"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Nunca, apenas manualmente"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Somente usado no modo categoria"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Quando ocioso"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Atualizar automaticamente"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Outros"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Atualizar"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Quando alternar arquivo no editor fonte"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procedimentos"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Propriedades"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Propriedades publicadas sem padrão"
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Exibir observações sobre"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Estilo"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Circundante"
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Para Fazer (ToDos)"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Tipos"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Constantes sem nome"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Membros sem classificação"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Visibilidade sem classificação"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "\"Uses\""
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Variáveis"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Identação incorreta"
#: lazarusidestrconsts.liscfeanexceptionoccuredduringdeletionof
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "Uma exceção ocorreu durante exclusão de %s\"%s%s\"%s%s"
#: lazarusidestrconsts.liscfecancelloadingthisresource
msgid "Cancel loading this resource"
msgstr "Cancelar carregamento deste recurso"
#: lazarusidestrconsts.liscfeclassnotfound
msgid "%s%sClass \"%s\" not found."
msgstr "%s%sClasse \"%s\" não encontrada."
#: lazarusidestrconsts.liscfecomponent
msgid "%s%sComponent: %s:%s"
msgstr "%s%sComponente: %s:%s"
#: lazarusidestrconsts.liscfecomponentclass
msgid "%s%sComponent Class: %s"
msgstr "%s%sClasse Componente: %s"
#: lazarusidestrconsts.liscfecontinueloading
msgid "Continue loading"
msgstr "Continuar carregando"
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Não sei como copiar esta seleção em edição no formulário"
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Não sei como recortar esta seleção em edição no formulário"
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Não sei como excluir esta seleção em edição no formulário"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Erro ao criar componente"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
msgid "Error creating component: %s%s%s"
msgstr "Erro ao criar componente: %s%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Erro ao destruir componente"
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Erro ao destruir componente do tipo %s da unidade %s:%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Erro ao destruir mediador"
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Erro ao destruir mediador %s da unidade %s:%s%s"
#: lazarusidestrconsts.liscfeerrorreading
msgid "Error reading %s"
msgstr "Erro ao ler %s"
#: lazarusidestrconsts.liscfeinfile
msgid "In file %s"
msgstr "No arquivo %s"
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Proprietário do componente inválido"
#: lazarusidestrconsts.liscferoot
msgid "%sRoot=%s:%s"
msgstr "%sRaiz=%s:%s"
#: lazarusidestrconsts.liscfestopallloading
msgid "Stop all loading"
msgstr "Parar todo o carregamento"
#: lazarusidestrconsts.liscfestream
msgid "%sStream=%s"
msgstr "%sFluxo=%s"
#: lazarusidestrconsts.liscfestreamposition
msgid "%s%sStream position: %s"
msgstr "%s%sPosição fluxo: %s"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm já existe"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Tipo desconhecido %s"
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent Onde está o TCustomNonFormDesignerForm? %s"
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator já registrado: %s"
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "O editor do componente da classe \"%s\" criou o erro:%s\"%s\""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "O componente do tipo %s falhou ao definir seu proprietário para %s:%s"
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
msgid "Unable to clear the form editing selection%s%s"
msgstr "Incapaz de limpar a seleção em edição no formulário %s%s"
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Alterar"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Alterar modo construção"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Alterar Classe"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "Alterado %s coord de %s desde \"%d\" para \"%d\" dentro de %s."
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Alterar codificação"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Alterar arquivo"
#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Alterar controle-pai"
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Alterações não foram salvas"
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Alterar para / Unix"
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Alterar para \\ Windows"
#: lazarusidestrconsts.lischaracter
msgid "Character"
msgstr "Caracter"
#: lazarusidestrconsts.lischaractermap
msgid "Character Map"
msgstr "Mapa de Caracteres"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Verificar tudo"
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Verificar por alterações de arquivo em disco via conteúdo ao invés do horário"
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ". Verificar se o pacote %s cria %s.ppu, se nada exclui este arquivo e que outros dois pacotes não tenham acesso ao fonte da unidade."
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ". Verificar se o pacote %s está nas dependências"
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "Verificar se o próximo símbolo (token) no código é um fim e se não retorna fimlinha + fim; + fimlinha"
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Opções verificação"
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ". Verificar caminho de busca do pacote %s, tentar reconstrução limpa, verificar implementação das seções \"uses\"."
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr "Verificar o próximo símbolo (token) no fonte e adicionar ponto-e-vírgula se necessário."
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Verificar o alvo (OS, CPU, Tipo \"widget\" LCL). Talvez você tenha que recompilar o pacote para este alvo ou definir outro alvo para o projeto."
#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr "Marcar/desmarcar tudo"
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Escolha um nome diferente"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "Escolha um arquivo com modelo CodeTools"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Escolha um vínculo \"FPDOC\""
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Escolha uma tecla ..."
#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr "Escolha um nome para o componente"
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Escolha um arquivo exemplo"
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Escolha um arquivo de mensagens FPC"
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Escolha um arquivo Pascal para exemplos de identação"
#: lazarusidestrconsts.lischoosecompilerexecutable
msgid "Choose compiler executable (%s)"
msgstr "Escolha o executável do compilador (%s)"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Escolha o arquivo de mensagens do compilador"
#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Escolha o executável do depurador"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Escolha o pacote Delphi (*.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Escolha o projeto Delphi (*.dpr)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Escolha a unidade Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Escolha o diretório"
#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr "Escolha um executável"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Escolha o diretório fonte FPC"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Escolha o diretório do Lazarus"
#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "Escolha o executável \"make\""
#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr "Escolha nome e texto"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Escolha um desses items para criar um novo Arquivo"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Escolha um desses items para criar um novo Pacote"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Escolha um desses items para criar um novo projeto"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Escolha um desses itens para herdar de outro já existente"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Escolher fonte do programa (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Escolha a estrutura para circundar a seleção"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Escolha o diretório para testes"
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Dependência circular detectada"
#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr "&Classe"
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Complemento Classe"
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Classes e propriedades existem. Valores não foram verificados."
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "Classe \"%s\" não é uma classe de componente registrado.%sIncapaz de colar."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Classe não encontrada"
#: lazarusidestrconsts.lisclassnotfoundat
msgid "Class %s not found at %s(%s,%s)"
msgstr "Classe %s não encontrada na %s(%s,%s)"
#: lazarusidestrconsts.lisclassofmethodnotfound
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "Classe \"%s\" do método \"%s\" não encontrada."
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Limpar"
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Limpar Diretório"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Limpar subdiretórios"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Manter todos os arquivos de texto"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Manter arquivos correspondendo ao filtro"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Remover arquivo correspondendo ao filtro"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Sintaxe Simples (ex: * em vez de .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Limpar tudo"
#: lazarusidestrconsts.liscleancommonfiles
msgid "Clean common files"
msgstr "Limpar arquivos comuns"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Limpar o Fonte do Lazarus (Clean)"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Mudar após construção para automatizada"
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Limpeza"
#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Limpar e construir"
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Limpar e construir projeto"
#: lazarusidestrconsts.liscleanuppackage
msgid "Clean up package \"%s\"."
msgstr "Limpar pacote \"%s\"."
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Limpar caminho da unidade?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Limpar"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Limpar Diretório?"
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Limpar o filtro para opções"
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Clique aqui para navegar nos arquivos"
#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr "Clique para ver escolhas"
#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr "Clique para selecionar página da paleta"
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Clonar"
#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Fechar"
#: lazarusidestrconsts.liscloseall
msgctxt "lazarusidestrconsts.liscloseall"
msgid "Close All"
msgstr "Fechar tudo"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Fechar todos marcados"
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Fechar arquivos"
#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Ocultar janela"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Fechando uma Janela Editor Fonte. Deseja fechar todos os arquivos ou ocultar a janela?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Fechar Janela Editor Fonte"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Opções especificas da Interface LCL"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Parâmetro"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Componentes"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Herança"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Lista"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Paleta"
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Páginas"
#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr "Paleta é &visível"
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "&Restaurar padrões"
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Arquivo adicional de configuração do compilador ambíguo"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Chamar em:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sClique OK se você definitivamente quer fazer isso."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Comando:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Código"
#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Navegador de código"
#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr "Opções de criação de código"
#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr "Seção da classe"
#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Localização"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Opções geração de código"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Adicionar caminho"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Navegar"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Confirmar substituição"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Criar item ajuda"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Remover caminho"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Descrição"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Erros"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Exemplo"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "Ajustes FPDoc"
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Inserir \"tag\" formatação em negrito"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Inserir \"tag\" de formatação de código"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Inserir \"tag\" de formatação itálico"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Inserir \"tag\" de comentário da formatação"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Inserir \"tag\" de formatação de sublinhado"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Inserir \"tag\" de formatação de variável"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Herança"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Inserir um vínculo ..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Inserir \"tag\" de formatação de parágrafo"
#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(nenhuma descrição de herança encontrada)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<NENHUM>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Veja também"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Descrição curta de"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Curto"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Ignorar constantes nas próximas funções"
#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Localizar constantes de caracteres não nomeadas"
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Observador de Código"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Ignorar próximas constantes não nomeadas"
#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Adicionar modelo"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Adicionar Modelo de Código"
#: lazarusidestrconsts.liscodetemplatokenalreadyexists
msgid " A token \"%s\" already exists! "
msgstr "Um símbolo \"%s\" já existe!"
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Auto completar em"
#: lazarusidestrconsts.liscodetemplchange
msgctxt "lazarusidestrconsts.liscodetemplchange"
msgid "Change"
msgstr "Alterar"
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Comentário:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Editar Modelo de Código"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Erro"
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Símbolo:"
#: lazarusidestrconsts.liscodetoolsdefsaction
msgid "Action: %s"
msgstr "Ação: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Nós auto-criados não podem ser editados,%snem podem possuir nós filhos não auto-criados."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
msgid "%s, auto generated"
msgstr "%s, auto gerado"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "Nós auto-criados não podem ser editados."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Bloco"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Editor de definições das Ferramentas de Código"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Caminho do compilador"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Converter nó"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
msgid "Create Defines for %s Directory"
msgstr "Criar definições para diretório %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Criar definições para o compilador Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal SVN Sources"
msgstr "Criar definições para os fontes SVN do Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
msgid "Create Defines for %s Project"
msgstr "Criar definições para o projeto %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Criar macros FPC e caminhos para um diretório de projeto FPC"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Definir"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Definir Recursão"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Excluir nó"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sPor exemplo: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sque são usados por este %s projeto.%sPor exemplo: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Descrição:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
msgid "%s directory"
msgstr "Diretório %s"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "\"Else\""
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "\"ElseIf\""
#: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave
msgid "Exit without Save"
msgstr "Sair sem Salvar"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC SVN source directory"
msgstr "Diretório SVN do fonte FPC"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "\"If\""
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "\"IfDef\""
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "\"IfNDef\""
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Diretório"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Inserir modelo de compilador Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Inserir modelo de diretório Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Inserir modelo de projeto Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Inserir modelo de compilador Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Inserir modelo de diretório Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Inserir modelo de projeto Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Inserir modelo de compilador Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Inserir modelo de diretório Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Inserir modelo de projeto Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Inserir modelo de compilador Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Inserir modelo de projeto Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal SVN Source Template"
msgstr "Inserir modelo de Fonte SVN Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Inserir modelo de compilador Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Inserir modelo de diretório Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Inserir modelo de projeto Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Inserir nó como filho"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Inserir nó abaixo"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Inserir Modelo"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Controle-Pai Inválido"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Nó do Controle-Pai inválido"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Nó anterior inválido"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sPor exemplo: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "O %s diretório principal,%sonde Borland instalou todos %s fontes.%sque são usados por este %s projeto.%sPor exemplo: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Mover nó abaixo"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Mover nó um nível abaixo"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Move nó um nível acima"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Mover nó acima"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Novo nó"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Nó somente leitura"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Nenhum selecionado"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "Nó do controle-pai não pode conter nós filhos."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Nó anterior não pode conter filhos."
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Diretório do projeto"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
msgid "%s project directory"
msgstr "Diretório do projeto %s"
#: lazarusidestrconsts.liscodetoolsdefsreaderror
msgid "Read error"
msgstr "Erro de Leitura"
#: lazarusidestrconsts.liscodetoolsdefssaveandexit
msgid "Save and Exit"
msgstr "Salvar e Sair"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Nó selecionado:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgstr "O diretório SVN do fonte Free Pascal. Não requerido. Isto irá aprimorar a procura de declaração e depuração."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "O diretório de projeto Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal SVN source directory."
msgstr "O diretório SVN do fonte Free Pascal."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "O caminho para compilador Free Pascal.%s Por exemplo %s/usr/bin/%s -n%s ou %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgstr "O caminho para o compilador Free Pascal deste projeto. Requerido apenas se você definir o fonte SVN do FPC abaixo. Usado para auto-criar macros."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "O caminho do compilador Free Pascal para este fonte.%sUsado para autocriar macros."
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "O diretório de projeto %s, %sque contém os arquivos .dpr, .dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Indefinir"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Indefinir Tudo"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Indefinir Recursão"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Valor como Caminho Arquivos"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Valor como Texto"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%svalor \"%s\" inválido."
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variável:"
#: lazarusidestrconsts.liscodetoolsdefswriteerror
msgid "Write error"
msgstr "Erro de Escrita"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Arroba"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Parentêse"
#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr "Circunflexo (^)"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Dois Pontos"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Vírgula"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identificador"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Palavra-Chave"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nova linha"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Nenhum"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Número"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Ponto"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Ponto e vírgula"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Espaço"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Const. \"String\""
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Símbolo"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Executar após"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Executar antes"
#: lazarusidestrconsts.liscoladdress
msgid "Address"
msgstr "Endereço"
#: lazarusidestrconsts.liscolclass
msgid "Class"
msgstr "Classe"
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All (/)"
msgstr "Retrair tudo (/)"
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Retrair todas as classes"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Retrair todos os pacotes"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Retrair todas as unidades"
#: lazarusidestrconsts.liscolreturns
msgid "Returns"
msgstr "Retorna"
#: lazarusidestrconsts.liscolvisibility
msgid "Visibility"
msgstr "Visibilidade"
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Parâmetros da linha de comando"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Parâmetros de linha de comando do programa"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Compilar"
#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr "Compilar os seguintes modos"
#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Compilar projeto"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compilador"
#: lazarusidestrconsts.liscompilercfgismissing
msgid "%s is missing."
msgstr "%s está faltando."
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Compilador \"%s\" não suporta o alvo %s-%s"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
msgid "Error: invalid compiler: %s"
msgstr "Erro: compilador inválido: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nome de arquivo do compilador"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Dica: Você pode definir o caminho do compilador em Ferramentas -> Opções -> Arquivos -> Caminho do Compilador"
#: lazarusidestrconsts.liscompilermessagesfilenotfound
msgid "Compiler messages file not found:%s%s"
msgstr "Arquivo de mensagens do compilador não encontrado:%s%s"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "NOTA: Arquivo de configuração das Ferramentas de Código não encontrado - usando padrão"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "NOTA: carregando arquivo antigo de configurações das Ferramentas de Código"
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Compilar"
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "Compilar com -vd para mais detalhes. Verificar por duplicações."
#: lazarusidestrconsts.liscompiling
msgid "%s (compiling ...)"
msgstr "%s (compilando ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Exibir dicas longas"
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Estender à extrema esquerda"
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Estender pouco à esquerda"
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Nunca"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Estender apenas à direita"
#: lazarusidestrconsts.liscomponentnameisapascalkeyword
msgid "Component name \"%s\" is a Pascal keyword."
msgstr "Nome componente \"%s\" é uma palavra-chave Pascal."
#: lazarusidestrconsts.liscomponentnameiskeyword
msgid "Component name \"%s\" is keyword"
msgstr "Nome de componente \"%s\" é uma palavra-chave"
#: lazarusidestrconsts.liscomponentnameisnotavalididentifier
msgid "Component name \"%s\" is not a valid identifier"
msgstr "Nome de componente \"%s\" não é um identificador válido"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Exibir tudo"
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Abrir pacote"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Abrir unidade"
#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr "Compactar"
#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr "O diretório resultante será compactado em um arquivo ZIP."
#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Testar"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Condição"
#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Condicionais"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Diretório de configuração do Lazarus"
#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr "Arquivo de configurações de adições:"
#: lazarusidestrconsts.lisconfigurebuild
msgid "Configure Build %s"
msgstr "Configurar Construir %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Configurar \"Construção Lazarus\""
#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr "Configurar barra de ferramentas"
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Configurar IDE Lazarus"
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Confirmar"
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Confirmação"
#: lazarusidestrconsts.lisconfirmbuildallprofiles
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus será reconstruído com o seguinte perfil:%sContinuar?"
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Confirmar alterações"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Confirmar exclusão"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Você deseja reconstruir o Lazarus com o perfil: %s?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Confirmar novo conjunto pacote para a IDE"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Novo conjunto pacote"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Antigo conjunto pacote"
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Conflito"
#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Conflito detetado"
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Aplicação console"
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Um programa de linha de comando Free Pascal usando TCustomApplication para facilmente verificar as opções de linha de comando, tratamento de exceções, etc."
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Código do construtor"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "contém"
#: lazarusidestrconsts.liscontents
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Conteúdo"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Sensível ao contexto"
#: lazarusidestrconsts.liscontinue
msgctxt "lazarusidestrconsts.liscontinue"
msgid "Continue"
msgstr "Continuar"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Continuar e não perguntar mais"
#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr "Continuar a construção"
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Continuar sem carregar o formulário"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Colaboradores"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Controle precisa de um controle-pai"
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Adicionar comentário após substituição"
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr "Adicionado \"MODE\" modificador de sintaxe Delphi após o nome da unidade."
#: lazarusidestrconsts.lisconvaddingflagforregister
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr "Adicionar flag para o procedimento \"Register\" na unidade %s."
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
msgid "\")\" is missing from replacement function: %s"
msgstr "\")\" está faltando na função substituta: %s"
#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr "Colchete não encontrado"
#: lazarusidestrconsts.lisconvconvertedfrom
msgid " { *Converted from %s* }"
msgstr " { *Convertido de %s* }"
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Um deslocamento é adicionado à coordenada \"superior\" dos controles dentro de contâineres visuais"
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Deslocamentos de coordenadas"
#: lazarusidestrconsts.lisconvdeletedfile
msgid "Deleted file %s"
msgstr "Arquivo excluído %s"
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
msgid "Added defines %s in custom options"
msgstr "Adicionada definições %s nas opções customizadas"
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
msgid "Added Package %s as a dependency."
msgstr "Adicionado pacote %s como uma dependência."
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
msgid "Added unit \"%s\" to uses section."
msgstr "Adicionada unidade \"%s\" à seção \"uses\""
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Todos os subdiretórios serão escaneados por arquivos unidades"
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "\"BeginCodeTools\" falhou!"
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Categorias:"
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
msgid "Changed encoding from %s to UTF-8"
msgstr "Codificação alterada de %s para UTF-8"
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Conversão abortada."
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Conversão Pronta."
#: lazarusidestrconsts.lisconvdelphiconversiontook
msgid "Conversion took: %s"
msgstr "A conversão levou: %s"
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Converter pacote Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Converter projeto Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Converter unidade Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Arquivos de unidade sendo convertidos foram encontrados durante a conversão ***"
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** Arquivos de unidade sendo convertidos pertencentes ao projeto/pacote ***"
#: lazarusidestrconsts.lisconvdelphierror
msgid "Error=\"%s\""
msgstr "Erro=\"%s\""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "Exceção ocorreu durante a conversão da unidade. Continuando com arquivos de formulários das unidades já convertidas..."
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Falha ao converter unidade"
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
msgid "Failed to convert unit \"%s\""
msgstr "Falha ao converter unidade \"%s\""
#: lazarusidestrconsts.lisconvdelphifixedunitcase
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Corrigido maiúsculas/minúsculas da unidade \"%s\" para \"%s\"."
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Todos os arquivos de unidade encontrados"
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Função Delphi"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) arquivo inclusão faltando"
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Nome Delphi"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Nome do pacote já existe"
#: lazarusidestrconsts.lisconvdelphipackagerequired
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "Pacote %s é requerido mas não está instalado no Lazarus! Instalar posteriormente."
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
msgid "Omitted unit %s from project"
msgstr "Unidade %s omitida do projeto"
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
msgid "Removed unit \"%s\" from uses section."
msgstr "Unidade \"%s\" removida da seção \"uses\""
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Corriginfo unidades usadas e reparando arquivos de formulários ***"
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Unidade \"%s\" substituída com \"%s\" na seção \"uses\"."
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Já existe um pacote com o nome \"%s\"%sFavor fechar este pacote primeiro."
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "Nomde de unidade existente na LCL"
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
msgid "Units to replace in %s"
msgstr "Unidades à substituir em %s"
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "LCL já possui uma unidade com o nome %s. Excluir arquivo local %s?"
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr "arquivo .dproj ainda não suportado. O arquivo é usado pelo Delphi 2007e superiores. Favor selecionar um arquivo .dpr para projetos ou .dpk para pacotes."
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Erro de conversão"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Converter"
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Converter codificação"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Converter codificação do projeto/pacotes"
#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr "Outras opções afetando a conversão"
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Converter projeto ou pacote"
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Alvo"
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Cross-platform"
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Cross-platform versus apenas-Windows"
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Conversor adiciona compilação condicional para suportar alvos diferentes"
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Usar o mesmo arquivo de formulário DFM"
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Mesmo arquivo DFM para Lazarus e Delphi ao invés de copiá-lo para LFM"
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Suporte Delphi"
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Usar compilação condicional para suportar Delphi"
#: lazarusidestrconsts.lisconvfixedunitname
msgid "Fixed unit name from %s to %s."
msgstr "Nome de unidade corrigido de %s para %s."
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Substituições de funções"
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Algumas funções Delphi podem ser substituídas por funções LCL"
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Funções / procedimentos à substituir"
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Deslocamento esquerda"
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Novo Nome"
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Contâiner Pai"
#: lazarusidestrconsts.lisconvproblemsfindingallunits
msgid "Problems when trying to find all units from project file %s"
msgstr "Problemas ao tentar localiza todas as unidades do arquivo de projeto %s"
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
msgid "Problems when fixing include files in file %s"
msgstr "Problemas ao corrigir arquivos de inclusão no arquivo %s"
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
msgid "Problems when repairing form file %s"
msgstr "Problemas ao reparar o arquivo do formulário %s"
#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr "Reparando arquivos de inclusão :"
#: lazarusidestrconsts.lisconvreplacedcall
msgid "Replaced call %s with %s"
msgstr "Chamada %s substituída com %s"
#: lazarusidestrconsts.lisconvreplfuncparameternum
msgid "Replacement function parameter number should be >= 1: %s"
msgstr "Número do parâmetro da função de substituição deve ser >= 1: %s"
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
msgid "\"$\" should be followed by a number: %s"
msgstr "\"$\" deve ser seguido por um número: %s"
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr "Parado porque já existe um pacote com o mesmo nome"
#: lazarusidestrconsts.lisconvthislogwassaved
msgid "This log was saved to %s"
msgstr "Este registro foi salvo para %s"
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Deslocamento Topo"
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Substituições de tipos"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Tipos desconhecidos no arquivo de formulário (DFM/LFM)"
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Tipos à substituir"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Substituições de Unidades"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Nomes de unidades na seção \"uses\" de uma unidade fonte"
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Unidades à substituir"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Propriedades desconhecidas"
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
msgid "User selected to end conversion with file %s"
msgstr "Usuário selecionou encerrar a conversão do arquivo %s"
#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr "Adicionar/Configurar/Excluir Barra(s) de Ferramenta(s)"
#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr "Adicionar divisor"
#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr "Adicionar item selecionado à barra de ferramentas"
#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr "Comandos disponíveis"
#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr "Estilo da borda da barra de ferramentas"
#: lazarusidestrconsts.liscoolbarborderstyleitem0
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Nenhum"
#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Único"
#: lazarusidestrconsts.liscoolbarcodeexplorer
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Explorador de Código"
#: lazarusidestrconsts.liscoolbarcodetemplates
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Modelos de código"
#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr "&Configurar"
#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr "Tem certeza que quer excluir a barra de ferramentas selecionada?"
#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr "Deve haver ao menos uma barra de ferramentas!"
#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr "Editor formulário"
#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr "Configurações gerais \"Coolbar\""
#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr "Estilo da garra da barra de ferramentas"
#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr "Simples"
#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Duplo"
#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr "Linhas Horiz."
#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr "Linhas Vert."
#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr "Pinça"
#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Botão"
#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr "Largura da garra"
#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr "Menu Principal IDE"
#: lazarusidestrconsts.liscoolbarmessages
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Mensagens"
#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr "Mover item selecionado barra de ferramentas para baixo"
#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr "Mover item selecionado barra de ferramentas para cima"
#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr "IDE CoolBar"
#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr "Editor Pacotes"
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr "Arquivos Editor Pacote"
#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr "Remover item selecionado da barra de ferramentas"
#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr "Restaurar padrão"
#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr "Favor selecionar primeiro uma barra de ferramentas!"
#: lazarusidestrconsts.liscoolbarsourceeditor
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Editor de Código"
#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr "Aba do fonte"
#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr "Comandos barra de ferramentas"
#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr "Coolbar está &visível"
#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr "Largura Coolbar"
#: lazarusidestrconsts.liscopy
msgctxt "lazarusidestrconsts.liscopy"
msgid "Copy"
msgstr "Copiar"
#: lazarusidestrconsts.liscopyall
msgid "Copy All"
msgstr "Copiar Tudo"
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Copiar todos os items para a área de transf."
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Copiar Tudo/Mensagens originais para área transferência"
#: lazarusidestrconsts.liscopyalloutputclipboard
msgid "Copy all output to clipboard"
msgstr "Copiar toda saída para área transferência"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Copiar todas as mensagens exibidas para a área de transferência"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Copiar descrição para área transferência"
#: lazarusidestrconsts.liscopyerror
msgid "Copy Error"
msgstr "Erro na cópia"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Erro na cópia"
#: lazarusidestrconsts.liscopyfilename
msgid "Copy Filename %s"
msgstr "Copiar nome arquivo %s"
#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Copia nome arquivo para área de transferência"
#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr "Falha ao copiar arquivos"
#: lazarusidestrconsts.liscopyidentifier
msgid "Copy \"%s\" to clipboard"
msgstr "Copiar \"%s\" para área transferência"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Cópiar um formulário inteiro não está implementado."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Copiar item para a área de transferência"
#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Copiar/Mover arquivo para diretório"
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Copiar itens selecionados para a área de transf."
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Copiar mensagens selecionadas para a área de transferência"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Localizar mensagens FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Localizar mensagens Make"
#: lazarusidestrconsts.liscoscanformessages
msgid "Scan for messages:"
msgstr "Localizar mensagens:"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Ignorar chamadas do compilador"
#: lazarusidestrconsts.liscouldnotadditomainsource
msgid "Could not add \"{$I %s}\" to main source!"
msgstr "Não pode adicionar \"{$I %s}\" ao fonte principal!"
#: lazarusidestrconsts.liscouldnotaddrtomainsource
msgid "Could not add \"{$R %s}\" to main source!"
msgstr "Não pode adicionar \"{$R %s}\" ao fonte principal!"
#: lazarusidestrconsts.liscouldnotaddtomainsource
msgid "Could not add \"%s\" to main source!"
msgstr "Não pode adicionar \"%s\" ao fonte principal!"
#: lazarusidestrconsts.liscouldnotremovefrommainsource
msgid "Could not remove \"%s\" from main source!"
msgstr "Não pode remover \"%s\" do fonte principal!"
#: lazarusidestrconsts.liscouldnotremoveifrommainsource
msgid "Could not remove \"{$I %s}\" from main source!"
msgstr "Não pode remover \"{$I %s}\" do fonte principal!"
#: lazarusidestrconsts.liscouldnotremoverfrommainsource
msgid "Could not remove \"{$R %s}\" from main source!"
msgstr "Não pode remover \"{$R %s}\" do fonte principal!"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Aviso: O arquivo adicional de configuração de compilador tem o mesmo nome de um dos arquivos de configuração padrão que o compilador Free Pascal está buscando. Isto pode resultar SOMENTE na análise da configuração adicional, ignorando a configuração padrão."
#: lazarusidestrconsts.liscpopenpackage
msgid "Open Package %s"
msgstr "Abrir pacote %s"
#: lazarusidestrconsts.liscpopenunit
msgid "Open Unit %s"
msgstr "Abrir unidade %s"
#: lazarusidestrconsts.liscpu
msgid ", CPU: %s"
msgstr ", CPU: %s"
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Crie um projeto primeiro!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Criar modos depuração e lançamento"
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Criar diretório?"
#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Criar filtro"
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Criar função"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Criar nó Ajuda"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Criá-lo"
#: lazarusidestrconsts.liscreatelocalvariable
msgid "Create local variable \"%s\""
msgstr "Criar variável local \"%s\""
#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr "Criar nova adição"
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Criar novo pacote)"
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Criar novo componente pacote"
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Criar projeto"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Criar/atualizar arquivo .po ao salvar o arquivo lfm"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
msgid "Creating file index of FPC sources %s ..."
msgstr "Criando índice arquivos fontes FPC %s ..."
#: lazarusidestrconsts.liscsbottom
msgctxt "lazarusidestrconsts.liscsbottom"
msgid "Bottom"
msgstr "Base"
#: lazarusidestrconsts.liscstop
msgctxt "lazarusidestrconsts.liscstop"
msgid "Top"
msgstr "Topo"
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Escolha o diretório"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Valores do diretório das Ferramentas de Código"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Modelos definições"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<nenhuma variável selecionada>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Abrir Visualização"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Ferramentas"
#: lazarusidestrconsts.lisctdefvariable
msgid "Variable: %s"
msgstr "Variável: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nome da Variável"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Modelos"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Atualizar todas as assinaturas de métodos"
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Atualizar múltiplas assinaturas de procedimentos"
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "favor selecionar uma macro"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Selecionar Código de Macro"
#: lazarusidestrconsts.liscurrent
msgctxt "lazarusidestrconsts.liscurrent"
msgid "Current"
msgstr "Atual"
#: lazarusidestrconsts.liscurrentlclwidgetset
msgid "Current LCL widgetset: \"%s\""
msgstr "Widgetset LCL atual: \"%s\""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Estado atual:"
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Coluna do cursor no editor atual"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Linha do cursor no editor atual"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Estas opções são passadas ao compilador após a substituição de macros."
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "Opções personalizadas"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Opções personalizadas"
#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr "Opções personalizadas"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Programa personalizado"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Um programa Free Pascal customizado."
#: lazarusidestrconsts.liscut
msgctxt "lazarusidestrconsts.liscut"
msgid "Cut"
msgstr "Recortar"
#: lazarusidestrconsts.lisdadattach
msgid "Attach"
msgstr "Anexar"
#: lazarusidestrconsts.lisdadimagename
msgid "Image Name"
msgstr "Nome imagem"
#: lazarusidestrconsts.lisdadpid
msgid "PID"
msgstr "PID"
#: lazarusidestrconsts.lisdadrunningprocesses
msgid "Running Processes"
msgstr "Processos executando"
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Data Module"
#: lazarusidestrconsts.lisdate
msgid "Date"
msgstr "Data"
#: lazarusidestrconsts.lisdbgallitemdelete
msgctxt "lazarusidestrconsts.lisdbgallitemdelete"
msgid "Delete all"
msgstr "Excluir tudo"
#: lazarusidestrconsts.lisdbgallitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgallitemdeletehint"
msgid "Delete all"
msgstr "Excluir tudo"
#: lazarusidestrconsts.lisdbgallitemdisable
msgctxt "lazarusidestrconsts.lisdbgallitemdisable"
msgid "Disable all"
msgstr "Desativar tudo"
#: lazarusidestrconsts.lisdbgallitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgallitemdisablehint"
msgid "Disable all"
msgstr "Desativar tudo"
#: lazarusidestrconsts.lisdbgallitemenable
msgctxt "lazarusidestrconsts.lisdbgallitemenable"
msgid "Enable all"
msgstr "Ativar tudo"
#: lazarusidestrconsts.lisdbgallitemenablehint
msgctxt "lazarusidestrconsts.lisdbgallitemenablehint"
msgid "Enable all"
msgstr "Ativar tudo"
#: lazarusidestrconsts.lisdbgasmcopytoclipboard
msgid "Copy to Clipboard"
msgstr "Copiar para a área de transferência"
#: lazarusidestrconsts.lisdbgbreakpointpropertieshint
msgctxt "lazarusidestrconsts.lisdbgbreakpointpropertieshint"
msgid "Breakpoint Properties ..."
msgstr "Propriedades dos Pontos de Parada ..."
#: lazarusidestrconsts.lisdbgemexpression
msgid "&Expression:"
msgstr "&Expressão:"
#: lazarusidestrconsts.lisdbgemnewvalue
msgid "&New value:"
msgstr "&Novo valor:"
#: lazarusidestrconsts.lisdbgemresult
msgid "&Result:"
msgstr "&Resultado:"
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Avaliação no Ponto de Parada"
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Acerto no Ponto de Parada"
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Mensagem no Ponto de Parada"
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Despejo da Pilha no Ponto de Parada"
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Cor Padrão"
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Exceção Elevada"
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Carregamento de Módulo"
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Descarregamento de Módulo"
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "\"String\" de Saída de Depuração"
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Término de Processo"
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Início de Processo"
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Término de \"Thread\""
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Início de \"Thread\""
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Mensagem Windows Postada"
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Mensagem Windows Enviada"
#: lazarusidestrconsts.lisdbgitemdeletehint
msgctxt "lazarusidestrconsts.lisdbgitemdeletehint"
msgid "Delete"
msgstr "Excluir"
#: lazarusidestrconsts.lisdbgitemdisable
msgctxt "lazarusidestrconsts.lisdbgitemdisable"
msgid "Disable"
msgstr "Desativar"
#: lazarusidestrconsts.lisdbgitemdisablehint
msgctxt "lazarusidestrconsts.lisdbgitemdisablehint"
msgid "Disable"
msgstr "Desativar"
#: lazarusidestrconsts.lisdbgitemenable
msgctxt "lazarusidestrconsts.lisdbgitemenable"
msgid "Enable"
msgstr "Ativar"
#: lazarusidestrconsts.lisdbgitemenablehint
msgctxt "lazarusidestrconsts.lisdbgitemenablehint"
msgid "Enable"
msgstr "Ativar"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nenhum depurador especificado"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Definir ponto de parada assim mesmo"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Não há um depurador especificado.%sDefinir pontos de parada não tem efeito até que você configure um Depurador, no diálogo de opções de depurador, no menu."
#: lazarusidestrconsts.lisdbgterminal
msgctxt "lazarusidestrconsts.lisdbgterminal"
msgid "Console In/Output"
msgstr "Entrada/Saída Console"
#: lazarusidestrconsts.lisdbgwinpower
msgid "On/Off"
msgstr "Ligar/Desligar"
#: lazarusidestrconsts.lisdbgwinpowerhint
msgid "Disable/Enable updates for the entire window"
msgstr "Desativar/Ativar atualizações para toda a janela"
#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Depuração"
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Depurador"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgstr "Erro do Depurador%sOoops, o depurador entrou em uma condição de erro%sSalve seu trabalho agora !%sClique Parar e espere pelo melhor, estamos puxando a tomada."
#: lazarusidestrconsts.lisdebuggerfeedbackerror
msgid "Debugger Error"
msgstr "Erro do Depurador"
#: lazarusidestrconsts.lisdebuggerfeedbackinformation
msgid "Debugger Information"
msgstr "Informação Depurador"
#: lazarusidestrconsts.lisdebuggerfeedbackwarning
msgid "Debugger Warning"
msgstr "Aviso do Depurador"
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Depurador inválido"
#: lazarusidestrconsts.lisdebugging
msgid "%s (debugging ...)"
msgstr "%s (depurando ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "\"Typecast\" automático para objetos"
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Adicionar Exceção"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Caminho de busca adicional"
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr "Fechar a janela assembler automaticamente, após código não encontrado"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Ponto de parada"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Limpar registro de eventos ao executar"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Depurador"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Opções gerais do Depurador"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Opções específicas do Depurador (dependem do tipo de depurador)"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Duplicar nome da Exceção"
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Digitar o nome da exceção"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Registro de eventos"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Manipulado por"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Manipulado pelo Depurador"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Manipulado pelo Programa"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorar estas exceções"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Exceções de Idioma"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Limitar contagem de linha em"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Módulo"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Exceptions"
msgstr "Notificar as exceções"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Exceções do SO"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Saída"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Processo"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Redefinir o depurador após cada execução"
#: lazarusidestrconsts.lisdebugoptionsfrmresume
msgid "Resume"
msgstr "Retomar"
#: lazarusidestrconsts.lisdebugoptionsfrmresumehandled
msgid "Resume Handled"
msgstr "Retomar Manipulados"
#: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled
msgid "Resume Unhandled"
msgstr "Retomar não Manipulados"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Exibir mensagem na parada"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Sinais"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Thread"
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Usar cores no registro de eventos"
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Janelas"
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Incapaz de carregar arquivo"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
msgid "Unable to load file \"%s\"."
msgstr "Incapaz de carregar arquivo \"%s\"."
#: lazarusidestrconsts.lisdecimal
msgctxt "lazarusidestrconsts.lisdecimal"
msgid "Decimal"
msgstr "Decimal"
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Padrão"
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr "Seção padrão visibilidade de classe de novos métodos. Por exemplo complemento de código no OnShow:="
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr "O padrão é \"ComboBox\" com seleções \"True\" e \"False\""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(padrão)"
#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr "Seção padrão de métodos"
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Atraso para dicas longas na caixa de conclusão"
#: lazarusidestrconsts.lisdelayforhintsandcompletionbox
msgid "Delay for hints and completion box"
msgstr "Atraso para dicas e caixa de conclusão"
#: lazarusidestrconsts.lisdelete
msgctxt "lazarusidestrconsts.lisdelete"
msgid "Delete"
msgstr "Excluir"
#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "Excluir?"
#: lazarusidestrconsts.lisdeleteaddition
msgid "Delete addition \"%s\"?"
msgstr "Excluir adição \"%s\"?"
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Excluir Tudo"
#: lazarusidestrconsts.lisdeleteallbreakpoints
msgid "Delete all breakpoints?"
msgstr "Excluir todos os pontos de parada?"
#: lazarusidestrconsts.lisdeleteallbreakpoints2
msgid "Delete all breakpoints in file \"%s\"?"
msgstr "Excluir todos os pontos de parada no arquivo \"%s\"?"
#: lazarusidestrconsts.lisdeleteallinsamesource
msgid "Delete All in same source"
msgstr "Excluir Tudo no mesmo código fonte"
#: lazarusidestrconsts.lisdeleteallselectedbreakpoints
msgid "Delete all selected breakpoints?"
msgstr "Excluir todos os pontos de parada selecionados?"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Excluir todos esses arquivos?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Excluir arquivo ambíguo?"
#: lazarusidestrconsts.lisdeletebreakpoint
msgid "Delete Breakpoint"
msgstr "Excluir Ponto de parada"
#: lazarusidestrconsts.lisdeletebreakpointatline
msgid "Delete breakpoint at%s\"%s\" line %d?"
msgstr "Excluir ponto de parada na%s\"%s\" linha %d?"
#: lazarusidestrconsts.lisdeletebreakpointforaddress
msgid "Delete breakpoint for address %s?"
msgstr "Excluir ponto de parada para o endereço %s?"
#: lazarusidestrconsts.lisdeletebreakpointforwatch
msgid "Delete watchpoint for \"%s\"?"
msgstr "Excluir ponto de observação para \"%s\"?"
#: lazarusidestrconsts.lisdeletefilefailed
msgid "Delete file failed"
msgstr "Falha na exclusão do arquivo"
#: lazarusidestrconsts.lisdeletemacro
msgid "Delete macro \"%s\"?"
msgstr "Excluir macro \"%s\"?"
#: lazarusidestrconsts.lisdeletemode
msgid "Delete mode \"%s\""
msgstr "Excluir modo \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
msgid "Delete old file \"%s\"?"
msgstr "Excluir arquivo antigo \"%s\"?"
#: lazarusidestrconsts.lisdeleteoldfile2
msgid "Delete old file?"
msgstr "Excluir arquivo antigo?"
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Excluir macro selecionada?"
#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr "Excluir esta adição"
#: lazarusidestrconsts.lisdeletevalue
msgid "Delete value \"%s\"?"
msgstr "Excluir valor \"%s\"?"
#: lazarusidestrconsts.lisdeletevalue2
msgid "Delete value %s"
msgstr "Excluir valor %s"
#: lazarusidestrconsts.lisdeletingoffilefailed
msgid "Deleting of file \"%s\" failed."
msgstr "Falha ao excluir arquivo \"%s\""
#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr "Delimitador é ponto-e-vírgula"
#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr "Recursos compatíveis com Delphi. Recomendado."
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "Pacotes de \"Tempo de projeto\" adicionam componentes e itens de menu à IDE. Eles podem ser usados por projetos, mas não são compilados no projeto. O compilador não encontrará as unidades deste pacote ao compilar o projeto."
#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr "Áreas de trabalho ..."
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Diretório de destino"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Código do Destruidor"
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Não diferenciar maiúsc./minúsc."
#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "Arquivo1"
#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "Arquivo2"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorar se linhas em branco foram adicionadas ou removidas"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorar diferenças no final de linha (ex. #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorar quantidade de espaços em branco"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorar espaços (caracteres de nova linha não incluídos)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorar espaços no final da linha"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorar espaços no início da linha"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Somente seleção"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Abrir diferenças no editor"
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
msgid "different unit %s found at new position \"%s\""
msgstr "unidade diferente %s encontrada na nova posição \"%s\""
#: lazarusidestrconsts.lisdigits
msgid "Digits:"
msgstr "Dígitos:"
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Diretivas"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Diretivas para nova unidade"
#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Diretórios"
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Diretório:"
#: lazarusidestrconsts.lisdirectorynotfound
msgid "Directory \"%s\" not found."
msgstr "Diretório \"%s\" não encontrado."
#: lazarusidestrconsts.lisdirectorynotfound2
msgid "directory %s not found"
msgstr "diretório %s não encontrado"
#: lazarusidestrconsts.lisdirectorynotwritable
msgid "Directory not writable"
msgstr "Diretório não gravável"
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Diretório onde a IDE coloca os arquivos .po"
#: lazarusidestrconsts.lisdisableallinsamesource
msgid "Disable All in same source"
msgstr "Desativar Tudo no mesmo código fonte"
#: lazarusidestrconsts.lisdisablebreakpoint
msgid "Disable Breakpoint"
msgstr "Desativar Ponto de Parada"
#: lazarusidestrconsts.lisdisabled
msgctxt "lazarusidestrconsts.lisdisabled"
msgid "Disabled"
msgstr "Desativado"
#: lazarusidestrconsts.lisdisablegroups
msgid "Disable Groups"
msgstr "Desabilitar Grupos"
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Desativar I18N para LFM"
#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr "Desativar opção -Xg?"
#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr "Desativar opção -Xg"
#: lazarusidestrconsts.lisdisassassembler
msgctxt "lazarusidestrconsts.lisdisassassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lisdisassgotoaddress
msgctxt "lazarusidestrconsts.lisdisassgotoaddress"
msgid "Goto Address"
msgstr "Ir para endereço"
#: lazarusidestrconsts.lisdisassgotoaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotoaddresshint"
msgid "Goto Address"
msgstr "Ir para endereço"
#: lazarusidestrconsts.lisdisassgotocurrentaddress
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddress"
msgid "Goto Current Address"
msgstr "Ir para endereço atual"
#: lazarusidestrconsts.lisdisassgotocurrentaddresshint
msgctxt "lazarusidestrconsts.lisdisassgotocurrentaddresshint"
msgid "Goto Current Address"
msgstr "Ir para endereço atual"
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "&Descartar alterações"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Descartar todas alterações"
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Descartar alterações e abrir projeto"
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Descartar alterações e sair"
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Descartar alterações, criar novo projeto"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Clique em um dos items acima para ver as diferenças"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
msgid "Error reading file: %s"
msgstr "Erro lendo o arquivo: %s"
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr "Ignorar todas as alterações no disco"
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr "Recarregar arquivos marcados do disco"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Alguns arquivos foram alterados no disco:"
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Distinguir letras grandes e pequenas, ex: A e a"
#: lazarusidestrconsts.lisdlgadd
msgctxt "lazarusidestrconsts.lisdlgadd"
msgid "Add ..."
msgstr "Adicionar ..."
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Todas opções ..."
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Alterar classe ..."
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Definições ..."
#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Editar ..."
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Exportar..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Importar ..."
#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr "Mais ..."
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Abrir ..."
#: lazarusidestrconsts.lisdlgsave
msgctxt "lazarusidestrconsts.lisdlgsave"
msgid "Save ..."
msgstr "Salvar ..."
#: lazarusidestrconsts.lisdoesnotexists
msgid "%s does not exist: %s"
msgstr "%s não existe: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Não alterar"
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "%sDo not check if another IDE instance is already running"
msgstr "%sNão verificar se outra instância da IDE já está executando"
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Não fechar o projeto"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "do not compile dependencies"
msgstr "não compilar dependências"
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen"
msgstr "Não exibir a tela de início"
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Não exibir este diálogo para este projeto"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Não exibir esta mensagem novamente"
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr "Não gravar arquivo informação do projeto atualizado após construção. Se não especificado, número de construção será incrementado se configurado."
#: lazarusidestrconsts.lisdonwloadonlinepackages
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?\n"
msgstr ""
"O(s) pacote(s) seguinte(s) não está(ão) disponível(eis) localmente: %s.\n"
"Para instalá-lo(s) você deve baixá-lo(s) primeiro. Baixar agora?\n"
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Abaixo"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Desatualização"
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Configuração de desatualização"
#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr "Baixar"
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "Você ainda deseja criar um novo projeto?"
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Você ainda deseja abrir outro projeto?"
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Você ainda deseja sair?"
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Desenhar linhas da grade"
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "Desenhar a seleção focada, mesmo se a janela Mensagens não estiver em foco. Usar isto se o seu tema tem uma visão difícil de desenho não focado."
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copiar componentes selecionados para Área de Transferência"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Recortar componentes selecionados para Área de Transferência"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Mover componente um atrás"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Mover componente um adiante"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Mover componente para trás"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Mover componente para frente"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Colar componentes selecionados da Área de Transferência"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Selecionar componente pai"
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr "Exibir componentes não-visuais."
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr "Alternar exibição componentes não-visuais"
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Duplicado"
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Entrada duplicada"
#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Nome de arquivo duplicado"
#: lazarusidestrconsts.lisduplicatefoundofvalue
msgid "Duplicate found of value \"%s\"."
msgstr "Valor duplicado encontrado \"%s\"."
#: lazarusidestrconsts.lisduplicatemodename
msgid "Mode \"%s\" is already present in the list."
msgstr "Modo \"%s\" já está presente na lista."
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Nome duplicado"
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Nome duplicado: Um componente chamado \"%s\" já existe no componente herdado %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Arquivos ppu duplicados. Exclua um ou certifique-se de que todos os caminhos de busca tenham a ordem correta (Dica: FPC usa o último caminho primeiro)."
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Caminho busca duplicado"
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Fontes duplicados. Exclua um ou certifique-se de que todos os caminhos de busca tenham a ordem correta (Dica: FPC usa o último caminho primeiro)."
#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Unidade duplicada"
#: lazarusidestrconsts.lisduplicateunitin
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr "Unidade duplicada \"%s\" em \"%s\""
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Editar"
#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr "Editar ajuda adicional para mensagens"
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Editar ajuda contextual"
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Ajuda de edição"
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Tecla de edição"
#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Cores do Editor"
#: lazarusidestrconsts.liseditormacros
msgid "Editor Macros"
msgstr "Macros do Editor"
#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr "Barra de ferramentas do Editor"
#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr "Configurações barra de ferramentas do Editor"
#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr "Barra de ferramentas do Editor é &visível"
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Carregar um esquema"
#: lazarusidestrconsts.lisedtdefallpackages
msgid "All packages"
msgstr "Todos os pacotes"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Projeto Atual"
#: lazarusidestrconsts.lisedtdefsallprojects
msgid "All projects"
msgstr "Todos os projetos"
#: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi
msgid "set FPC mode to DELPHI"
msgstr "definir modo FPC para DELPHI"
#: lazarusidestrconsts.lisedtdefsetfpcmodetofpc
msgid "set FPC mode to FPC"
msgstr "definir modo FPC para FPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetogpc
msgid "set FPC mode to GPC"
msgstr "definir modo FPC para GPC"
#: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas
msgid "set FPC mode to MacPas"
msgstr "definir modo FPC para MacPas"
#: lazarusidestrconsts.lisedtdefsetfpcmodetotp
msgid "set FPC mode to TP"
msgstr "definir modo FPC para TP"
#: lazarusidestrconsts.lisedtdefsetiocheckson
msgid "set IOCHECKS on"
msgstr "definir IOCHECKS=ON"
#: lazarusidestrconsts.lisedtdefsetoverflowcheckson
msgid "set OVERFLOWCHECKS on"
msgstr "definir OVERFLOWCHECKS=ON"
#: lazarusidestrconsts.lisedtdefsetrangecheckson
msgid "set RANGECHECKS on"
msgstr "definir RANGECHEKS=ON"
#: lazarusidestrconsts.lisedtdefuseheaptrcunit
msgid "use HeapTrc unit"
msgstr "usar unidade HeapTrc"
#: lazarusidestrconsts.lisedtdefuselineinfounit
msgid "use LineInfo unit"
msgstr "usar unidade LineInfo"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Uma ferramenta válida necessita no mínimo de um título e um nome de arquivo."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Editar Ferramenta"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Tecla"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Macros"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Parâmetros:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Nome do programa:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for FPC messages"
msgstr "Examinar saída por mensagens FPC"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for \"make\" messages"
msgstr "Examinar saída por mensagens do \"make\""
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Título e Nome do Arquivo requerido"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Diretório trabalho:"
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr "Elevar a prioridade de mensagem para sempre exibí-la (por padrão ela tem baixa prioridade no \"detalhamento\")"
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Tudo"
#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Métodos Vazios"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Métodos vazios encontrados:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Nenhuma classe"
#: lazarusidestrconsts.lisemdnoclassat
msgid "No class at %s(%s,%s)"
msgstr "Nenhuma classe em %s(%s,%s)"
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Somente publicados"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Público"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Publicado"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Remover métodos"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Localizar nestas seções de classe:"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Incapaz de exibir métodos vazios da classe atual, porque%s%s"
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Vazio"
#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr "Diretório de destino para publicação ou é um caminho relativo ou está vazio."
#: lazarusidestrconsts.lisenableall
msgid "&Enable All"
msgstr "&Ativar Tudo"
#: lazarusidestrconsts.lisenableallinsamesource
msgid "Enable All in same source"
msgstr "Ativar tudo no mesmo código fonte"
#: lazarusidestrconsts.lisenablebreakpoint
msgid "Enable Breakpoint"
msgstr "Ativar Ponto de Parada"
#: lazarusidestrconsts.lisenabled
msgctxt "lazarusidestrconsts.lisenabled"
msgid "Enabled"
msgstr "Ativo"
#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr "Ativado apenas para pacotes."
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ". Ativar flag \"Use Unit\" da unidade %s no pacote %s"
#: lazarusidestrconsts.lisenablegroups
msgid "Enable Groups"
msgstr "Habilitar Grupos"
#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "Ativar I18N para LFM"
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Ativar internacionalização e suporte a tradução"
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Ativar Macros"
#: lazarusidestrconsts.lisenableoptiondwarf
msgid "Enable Dwarf 2 (-gw)?"
msgstr "Habilitar Dwarf 2 (-gw)?"
#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr "Habilitar Dwarf 2 (-gw)"
#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr "Habilitar Dwarf 2 com definições"
#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr "Habilitar Dwarf 3 (-gw3)"
#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr "Habilitar opção -Xg?"
#: lazarusidestrconsts.lisenableoptionxg2
msgid "Enable option -Xg"
msgstr "Habilitar opção -Xg"
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr ""
"Habilitado = pressionando \"Return\" substitue o identificador inteiro e \"Shift+Return\" o prefixo,\n"
"Desabilitado = pressionando \"Return\" substitue o prefixo e \"Shift+Return\" o identificador inteiro.\n"
#: lazarusidestrconsts.lisenclose
msgid "Enclose"
msgstr "Circundar"
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Circundar $IFDEF"
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
msgid "Number of files failed to convert: %d"
msgstr "Número de arquivos com falha na conversão: %d"
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "Codificação do arquivo \"%s\"%sno disco é %s. Nova codificação é %s."
#: lazarusidestrconsts.lisendlessloopinmacros
msgid "Endless loop in macros"
msgstr "Laço infinito em macros"
#: lazarusidestrconsts.lisenternewnameformacros
msgid "Enter new name for Macro \"%s\""
msgstr "Digite novo nome para a macro \"%s\""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Variável ambiente, nome como parâmetro"
#: lazarusidestrconsts.lisenvoptdlgdirectorynotfound
msgid "Directory not found"
msgstr "Diretório não encontrado"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nome de arquivo do depurador inválido"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
msgid "The debugger file \"%s\" is not an executable."
msgstr "O arquivo do depurador \"%s\" não é um executável."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
msgid "Test directory \"%s\" not found."
msgstr "Diretório de teste \"%s\" não encontrado."
#: lazarusidestrconsts.liserrinvalidoption
msgid "Invalid option at position %d: \"%s\""
msgstr "Opção inválida na posição %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
msgid "Option at position %d does not allow an argument: %s"
msgstr "Opção na posição %d não permite um argumento: %s"
#: lazarusidestrconsts.liserroptionneeded
msgid "Option at position %d needs an argument : %s"
msgstr "Opção na posição %d precisa de um argumento : %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Erro: "
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Erro ao criar arquivo"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Erro na exclusão do arquivo"
#: lazarusidestrconsts.liserrorin
msgid "Error in %s"
msgstr "Erro em %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Erro no nome do arquivo do compilador:"
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Erro nas opções customizadas do compilador (Outro):"
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Erro nas opções customizadas do vinculador (Compilação e vinculação / Passar opções ao vinculador):"
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Erro no \"caminho adicional Depurador\":"
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Erro no caminho de busca para \"Arquivos de inclusão\":"
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Erro no caminho de busca para \"Bibliotecas\":"
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Erro no caminho de busca para \"Arquivos objeto\":"
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Erro no caminho de busca para \"Outros fontes\":"
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Erro no caminho de busca para \"Outros arquivos de unidade\":"
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Erro no \"diretório de saída de unidades\":"
#: lazarusidestrconsts.liserrorinvalidbuildmode
msgid "Error: (lazarus) invalid build mode \"%s\""
msgstr "Erro: (lazarus) modo de construção inválido \"%s\""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Erro carregando arquivo"
#: lazarusidestrconsts.liserrorloadingfile2
msgid "Error loading file \"%s\":"
msgstr "Erro ao carregar arquivo \"\"%s\"\":"
#: lazarusidestrconsts.liserrorloadingfrom
msgid "Error loading %s from%s%s%s%s"
msgstr "Erro carregado %s de%s%s%s%s"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Erro ao mover o componente"
#: lazarusidestrconsts.liserrormovingcomponent2
msgid "Error moving component %s:%s"
msgstr "Erro ao mover o componente %s%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Erro ao nomear componente"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Erro abrindo componente"
#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr "Erro ao abrir formulário"
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Erro na análise do fluxo de componente no arquivo LFM."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
msgid "Error reading package list from file%s%s%s%s"
msgstr "Erro na leitura da lista de pacotes do arquivo%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Erro lendo XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Erro lendo arquivo xml \"%s\"%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Erro na renomeação do arquivo"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Erros"
#: lazarusidestrconsts.liserrors2
msgid ", Errors: %s"
msgstr ", Erros: %s"
#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr "Erro ao salvar formulário"
#: lazarusidestrconsts.liserrorsavingto
msgid "Error saving %s to%s%s%s%s"
msgstr "Erro salvando %s to%s%s%s%s"
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
msgid "Error setting the name of a component %s to %s"
msgstr "Erro ao definir o nome de um componente %s para %s"
#: lazarusidestrconsts.liserrorwritingfile
msgid "Error writing file \"%s\""
msgstr "Erro ao gravar arquivo \"%s\""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
msgid "Error writing package list to file%s%s%s%s"
msgstr "Erro na escrita do lista de pacotes para arquivo%s%s%s%s"
#: lazarusidestrconsts.lisevalexpression
msgctxt "lazarusidestrconsts.lisevalexpression"
msgid "Eval expression"
msgstr "Avaliar expressão"
#: lazarusidestrconsts.lisevaluate
msgid "E&valuate"
msgstr "A&valiar"
#: lazarusidestrconsts.lisevaluatemodify
msgid "&Evaluate/Modify"
msgstr "&Avaliar/Modificar"
#: lazarusidestrconsts.liseventlogclear
msgid "Clear Events"
msgstr "Limpar Eventos"
#: lazarusidestrconsts.liseventlogoptions
msgid "Event Log Options ..."
msgstr "Opções do registro de eventos ..."
#: lazarusidestrconsts.liseventlogsavetofile
msgid "Save Events to File"
msgstr "Salvar Eventos para Arquivo"
#: lazarusidestrconsts.liseventslogaddcomment
msgid "Add Comment ..."
msgstr "Adicionar Comentário ..."
#: lazarusidestrconsts.liseventslogaddcomment2
msgid "Add Comment"
msgstr "Adicionar Comentário"
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Every n-th line number"
msgstr "Todo enésimo número linha"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Arquivo exemplo:"
#: lazarusidestrconsts.lisexamplesbuildallselected
msgid "Build all selected"
msgstr "Construir todos os selecionados"
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Exemplos:%sIdentificador%sTMyEnum.Enum%sNomeUnidade.Identificador%s#NomePacote.NomeUnidade.Identificador"
#: lazarusidestrconsts.lisexamplesopenfirstselected
msgid "Open first selected"
msgstr "Abrir o primeiro selecionado"
#: lazarusidestrconsts.lisexceptiondialog
msgid "Debugger Exception Notification"
msgstr "Notificação Exceções Depurador"
#: lazarusidestrconsts.lisexcludedatruntime
msgid "%s excluded at run time"
msgstr "%s excluído em tempo de execução"
#: lazarusidestrconsts.lisexecutableisadirectory
msgid "executable \"%s\" is a directory"
msgstr "executável \"%s\" é um diretório"
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
msgid "executable \"%s\" lacks the permission to run"
msgstr "executável \"%s\" não tem permissão para execução"
#: lazarusidestrconsts.lisexecutingcommandafter
msgid "Executing command after"
msgstr "Executando comando posterior"
#: lazarusidestrconsts.lisexecutingcommandbefore
msgid "Executing command before"
msgstr "Executando comando anterior"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Execução parada"
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Sair"
#: lazarusidestrconsts.lisexitcode
msgid "Exit code %s"
msgstr "Código saída %s"
#: lazarusidestrconsts.lisexpandall
msgid "Expand All (*)"
msgstr "Expandir Tudo (*)"
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Expandir todas as classes"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Expandir todos os pacotes"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Expandir todas as unidades"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Nome de arquivo expandido do editor de arquivo atual"
#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Exportar"
#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr "Exportar tudo"
#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Exportar todos itens para arquivo"
#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr "Exportar opções de ambiente"
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Exportar como HTML"
#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr "Exportar / Importar"
#: lazarusidestrconsts.lisexportlist
msgid "Export list"
msgstr "Exportar Lista"
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list (*.xml)"
msgstr "Exportar lista de pacote (*.xml)"
#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr "Exportar selecionados"
#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr "Exportar >>"
#: lazarusidestrconsts.lisexpression
msgid "Expression:"
msgstr "Expressão:"
#: lazarusidestrconsts.lisextendincludefilesearchpathofpackagewith
msgid "Extend include file search path of package \"%s\" with%s\"%s\"?"
msgstr "Estender caminho de busca de arquivo de inclusão do pacote \"%s\" com%s\"%s\"?"
#: lazarusidestrconsts.lisextendincludefilessearchpathofprojectwith
msgid "Extend include files search path of project with%s\"%s\"?"
msgstr "Estender caminho de busca de arquivos de inclusão do projeto com%s\"%s\"?"
#: lazarusidestrconsts.lisextendincludepath
msgid "Extend include path?"
msgstr "Estender caminho de inclusão?"
#: lazarusidestrconsts.lisextendunitpath
msgid "Extend unit path?"
msgstr "Estender caminho da unidade?"
#: lazarusidestrconsts.lisextendunitsearchpathofpackagewith
msgid "Extend unit search path of package \"%s\" with%s\"%s\"?"
msgstr "Estender caminho de busca de unidade do pacote \"%s\" com%s\"%s\"?"
#: lazarusidestrconsts.lisextendunitsearchpathofprojectwith
msgid "Extend unit search path of project with%s\"%s\"?"
msgstr "Estender caminho de busca de unidade do projeto com%s\"%s\"?"
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Extrair"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Extrair Procedimento"
#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Extremamente detalhado"
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Ferramentas externas"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Máximo de Ferramentas atingido"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
msgid "There is a maximum of %s tools."
msgstr "Há um máximo de %s ferramentas."
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
msgid "Failed to add %d not unique resource(s)"
msgstr "Falha ao adicionar %d recurso(s) não únicos"
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Falha ao criar aplicação inclusa para \"%s\""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Falha ao carregar estado retração"
#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "falha ao resolver macros"
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "Falha ao salvar arquivo."
#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr "Fatal"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidle
msgid "Reduce designer painting"
msgstr "Reduzir atualização de janela"
#: lazarusidestrconsts.lisfepaintdesigneritemsonidlehint
msgctxt "lazarusidestrconsts.lisfepaintdesigneritemsonidlehint"
msgid "Paint designer items only on idle (reduce overhead for slow computers)"
msgstr "Pintar itens da janela do editor quando ocioso.(Reduz pico processamento para computadores lentos)"
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Arquivo"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Arquivo:"
#: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway
msgctxt "lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway"
msgid "File \"%s\"%sdoes not look like a text file.%sOpen it anyway?"
msgstr "Arquivo \"%s\"%snão parece ser um arquivo texto.%sAbrir assim mesmo?"
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Extensões de arquivos de programas"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtro arquivo"
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Filtros de Arquivos"
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Adicionar linha"
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Excluir linha"
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Inserir linha"
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Máscara de arquivo"
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Definir padrões"
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Estes são filtros de arquivos que aparecerão em todos os diálogos Abrir Arquivo"
#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr "Arquivo encontrado"
#: lazarusidestrconsts.lisfilehaschangedsave
msgid "File \"%s\" has changed. Save?"
msgstr "Arquivo \"%s\" foi alterado. Salvar?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Arquivo não tem projeto"
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Arquivo é um diretório"
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Arquivo não é um executável"
#: lazarusidestrconsts.lisfileisnotwritable
msgid "File is not writable"
msgstr "Arquivo não aceita escrita"
#: lazarusidestrconsts.lisfileissymlink
msgid "File is symlink"
msgstr "Arquivo é um vínculo simbólico"
#: lazarusidestrconsts.lisfileisvirtual
msgid "File \"%s\" is virtual."
msgstr "Arquivo \"%s\" é virtual."
#: lazarusidestrconsts.lisfilelinkerror
msgid "File link error"
msgstr "Erro vínculo arquivo"
#: lazarusidestrconsts.lisfilenameaddress
msgid "Filename/Address"
msgstr "Nome de arquivo/Endereço"
#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr "Estilo nome de arquivo"
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Arquivo não encontrado"
#: lazarusidestrconsts.lisfilenotfound2
msgctxt "lazarusidestrconsts.lisfilenotfound2"
msgid "File \"%s\" not found."
msgstr "Arquivo \"%s\" não encontrado."
#: lazarusidestrconsts.lisfilenotfound3
msgid "file %s not found"
msgstr "arquivo %s não encontrado"
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "arquivo não encontrado"
#: lazarusidestrconsts.lisfilenotfound5
msgid "File not found:%s%s"
msgstr "Arquivo não encontrado:%s%s"
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "Arquivo \"%s\" não encontrado.%sDeseja criá-lo?"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Arquivo não está em minúsculo"
#: lazarusidestrconsts.lisfilenottext
msgid "File not text"
msgstr "Arquivo não é texto"
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Configurações do arquivo"
#: lazarusidestrconsts.lisfileshasincorrectsyntax
msgid "File %s has incorrect syntax."
msgstr "Arquivo %s tem sintaxe incorreta."
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Arquivos: %s, tem procedimento \"Register\": %s, na seção \"uses\" do pacote: %s"
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Todos os arquivos encontrados já têm a codificação correta ***"
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Arquivos em ASCII ou codificação UTF-8"
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
msgid "File %s is converted to text format."
msgstr "Arquivo %s foi convertido para formato texto."
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Arquivos não está em ASCII nem na codificação UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "file where debug output is written to. If it is not specified, debug output is written to the console."
msgstr "arquivo, onde saída do depurador é escrita. Se não for especificado, a saída será para o console."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtro"
#: lazarusidestrconsts.lisfilter3
msgid "Filter: %s"
msgstr "Filtro: %s"
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr "Filtrar todas mensagens de certo tipo"
#: lazarusidestrconsts.lisfilterallmessagesoftype
msgid "Filter all messages of type %s"
msgstr "Filtrar todas mensagens do tipo %s"
#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "Filtro já existe"
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Filtrar mensagens de depuração e abaixo"
#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Filtrar dicas e abaixo"
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Filtrar dicas sem posição no fonte"
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "Nada filtrar, não filtrar por urgência"
#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Filtrar mensagens sem urgência"
#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "Filtrar notas e abaixo"
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Definições Filtro"
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Filtrar a lista de opções disponíveis"
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Filtrar mensagens detalhamento e abaixo"
#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Filtrar avisos e abaixo"
#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Localizar ..."
#: lazarusidestrconsts.lisfinddeclarationof
msgid "Find Declaration of %s"
msgstr "Localizar declaração de %s"
#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "D&iretórios"
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "&Máscara arquivo"
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Incluir &subdiretórios"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Padrão linhas &múltiplas"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "search all files in &project"
msgstr "Localizar todos os arquivos no &projeto"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "search all &open files"
msgstr "Localizar todos &os arquivos abertos"
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "search in &active file"
msgstr "localizar no arquivo &ativo"
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "search in &directories"
msgstr "Localizar nos &diretórios"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Where"
msgstr "Onde"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Localizar combinação teclas"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Localizar unidade faltante"
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Primeiro"
#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr "&Primeiro teste"
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Corrigir arquivo LFM"
#: lazarusidestrconsts.lisfloatingpoin
msgid "Floating Point"
msgstr "Ponto Flutuante"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Dica de foco"
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Forçar renomeação"
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr "Por exemplo exibir no topo as variáveis locais, depois os membros da classe atual, depois os ancestrais, depois a unidade atual, depois as unidades usadas"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Formulário"
#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr "Para macOS (Darwin)"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Erro formatação"
#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr "Para Windows"
#: lazarusidestrconsts.lisfoundversionexpected
msgid "Found version %s, expected %s"
msgstr "Versão encontrada %s, esperada %s"
#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr "Versão FPC como um número (ex. 20701)"
#: lazarusidestrconsts.lisfpcmakefailed
msgid "fpcmake failed"
msgstr "\"fpcmake\" falhou"
#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr "Arquivo mensagens FPC:"
#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr "Mensagens FPC: Apêndice"
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr "Recursos FPC (.res)"
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Fontes FPC"
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC muito antigo"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Versão FPC:"
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Versão FPC (ex. 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Editor FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
msgid "Error writing \"%s\"%s%s"
msgstr "Erro gravando \"%s\"%s%s"
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Erro sintaxe FPDoc"
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "Nome do pacote FPDoc:"
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "Nome do pacote FPDoc. Padrão é o nome do arquivo de projeto."
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Há um erro de sintaxe no elemento fpdoc \"%s\":%s%s"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Quadro com bordas"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "Localizar para &trás"
#: lazarusidestrconsts.lisfreeingbufferlines
msgid "freeing buffer lines: %s"
msgstr "liberando linhas \"buffer\": %s"
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Mensagens do compilador Free Pascal"
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Diretório fonte do Free Pascal"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Localizar para fre&nte"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Arquivos adicionais à localizar (ex: /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Localizar ou Renomear identificador"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Localizar Referências"
#: lazarusidestrconsts.lisfriidentifier
msgid "Identifier: %s"
msgstr "Identificador: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "em todos os pacotes e projetos abertos"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "na unidade atual"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "no projeto principal"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "no projeto/pacote proprietário da unidade atual"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Identificador Inválido"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Renomear todas as Referências"
#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr "Renomeando"
#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr "Localizar"
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Localizar também nos comentários"
#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Cheio"
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Função"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Geral"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "obter palavra na posição atual do cursor"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr "Obter palavra na posição atual do cursor."
#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr "Configurações globais"
#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Ir para a linha"
#: lazarusidestrconsts.lisgotoselected
msgid "Goto selected"
msgstr "Ir para selecionados"
#: lazarusidestrconsts.lisgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"Estes fontes são software livre; você pode redistribuir e/ou modificá-los sob os termos da GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior.\n"
"\n"
"Este código é distribuído na esperança de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.\n"
"\n"
"Você deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Grupo"
#: lazarusidestrconsts.lisgroupassignexisting
msgid "Assign to existing \"%s\" group?"
msgstr "Atribuir ao grupo \"%s\" existente?"
#: lazarusidestrconsts.lisgroupemptydelete
msgid "No more breakpoints are assigned to group \"%s\", delete it?"
msgstr "Não há mais pontos de parada atribuídos ao grupo \"%s\", excluí-lo?"
#: lazarusidestrconsts.lisgroupemptydeletemore
msgid "%sThere are %d more empty groups, delete all?"
msgstr "%sExistem mais %d grupos vazios, excluir todos?"
#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr "Agrupar automaticamente variáveis locais definidas"
#: lazarusidestrconsts.lisgroupnameemptyclearinstead
msgid "The group name cannot be empty. Clear breakpoints' group(s)?"
msgstr "O nome de grupo não pode ser vazio. Limpar grupo(s) de pontos de parada?"
#: lazarusidestrconsts.lisgroupnameinput
msgid "Group name:"
msgstr "Nome do grupo:"
#: lazarusidestrconsts.lisgroupnameinvalid
msgid "BreakpointGroup name must be a valid Pascal identifier name."
msgstr "Nome do grupo de pontos de parada deve ser um nome de identificador Pascal válido."
#: lazarusidestrconsts.lisgroupsetnew
msgid "Set new group ..."
msgstr "Definir novo grupo ..."
#: lazarusidestrconsts.lisgroupsetnone
msgid "Clear group(s)"
msgstr "Limpar grupo(s)"
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or Disable groups of debug output. Valid Options are:"
msgstr "Habilitar ou desabilitar saída de grupos de depuração. Opções válidas são:"
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Aumentar para o maior"
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Tem Ajuda"
#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr "Cores cabeçalho"
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Cabeçalho de comentário para classe"
#: lazarusidestrconsts.lishelp
msgctxt "lazarusidestrconsts.lishelp"
msgid "Help"
msgstr "Ajuda"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Entradas da Ajuda"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Seletor de Ajuda"
#: lazarusidestrconsts.lishexadecimal
msgid "Hexadecimal"
msgstr "Hexadecimal"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Ajuda para mensagem do Compilador Free Pascal"
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "Ocultar todas as dicas e avisos inserindo a diretiva IDE {%H-}"
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "Ocultar mensagem em %s inserindo a diretiva IDE {%H-}"
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "Ocultar mensagem inserindo a diretiva IDE {%H-}"
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr "Ocultar mensagem inserindo {$warn %s off} na unidade \"%s\""
#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Ocultar Localizar"
#: lazarusidestrconsts.lishidewindow
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Ocultar janela"
#: lazarusidestrconsts.lishidewithpackageoptionvm
msgid "Hide with package option (-vm%s)"
msgstr "Ocultar com a opção de pacote (-vm%s)"
#: lazarusidestrconsts.lishidewithprojectoptionvm
msgid "Hide with project option (-vm%s)"
msgstr "Ocultar com a opção de projeto (-vm%s)"
#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "Dica"
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Dica: Um valor padrão pode ser definido nas condicionais."
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr "Uma dica no nome da propriedade exibe sua descrição"
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Dica: Verificar se dois pacotes contém uma unidade com o mesmo nome."
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr "Dica: Clique em \"Exibir opções\" para descobrir de onde vêm os caminhos herdados."
#: lazarusidestrconsts.lishints
msgid ", Hints: %s"
msgstr ", Dicas: %s"
#: lazarusidestrconsts.lishintsaveall
msgid "Save all"
msgstr "Salvar tudo"
#: lazarusidestrconsts.lishintstepinto
msgid "Step Into"
msgstr "Passar Dentro"
#: lazarusidestrconsts.lishintstepout
msgid "Run until function returns"
msgstr "Executar até o retorno da função"
#: lazarusidestrconsts.lishintstepover
msgid "Step Over"
msgstr "Passar Sobre"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Dica: A função \"Make Resourcestring\" espera uma constante \"string\".%sFavor selecionar a expressão e tentar novamente."
#: lazarusidestrconsts.lishinttoggleformunit
msgid "Toggle Form/Unit"
msgstr "Alternar Formulário/Unidade"
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Exibir Formulários"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Exibir Unidades"
#: lazarusidestrconsts.lishitcount
msgid "Hitcount"
msgstr "Contagem acertos"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Banco de Dados"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Opções de Ajuda"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Propriedades:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Visualizadores"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Caminho do Doc HTML do FPC"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontal"
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr "Linhas horizontais entre propriedades."
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"
#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr "Adição"
#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr "Abertura"
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Opções construção IDE"
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "A IDE será recompilada e reiniciada durante a instalação/desinstalação de pacotes."
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Bem-vindo ao Lazarus.%0:sA configuração da IDE encontrada foi anteriormente usada por outra instalação do Lazarus.%0:sSe você tem duas ou mais instalações separadas do Lazarus, elas não podem compartilhar a mesma configuração. Isto pode gerar conflitos e sua instalação do Lazarus pode ficar inutilizada.%0:s%0:sSe você tiver apenas uma instalação e copiou ou moveu o executável do Lazarus, então você poderá atualizar esta configuração.%0:s%1:s%0:s%0:sEscolha:%0:s%0:s* Atualizar info: Usar esta configuração e atualizá-la para ser utilizada com o Lazarus no futuro. A instalação antiga não irá usá-la mais.%0:s* Ignorar: Usar esta configuração, mas manter o aviso. Isto pode gerar conflitos com outras instalações.%0:s* Abortar: Sair agora. Você pode então corrigir o problema iniciando o Lazarus com a configuração correta.%0:s%0:sInformação adicional:%0:sEsta configuração está em: %2:s%0:sEla pertence à instalação Lazarus em: %3:s%0:s A IDE atual foi iniciada de: %4:s%0:s"
#: lazarusidestrconsts.lisideinfocreatingmakefileforpackage
msgid "Creating Makefile for package %s"
msgstr "Criando \"Makefile\" para pacote %s"
#: lazarusidestrconsts.lisideinfoerrorrunningcompileaftertoolfailedforpackage
msgid "Error: running 'compile after' tool failed for package %s"
msgstr "Erro: execução ferramenta 'compilar após\" falhou para o pacote %s"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informações sobre a IDE"
#: lazarusidestrconsts.lisideinfowarningunitnameinvalidpackage
msgid "WARNING: unit name invalid %s, package=%s"
msgstr "AVISO: nome unidade inválido %s, pacote=%s"
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "Macros IDE"
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr "A IDE mantém Application.Scaled (DPI-Alto) na unidade principal."
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "A IDE mantém o título na unidade principal."
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "identificador"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Identificadores começam com ..."
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Identificadores contêm ..."
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Opções da IDE:"
#: lazarusidestrconsts.lisidetitleshowsbuildmode
msgid "IDE title shows selected build mode"
msgstr "Título IDE exibe modo de construção selecionado"
#: lazarusidestrconsts.lisidetitleshowsprojectdir
msgid "IDE title shows project directory"
msgstr "Título IDE exibe diretório do projeto"
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "IDE title starts with project name"
msgstr "Título IDE começa com o nome do projeto"
#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Todos modos de construção"
#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Opções compilador de"
#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Modo construção atual"
#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "Erro ao abrir XML"
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
msgid "Error opening XML file \"%s\":%s%s"
msgstr "Erro ao abrir arquivo XML \"%s\":%s%s"
#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Exportar opções do compilador"
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Arquivo exportado já existe"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Arquivo exportado \"%s\" já existe.%sAbrir arquivo e substituir somente as opções do compilador?%s(Outras configurações serão mantidas.)"
#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Importar opções do compilador"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Carregar do arquivo"
#: lazarusidestrconsts.lisieconocompileroptionsinfile
msgid "File \"%s\" does not contain compiler options."
msgstr "Arquivo \"%s\" não contém opções do compilador."
#: lazarusidestrconsts.lisiecorecentfiles
msgid "Recent files"
msgstr "Arquivos recentes"
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Salvar para arquivo"
#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "Se não marcado:"
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr "Se apenas alterada a informação de sessão, perguntar sobre salvar."
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "Se você deseja usar duas versões diferentes do Lazarus, você deve iniciar o segundo Lazarus com o parâmetro de linha de comando \"primary-config-path\" ou \"pcp.%sPor exemplo:"
#: lazarusidestrconsts.lisignore
msgctxt "lazarusidestrconsts.lisignore"
msgid "Ignore"
msgstr "Ignorar"
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Ignorar tudo"
#: lazarusidestrconsts.lisignoreandcontinue
msgid "Ignore and continue"
msgstr "Ignorar e continuar"
#: lazarusidestrconsts.lisignoreexceptiontype
msgid "Ignore this exception type"
msgstr "Ignorar este tipo de exceção"
#: lazarusidestrconsts.lisignoreuseasancestor
msgid "Ignore, use %s as ancestor"
msgstr "Ignorar, usar %s como ancestral"
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Seguir identação da unidade atual, projeto ou pacote"
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Comentário implementação para classe"
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Importar"
#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr "Importante"
#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr "Importar opções de ambiente"
#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Importar do arquivo"
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr "Importar modos de construção não é suportado por pacotes."
#: lazarusidestrconsts.lisimportlist
msgid "Import list"
msgstr "Importar lista"
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list (*.xml)"
msgstr "Importar lista de pacote (*.xml)"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Impossível"
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
msgid "In a source directory of the package \"%s\"."
msgstr "No diretório fonte do pacote \"%s\"."
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "No diretório fonte do projeto. Verificar duplicidades."
#: lazarusidestrconsts.lisincludeallsubdirectories
msgid "Include all subdirectories"
msgstr "Incluir todos os subdiretórios"
#: lazarusidestrconsts.lisincludefilter
msgid "Include filter"
msgstr "Filtro de inclusão"
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "caminho de inclusão"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Caminhos de inclusão"
#: lazarusidestrconsts.lisincludesubdirectories
msgid "Include subdirectories"
msgstr "Incluir subdiretórios"
#: lazarusidestrconsts.lisincompatibleppu
msgid ", incompatible ppu=%s"
msgstr ", ppu incompatível=%s"
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Encontrada configuração de diretórios incorreta"
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Identação para fontes Pascal"
#: lazarusidestrconsts.lisindex
msgid "Index"
msgstr "Índice"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Informação"
#: lazarusidestrconsts.lisinformationaboutunit
msgid "Information about %s"
msgstr "Informação sobre %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informação sobre FPC usado"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "No caminho de busca de unidades FPC. Provavelmente instalado pelo pacote FPC. Verificar se o compilador e o arquivo ppu são da mesma instalação."
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Na frente do relacionado"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Item herdado"
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Parâmetros herdados"
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Componente projeto herdado"
#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr "Inicializar variável local"
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Com o propósito de criar uma cópia \"limpa\" do projeto/pacote, todos os arquivos no seguinte diretório serão excluídos e todo o seu conteúdo será perdido.%sExcluir todos os arquivos em \"%s\"?"
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Inserir"
#: lazarusidestrconsts.lisinsertassignment
msgid "Insert Assignment %s := ..."
msgstr "Inserir atribuição %s := ..."
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "inserir data"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "inserir data e hora"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string."
msgstr "Inserir data e hora. Opcional: formatar \"string\""
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string."
msgstr "Inserir data. Opcional: formatar \"string\""
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "inserir fim se necessário"
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName, // extract/add ClassName.\n"
"WithoutClassName, // skip classname\n"
"WithoutName, // skip function name\n"
"WithoutParamList, // skip param list\n"
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes, // skip colon, param types and default values\n"
"WithDefaultValues, // extract default values\n"
"WithResultType, // extract colon + result type\n"
"WithOfObject, // extract 'of object'\n"
"WithCallingSpecs, // extract cdecl; inline;\n"
"WithProcModifiers, // extract forward; alias; external;\n"
"WithComments, // extract comments and spaces\n"
"InUpperCase, // turn to uppercase\n"
"CommentsToSpace, // replace comments with a single space\n"
" // (default is to skip unnecessary space,\n"
" // e.g 'Do ;' normally becomes 'Do;'\n"
" // with this option you get 'Do ;')\n"
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon, // skip semicolon at end\n"
msgstr ""
"Inserir cabeçalho do procedimento atual.\n"
"\n"
"Parâmetros opcionais (separados por vírgula):\n"
"WithStart, // palavra-chave proc ex. 'function', 'class procedure'\n"
"WithoutClassKeyword,// sem palavra-chave proc 'class'\n"
"AddClassName, // extrai/adiciona ClassName.\n"
"WithoutClassName, // ignora classname\n"
"WithoutName, // ignora nome função\n"
"WithoutParamList, // ignora lista parâmetros\n"
"WithVarModifiers, // extrai 'var', 'out', 'const'\n"
"WithParameterNames, // extrai nome parâmetro\n"
"WithoutParamTypes, // ignora dois-pontos, tipo param e valores padrão\n"
"WithDefaultValues, // extrai valores padrão\n"
"WithResultType, // extrai dois-pontos + tipo result\n"
"WithOfObject, // extrai 'of object'\n"
"WithCallingSpecs, // extrai cdecl; inline;\n"
"WithProcModifiers, // extrai forward; alias; external;\n"
"WithComments, // extrai comentários e espaços\n"
"InUpperCase, // torna caixa-alta\n"
"CommentsToSpace, // substitui comentários por um espaço\n"
" // (padrão é pular espaços desnecessários,\n"
" // ex. 'Do ;' se torna 'Do;'\n"
" // com esta opção se obtém 'Do ;')\n"
"WithoutBrackets, // ignora colchetes início e fim na lista de parâmetros\n"
"WithoutSemicolon, // ignora ponto-e-vírgula no final\n"
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Inserir Macro"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure."
msgstr "Inserir nome do procedimento atual"
#: lazarusidestrconsts.lisinsertprintshorttag
msgid "Insert PrintShort tag"
msgstr "Inserir \"tag PrintShort\""
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Inserir \"tag printshort\""
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "inserir cabeçalho procedimento"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "inserir nome procedimento"
#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr "Inserir ponto-e-vírgula se necessário"
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "inserir hora"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string."
msgstr "Inserir hora. Opcional: formatar \"string\""
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Inserir \"tag\" url"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "Na sessão"
#: lazarusidestrconsts.lisinspect
msgid "&Inspect"
msgstr "&Inspecionar"
#: lazarusidestrconsts.lisinspectclassinherit
msgid "%s: class %s inherits from %s"
msgstr "%s: classe %s herdada de %s"
#: lazarusidestrconsts.lisinspectdata
msgid "Data"
msgstr "Dados"
#: lazarusidestrconsts.lisinspectdialog
msgid "Debug Inspector"
msgstr "Inspetor do Depurador"
#: lazarusidestrconsts.lisinspectmethods
msgid "Methods"
msgstr "Métodos"
#: lazarusidestrconsts.lisinspectpointerto
msgid "Pointer to %s"
msgstr "Apontar para %s"
#: lazarusidestrconsts.lisinspectproperties
msgctxt "lazarusidestrconsts.lisinspectproperties"
msgid "Properties"
msgstr "Propriedades"
#: lazarusidestrconsts.lisinspectshowcolclass
msgid "Show class column"
msgstr "Exibir coluna classe"
#: lazarusidestrconsts.lisinspectshowcoltype
msgid "Show type column"
msgstr "Exibir coluna tipo"
#: lazarusidestrconsts.lisinspectshowcolvisibility
msgid "Show visibility column"
msgstr "Exibir coluna visibilidade"
#: lazarusidestrconsts.lisinspectunavailableerror
msgid "%s: unavailable (error: %s)"
msgstr "%s: indisponível (erro: %s)"
#: lazarusidestrconsts.lisinspectuseinstance
msgid "Instance"
msgstr "Instância"
#: lazarusidestrconsts.lisinspectuseinstancehint
msgid "Use instance class"
msgstr "Usar classe instância"
#: lazarusidestrconsts.lisinstallationfailed
msgid "Installation failed"
msgstr "Falha na instalação"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "instalado"
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Install it, I like the fat"
#: lazarusidestrconsts.lisinstallpackagesmsg
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?\n"
msgstr ""
"Os pacotes seguintes não estão instalados, mas disponíveis no repositório principal: %s.\n"
"Deseja instalar os pacotes que estão faltando?\n"
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Instalar Seleção"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Instalar/desinstalar pacotes"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compile package create a simple Makefile."
msgstr "Ao invés de compilar o pacote criar um simples Makefile."
#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr "Codificação insuficiente"
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interativo"
#: lazarusidestrconsts.lisinternalerror
msgid "internal error: %s"
msgstr "erro interno: %s"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Exclusão inválida"
#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr "Executável inválido"
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
msgid "The file \"%s\" is not executable."
msgstr "O arquivo \"%s\" não é executável."
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Expressão inválida.%sDica: A função \"Make Resourcestring\" espera uma constante \"string\" em um arquivo único. Favor selecionar a expressão e tentar novamente."
#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr "Nome de arquivo inválido"
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Filtro inválido"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
msgid "Invalid line, column in message%s%s"
msgstr "Linha, coluna inválida na mensagem%s%s"
#: lazarusidestrconsts.lisinvalidmacrosin
msgid "Invalid macros in \"%s\""
msgstr "Macros inválidas em \"%s\""
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Macros inválidas \"%s\" na ferramenta externa \"%s\""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "Macro \"%s\" inválida. O nome da macro deve ser um identificador Pascal."
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Nome de macro \"%s\" inválido. O nome é uma palavra-chave."
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Máscara inválida"
#: lazarusidestrconsts.lisinvalidmode
msgid "Invalid mode %s"
msgstr "Modo inválido %s"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Multi-seleção inválida"
#: lazarusidestrconsts.lisinvalidoff
msgid "Invalid (Off)"
msgstr "Inválido (Desligado)"
#: lazarusidestrconsts.lisinvalidon
msgid "Invalid (On)"
msgstr "Inválido (Ligado)"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Identificador Pascal inválido"
#: lazarusidestrconsts.lisinvalidpascalidentifiername
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr "O nome \"%s\" não é um identificador Pascal válido.%sUsar assim mesmo?"
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "\"Proc name\" inválido"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nome do arquivo de projeto inválido"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Diretório de publicação inválido"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Seleção inválida"
#: lazarusidestrconsts.lisinvalidversionin
msgid "invalid version in %s"
msgstr "versão inválida em %s"
#: lazarusidestrconsts.lisisalreadypartoftheproject
msgid "%s is already part of the Project."
msgstr "%s já faz parte do Projeto."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"%s\" é um nome de projeto inválido.%sFavor escolher outro nome (ex. projeto1.lpi)"
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s é um %s.%sEsta dependência circular não é permitida."
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "diretório não encontrado"
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Questões"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
msgid "I wonder how you did that. Error in the %s:"
msgstr "Quero saber como você fez isso. Erro na %s:"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Quero saber como você fez isso: Erro no diretório base:"
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Histórico de saltos"
#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr "Saltar para o erro"
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr "Quando um erro nos fontes é encontrado na complementação do identificador, salta para ele."
#: lazarusidestrconsts.lisjumptoprocedure
msgid "Jump to procedure %s"
msgstr "Saltar para procedimento %s"
#: lazarusidestrconsts.liskb
msgid "%s KB"
msgstr "%s KB"
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Manter"
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Manter arquivos convertidos abertos no editor"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Todos os arquivos do projeto serão abertos no editor após conversão"
#: lazarusidestrconsts.liskeepininstalllist
msgid "Keep in install list"
msgstr "Manter na lista instalação"
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Manter nome"
#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr "Manter aberto"
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep relative indentation of multi line template"
msgstr "Manter identação relativa do modelo de múltiplas linhas"
#: lazarusidestrconsts.liskeepsubindentation
msgid "Keep indentation"
msgstr "Manter identação"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Mantê-los e continuar"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Tecla"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Comandos personalizados"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Comandos do Editor"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Comandos do Inspetor de Objetos"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Tecla (ou sequência de 2 teclas)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Abortar construção"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Adicionar ponto de parada de endereço"
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Adicionar ponto de parada de fonte"
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Adicionar dado/ponto de observação"
#: lazarusidestrconsts.liskmaddwatch
msgid "Add watch"
msgstr "Adicionar observador"
#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Construir muitos modos"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Construir projeto/programa"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Escolha o esquema de mapeamento de teclas"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Clássico"
#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Limpar e construir"
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Fechar projeto"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Editor de definições das Ferramentas de Código"
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Compilar projeto/programa"
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "Configurar \"Construir arquivo\""
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Configurar componentes personalizados"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Ajuda contextual"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Converter pacote Delphi para Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Converter projeto Delphi para Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Converter unidade Delphi para Lazarus"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "Converter arquivo DFM para LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected components"
msgstr "Copiar componentes selecionados"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected components"
msgstr "Recortar componentes selecionados"
#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr "Padrão adaptado para macOS"
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Excluir último caractere"
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "Comparar arquivos do editor"
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Editar modelos de código"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Editar ajuda contextual"
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Circundar seleção"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Avaliar/Modificar"
#: lazarusidestrconsts.liskmexampleprojects
msgid "Example Projects"
msgstr "Projetos de exemplo"
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Configurações Ferramentas Externas"
#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Localização incremental"
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to bookmark 0"
msgstr "Ir para marcador 0"
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to bookmark 1"
msgstr "Ir para marcador 1"
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to bookmark 2"
msgstr "Ir para marcador 2"
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to bookmark 3"
msgstr "Ir para marcador 3"
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to bookmark 4"
msgstr "Ir para marcador 4"
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to bookmark 5"
msgstr "Ir para marcador 5"
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to bookmark 6"
msgstr "Ir para marcador 6"
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to bookmark 7"
msgstr "Ir para marcador 7"
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to bookmark 8"
msgstr "Ir para marcador 8"
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to bookmark 9"
msgstr "Ir para marcador 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Ir para editor fonte 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Ir para editor fonte 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Ir para editor fonte 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Ir para editor fonte 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Ir para editor fonte 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Ir para editor fonte 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Ir para editor fonte 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Ir para editor fonte 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Ir para editor fonte 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Ir para editor fonte 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Inserir data e hora"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Inserir nome de usuário"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspecionar"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Esquema de mapeamento de teclas"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus default"
msgstr "Padrão Lazarus"
#: lazarusidestrconsts.liskmmacosxapple
msgid "macOS, Apple style"
msgstr "macOS, estilo Apple"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "macOS, Lazarus style"
msgstr "macOS, estilo Lazarus"
#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Novo pacote"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Novo projeto"
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Novo projeto do arquivo"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nova unidade"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Nota: Todas as teclas serão definidas para os valores do esquema escolhido."
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Abrir arquivo de pacote"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components"
msgstr "Colar componentes"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Pausar programa"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publicar projeto"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Compilação rápida, sem vinculação"
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Remover arquivo ativo do projeto"
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Executar programa"
#: lazarusidestrconsts.liskmsaveall
msgid "SaveAll"
msgstr "SalvarTudo"
#: lazarusidestrconsts.liskmsaveas
msgid "SaveAs"
msgstr "SalvarComo"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Salvar projeto"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Salvar projeto como"
#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Selecionar fim de linha"
#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Selecionar início de linha"
#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Selecionar base da página"
#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Selecionar topo da página"
#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Selecionar palavra à esquerda"
#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Selecionar palavra à direita"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Definir Marcador livre"
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set bookmark 0"
msgstr "Definir marcador 0"
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set bookmark 1"
msgstr "Definir marcador 1"
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set bookmark 2"
msgstr "Definir marcador 2"
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set bookmark 3"
msgstr "Definir marcador 3"
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set bookmark 4"
msgstr "Definir marcador 4"
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set bookmark 5"
msgstr "Definir marcador 5"
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set bookmark 6"
msgstr "Definir marcador 6"
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set bookmark 7"
msgstr "Definir marcador 7"
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set bookmark 8"
msgstr "Definir marcador 8"
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set bookmark 9"
msgstr "Definir marcador 9"
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Parar programa"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Alternar Unidade/Formulário"
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle bookmark 0"
msgstr "Alternar marcador 0"
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle bookmark 1"
msgstr "Alternar marcador 1"
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle bookmark 2"
msgstr "Alternar marcador 2"
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle bookmark 3"
msgstr "Alternar marcador 3"
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle bookmark 4"
msgstr "Alternar marcador 4"
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle bookmark 5"
msgstr "Alternar marcador 5"
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle bookmark 6"
msgstr "Alternar marcador 6"
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle bookmark 7"
msgstr "Alternar marcador 7"
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle bookmark 8"
msgstr "Alternar marcador 8"
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle bookmark 9"
msgstr "Alternar marcador 9"
#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Exibir Assembler"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Exibir pontos de parada"
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Exibir chamada de pilha"
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Alternar exibição navegador de código"
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Alternar exibição explorador de código"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Alternar exibição da paleta de componentes"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Exibir registro de eventos de depuração"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Exibir saída do depurador"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Alternar exibição Editor de Documentação"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Exibir histórico"
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Alternar exibição botões da IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Exibir variáveis locais"
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Alternar exibição Mensagens"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Alternar exibição Inspetor de Objetos"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr "Exibir entrada/saída console"
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Exibir registradores"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Alternar exibição Resultados de Pesquisa"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Alternar exibição Editor Código"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Exibir \"threads\""
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Exibir observadores"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Exibir histórico de saltos"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Exibir opções de projeto"
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Exibir fonte do projeto"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Exibir informações da unidade"
#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr "Última abertura"
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Aplicação iniciando inválida"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Iniciando linha de comando alvo"
#: lazarusidestrconsts.lislazarus
msgctxt "lazarusidestrconsts.lislazarus"
msgid "Lazarus"
msgstr "Lazarus"
#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Padrão Lazarus"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Diretório Lazarus"
#: lazarusidestrconsts.lislazarusdiroverride
msgid "directory to be used as a basedirectory"
msgstr "diretório para ser usado como diretório base"
#: lazarusidestrconsts.lislazaruseditorv
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "IDE do Lazarus"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "ID de idioma do Lazarus (ex. en, de, br, fi)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nome de idioma do Lazarus (ex. inglês, alemão)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [opções] <nome-de-arquivo-do-projeto>"
#: lazarusidestrconsts.lislazarussvnrev
msgid "r%s"
msgstr "r%s"
#: lazarusidestrconsts.lislazbuildaboaction
msgctxt "lazarusidestrconsts.lislazbuildaboaction"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Escolha o diretório de saída do executável da IDE"
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Confirma a exclusão deste perfil de construção ?"
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Construir muitos"
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Configurações Comuns"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Confirmar antes de construir"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Confirmar exclusão"
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "Depurar IDE"
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Definições"
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Definições sem -d"
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Editar Definições"
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Editar lista de definições que podem ser usadas por qualquer perfil"
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Erro escrevendo arquivo"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%s\"lazbuild\" não é interativo, abortando agora."
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Gerenciar Perfis Construção"
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Gerenciar perfis"
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Nome do perfil ativo"
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Adicionar Novo Perfil"
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Opções de contrução atuais estão associadas com:"
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "IDE normal"
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "IDE Otimizada"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Opções:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Opções passadas ao compilador"
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Perfil à construir"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Renomear Perfil"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Novo nome para perfil:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Reiniciar após construir IDE"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Reiniciar Lazarus automaticamente após construção da IDE (sem efeito ao construir outras partes)"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Selecione perfis à construir"
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Exibir diálogo de confirmação ao construir diretamente do menu Ferramentas"
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Exibir opções e definições para a linha de comando"
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "CPU Alvo:"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Diretório alvo:"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "SO alvo:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
msgid "Unable to write file \"%s\":%s"
msgstr "Incapaz de gravar arquivo \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Atualizar \"revision.inc\""
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Atualizar informações de revisão no diálogo \"Sobre Lazarus\""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Limpar + Construir tudo"
#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Versão Lazarus (ex. 1.2.4)"
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "Tipo \"widget\" LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Adicionar vínculo ao herdado"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copiar do herdado"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s não tem um caminho FPDoc válido.%sIncapaz de criar o arquivo fpdoc para %s"
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Mover entradas para herdado"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Nenhum caminho FPDoc válido"
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "A unidade %s não é propriedade de nenhum pacote ou projeto.%sFavor adicionar a unidade a um pacote ou projeto.%sIncapaz de criar o arquivo \"fpdoc\"."
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Esquerda"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr ""
"Espaço da borda esquerda.\n"
"Este valor será adicionado ao espaço da borda base e\n"
"usado para o espaço à esquerda do controle.\n"
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ancoragem a esquerda"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr ""
"Este é o controle irmão ao qual o lado esquerdo está ancorado.\n"
"Deixar vazio para ancorar ao controle-pai no estilo Delphi (Espaçamento borda e lado referência não importa).\n"
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Lados Esquerdos"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Justificar a esquerda"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Menos"
#: lazarusidestrconsts.lislevels
msgid "Levels"
msgstr "Níveis"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "Arquivo LFM"
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "O arquivo LFM contém classes/propriedades desconhecidas que não existem na LCL. Eles podem ser substituídos ou removidos."
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Arquivo LFM corrompido"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM está ok"
#: lazarusidestrconsts.lislgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"Esta biblioteca é software livre; você pode redistribuí-la e/ou modificá-la sob os termos da GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior.\n"
"\n"
"Este programa é distribuido na esperanca de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.\n"
"\n"
"Você deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "caminho biblioteca."
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgstr "Uma biblioteca compartilhada Free Pascal (.dll no Windows, .so no Linux, .dylib no MacOS X)."
#: lazarusidestrconsts.lisline
msgid "Line:"
msgstr "Linha:"
#: lazarusidestrconsts.lislinelength
msgid "Line/Length"
msgstr "Linha/Comprimento"
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Vínculo:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "Opções do Vinculador"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Alvo vínculo"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "lista de todos os valores \"case\""
#: lazarusidestrconsts.lisloadingfailed
msgid "Loading %s failed."
msgstr "Carga %s falhou."
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Carregar macro de"
#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr "&Local"
#: lazarusidestrconsts.lislocals
msgctxt "lazarusidestrconsts.lislocals"
msgid "Local Variables"
msgstr "Variáveis locais"
#: lazarusidestrconsts.lislocalsdlgcopyname
msgid "&Copy Name"
msgstr "&Copiar Nome"
#: lazarusidestrconsts.lislocalsdlgcopyrawvalue
msgid "Copy &RAW Value"
msgstr "Copiar valor &RAW"
#: lazarusidestrconsts.lislocalsdlgcopyvalue
msgid "C&opy Value"
msgstr "C&opiar Valor"
#: lazarusidestrconsts.lislocalsnotevaluated
msgid "Locals not evaluated"
msgstr "Variáveis locais não avaliadas"
#: lazarusidestrconsts.lislogcallstack
msgid "Log Call Stack"
msgstr "Registrar chamada pilha"
#: lazarusidestrconsts.lislogcallstacklimit
msgid "(frames limit. 0 - no limits)"
msgstr "(limite quadros. 0 - sem limite)"
#: lazarusidestrconsts.lislogevalexpression
msgctxt "lazarusidestrconsts.lislogevalexpression"
msgid "Eval expression"
msgstr "Avaliar expressão"
#: lazarusidestrconsts.lislogmessage
msgid "Log Message"
msgstr "Mensagem registro"
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "Seq.caracteres minúsculas"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter."
msgstr "\"String\" em minúsculas dada como parâmetro."
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "lpk desapareceu no dico. Usando como alternativa%s"
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "lpk está faltando"
#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr "Arquivos inclusão recursos Lazarus (.lrs)"
#: lazarusidestrconsts.lismacro
msgid "Macro %s"
msgstr "Macro %s"
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Inserir Dados"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Inserir parâmetros de execução"
#: lazarusidestrconsts.lismainunithasapplicationcreateformstatements
msgid "Main unit has Application.CreateForm statements"
msgstr "Unidade principal tem declarações \"Application.CreateForm\""
#: lazarusidestrconsts.lismainunithasapplicationscaledstatement
msgid "Main unit has Application.Scaled statement"
msgstr "Unidade principal tem declaração \"Application.Scaled\""
#: lazarusidestrconsts.lismainunithasapplicationtitlestatement
msgid "Main unit has Application.Title statement"
msgstr "Unidade principal tem declaração \"Application.Title\""
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "Unidade principal tem seção \"Uses\" contendo todas as unidades do projeto"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "Unidade principal é fonte Pascal"
#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr "Assume Pascal mesmo que não termine com sufixo .pas/.pp."
#: lazarusidestrconsts.lismakecurrent
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "Atual"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Gerar Executável"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "\"Make\" não encontrado"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Criar recurso \"string\""
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Adicionar a seção"
#: lazarusidestrconsts.lismakeresstrchooseanothername
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "A \"string\" de recurso \"%s\" já existe.%sFavor escolher outro nome.%sUse Ignorar para adicionar assim mesmo."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Opções de Conversão"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identificador Personalizado"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identificador"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Comprimento identificador:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Prefixo identificador:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Inserir alfabeticamente"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Inserir contexto sensível"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Seção recurso \"string\" inválida"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Favor escolher um seção de recurso \"string\" da lista."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Recurso \"string\" já existe"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Seção Recurso sequência caracteres:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Visualizar fonte"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Constante \"string\" no fonte"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Sequências de carac. com o mesmo valor:"
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr "Certifique que todos os arquivos .ppu de um pacote estejam em seus diretórios de saída."
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Gerenciar editores de código ..."
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr "Número máximo de \"threads\" para compilação em paralelo. Padrão é 0, que tenta identificar o número de núcleos do sistema."
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr "Máximo de processos paralelos. 0 padrão (%s)"
#: lazarusidestrconsts.lismaxs
msgid "Max %d"
msgstr "Máximo %d"
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
msgid "%s Maybe you have to recompile the package."
msgstr "%s Talvez você tenha que recompilar o pacote."
#: lazarusidestrconsts.lismb
msgid "%s MB"
msgstr "%s MB"
#: lazarusidestrconsts.lismeaction
msgctxt "lazarusidestrconsts.lismeaction"
msgid "Action"
msgstr "Ação"
#: lazarusidestrconsts.lismemorydump
msgid "Memory Dump"
msgstr "Despejo Memória"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Abortar construção"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Sobre FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Adicionar &ponto de parada"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Adicionar arquivo ativo ao pacote ..."
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Adicionar ponto de salto ao histórico"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Adicionar arquivo do editor ao projeto"
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Adicionar &observador ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Interromper linhas na seleção"
#: lazarusidestrconsts.lismenubreak
msgid "&Break"
msgstr "&Interromper"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Construir arquivo"
#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Construir o Lazarus com o perfil atual"
#: lazarusidestrconsts.lismenubuildlazarusprof
msgid "Build Lazarus with Profile: %s"
msgstr "Construir o Lazarus com perfil: %s"
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "Verificar arquivo LFM no editor"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Limpar diretório ..."
#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Limpar e construir ..."
#: lazarusidestrconsts.lismenucloseall
msgid "Close A&ll"
msgstr "Fechar &tudo"
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "&Fechar o arquivo no editor"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Fechar projeto"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "Editor de definições das Ferramentas de Código ..."
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Comentar seleção"
#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Comparar arquivos ..."
#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr "Compilar muitos modos ..."
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Completar código"
#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr "Completar código (com diálogo)"
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configurar arquivo Construir+Executar ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Configurar componentes personalizados ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Configurar ferramentas externas ..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configurar \"Construção Lazarus\" ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Ajuda de contexto sensível"
#: lazarusidestrconsts.lismenucontinue
msgid "&Continue"
msgstr "&Continuar"
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Converter pacote Delphi para Lazarus..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Converter projeto Delphi para Lazarus..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Converter unidade Delphi para Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgstr "Converter DFM binário para LFM texto + verificar sintaxe ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Converter codificação dos projetos/pacotes ..."
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Janelas de depuração"
#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Conversão Delphi"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Editar"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Modelos de código ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Editar Ajuda contexto sensível"
#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Instalar/desinstalar pacotes ..."
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr "Tecla aceleradora(&&) \"%s\" necessita alteração"
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr "Adicionar um novo item acima do item selecionado"
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr "Adicionar um novo item após o item selecionado"
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr "Adicionar um novo item antes do item selecionado"
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr "Adicionar um novo item abaixo do item selecionado"
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr "Adicionar um submenu à direita do item selecionado"
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr "Adicionar um submenu abaixo do item selecionado"
#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr "&Adicionar dos modelos ..."
#: lazarusidestrconsts.lismenueditoraddiconfroms
msgid "Add icon from %s"
msgstr "Adicionar ícone de %s"
#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr "Adicionar ícone lista de &imagem"
#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr "Adicionar item de menu"
#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr "&Adicionar novo item acima"
#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr "Adicionar no&vo item após"
#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr "&Adicionar novo item antes"
#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr "Adicionar no&vo item abaixo"
#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr "Adicionar manipulador &OnClick"
#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr "Adicionar separador &após"
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr "Adicionar separador an&tes"
#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr "Adicionar submenu"
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr "Adicionar &submenu abaixo"
#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr "Adicionar &submenu à direita"
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr "Um novo modelo de menu descrito como \"%s\" foi salvo baseado no %s, com %d sub itens"
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr "&Editar,Menu edição básico,&Desfazer,Ctrl+Z,&Refazer,,-,,Selecionar &Tudo,Ctrl+A,C&ortar,Ctrl+X,Co&piar,Ctrl+C,Co&lar,Ctrl+V,Colar E&special,,-,,Locali&zar,,S&ubstituir,,&Ir para ...,,"
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr "&Arquivo,Arquivo menu básico,&Novo,,A&brir ...,,&Salvar,,Salvar &como,,-,,&Imprimir,,&Configurar impressora ...,,-,,Sa&ir,,"
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr "&Ajuda,Menu ajuda básico,Ajuda e &Conteúdo,F1,Índ&ice Ajuda,,Ajuda &Online,,-,,Informação de &Licença,,&Verificar por atualizações,,-,,&Sobre,,"
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr "&Janela,Menu janela básico,&Nova Janela,,&Título,,&Cascata,,&Reorganizar tudo,,-,,&Ocultar,,&Exibir,,"
#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr "Título"
#: lazarusidestrconsts.lismenueditorcaptioneditemss
msgid "Captioned items: %s"
msgstr "Itens com título: %s"
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr "Título não deve estar em branco"
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
msgid "Change conflicting accelerator \"%s\""
msgstr "Alterar aceleradores conflitantes \"%s\""
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr "Alterar ícone da lista de &imagens"
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
msgid "Change %s for %s"
msgstr "Alterar %s para %s"
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
msgid "Change shortcut conflict \"%s\""
msgstr "Alterar conflito de atalho \"%s\""
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
msgid "Change the shortCut for %s"
msgstr "Alterar o atalho para %s"
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
msgid "Change the shortCutKey2 for %s"
msgstr "Alterar tecla2 de atalho para %s"
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr "Escolha modelo a excluir"
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr "Escolha modelo a inserir"
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr "Clique um item sombreado para editar seu atalho ou clique cabeçalho para ordenar por aquela coluna"
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr "Componente de espécie inesperada"
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr "Componente não tem nome"
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr "<resolução conflito completa>"
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
msgid "Conflicts found initially: %d"
msgstr "Conflitos inicialmente encontrados: %d"
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
msgid "Deepest nested menu level: %s"
msgstr "Nível de menu aninhado mais profundo: %s"
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "&Delete item"
msgstr "Excluir &item"
#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr "&Excluir modelo menu ..."
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr "Excluir modelo de menu salvo"
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr "Excluir modelo de menu selecionado"
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr "Excluir este item e seus subitens?"
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr "Exibir visualização como menu \"&Popup\""
#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr "Editar &Título"
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
msgid "Editing Caption of %s"
msgstr "Editando título de %s"
#: lazarusidestrconsts.lismenueditoreditingsdots
msgid "To resolve conflict edit %s.%s"
msgstr "Para resolver conflito editar %s.%s"
#: lazarusidestrconsts.lismenueditoreditingsfors
msgid "Editing %s for %s"
msgstr "Editando %s para %s"
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
msgid "Editing %s.%s - no menuitem selected"
msgstr "Editando %s.%s - nenhum item de menu selecionado"
#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr "Digite uma &descrição de menu"
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
msgid "Enter a new ShortCut for %s"
msgstr "Digite um novo atalho para %s"
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
msgid "Enter a new ShortCutKey2 for %s"
msgstr "Digite um novo atalho tecla2 para %s"
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr "Encerrando modelos salvos"
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr "Outros conflitos de atalho"
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr "Obtenha ajuda para usar este editor"
#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr "Tecla &garra"
#: lazarusidestrconsts.lismenueditorgroupindexd
msgid "GroupIndex: %d"
msgstr "Índice grupo: %d"
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
msgid "Values in use: %s"
msgstr "Valores em uso: %s"
#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr "Descrição inadequada"
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
msgid "Insert menu template into root of %s"
msgstr "Inserir modelo de menu na raiz de %s"
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr "Inserir modelo de menu selecionado"
#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr "não atribuído"
#: lazarusidestrconsts.lismenueditoritemswithicons
msgid "Items with icon: %s"
msgstr "Itens com ícone: %s"
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
msgid "List shortcuts and &accelerators for %s ..."
msgstr "Listar atalhos e &aceleradores para %s ..."
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
msgid "List shortcuts for %s ..."
msgstr "Listar atalhos para %s ..."
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Editor de Menu"
#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr "Ações de item menu"
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
msgid "Menuitem shortcut conflicts in %s"
msgstr "Atalho de item de menu conflita em %s"
#: lazarusidestrconsts.lismenueditormovedown
msgid "Move Down (or right)"
msgstr "Mover Abaixo (ou direita)"
#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr "Mo&ver item abaixo"
#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr "&Mover item à esquerda"
#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr "Mo&ver item à direita"
#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr "&Mover item acima"
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Mover item selecionado abaixo"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr "Mover item selecionado para a esquerda"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr "Mover item selecionado para a direita"
#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Mover item selecionado acima"
#: lazarusidestrconsts.lismenueditormoveup
msgid "Move Up (or left)"
msgstr "Mover Acima (ou esquerda)"
#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr "n/a"
#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr "(nenhum menu selecionado)"
#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr "<nenhum>"
#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr "<nenhum>,<nenhum>"
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr "<nenhum conflito de atalho>"
#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr "Nenhum modelo salvo pelo usuário"
#: lazarusidestrconsts.lismenueditorpickaniconfroms
msgid "Pick an icon from %s"
msgstr "Escolher um ícone de %s"
#: lazarusidestrconsts.lismenueditorpopupassignmentss
msgid "Popup assignments: %s"
msgstr "Atribuições \"Popup\": %s"
#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr "RadioItem"
#: lazarusidestrconsts.lismenueditorremainingconflictss
msgid "Remaining conflicts: %s"
msgstr "Conflitos restantes: %s"
#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr "&Remover todos os separadores"
#: lazarusidestrconsts.lismenueditorresolvedconflictss
msgid "Resolved conflicts: %s"
msgstr "Conflitos resolvidos: %s"
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr "Resolver conflitos selecionados"
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr "&Resolver conflitos de atalho ..."
#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr "Modelos salvos"
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr "&Salvar menu como modelo ..."
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr "Salvar menu como modelo"
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr "Salvar menu como modelo para uso futuro"
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr "Salvar menu exibido como um novo modelo"
#: lazarusidestrconsts.lismenueditorsconflictswiths
msgid "%s conflicts with %s"
msgstr "%s conflita com %s"
#: lazarusidestrconsts.lismenueditorseparators
msgid "Se¶tors"
msgstr "Se¶dores"
#: lazarusidestrconsts.lismenueditorshortcutitemss
msgid "Shortcut items: %s"
msgstr "Item de atalho: %s"
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr "Atalho ainda inalterado"
#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr "Atalhos"
#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr "Atal&hos"
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr "Atalhos e teclas Aceleradoras"
#: lazarusidestrconsts.lismenueditorshortcutsd
msgid "Shortcuts (%d)"
msgstr "Atalhos (%d)"
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr "Atalhos (%d) e teclas aceleradoras (%d)"
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr "Atalho, Propriedade Fonte"
#: lazarusidestrconsts.lismenueditorshortcutsusedins
msgid "Shortcuts used in %s"
msgstr "Atalhos usados em %s"
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
msgid "Shortcuts used in %s (%d)"
msgstr "Atalhos usados em %s (%d)"
#: lazarusidestrconsts.lismenueditorshowmenueditortmenuparameterisnil
msgid "ShowMenuEditor: TMenu parameter is nil"
msgstr "ShowMenuEditor: parâmetro TMenu é nil"
#: lazarusidestrconsts.lismenueditorsins
msgid "\"%s\" in %s"
msgstr "\"%s\" em %s"
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut.\n"
msgstr ""
"\"%s\" já está em uso em %s como um atalho.\n"
"Tentar um atalho diferente.\n"
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr "Favor expandir: \"%s\" não é uma descrição suficiente"
#: lazarusidestrconsts.lismenueditorsomewidgetsetsdonotallowseparatorsinthemainmenubar
msgid "Some widgetsets do not allow separators in the main menubar"
msgstr "Algumas \"widgesets\" não permitem separadores na barra de menu principal"
#: lazarusidestrconsts.lismenueditorsshortcuts
msgid "%s: Shortcuts"
msgstr "%s: Atalhos"
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
msgid "%s: Shortcuts and accelerator keys"
msgstr "%s: Atalhos e teclas aceleradoras"
#: lazarusidestrconsts.lismenueditorsssonclicks
msgid "%s.%s.%s - OnClick: %s"
msgstr "%s.%s.%s - OnClick: %s"
#: lazarusidestrconsts.lismenueditorssubmenu
msgid "%s submenu"
msgstr "%s submenu"
#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr "Modelos padrão"
#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr "Descrição do modelo:"
#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr "&Modelos"
#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr "Modelo salvo"
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available.\n"
msgstr ""
"Não existem modelos de menu salvos pelo usuário.\n"
"\n"
"Apenas modelos padrão estão disponíveis.\n"
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr "TSCList.GetScanListCompName: índice %d inválido para FScanList"
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict\n"
msgstr ""
"Você tem que alterar o atalho de %s\n"
"para evitar um conflito\n"
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr "Você deve digitar o texto para o Título"
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Circundar $IFDEF ..."
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Circundar seleção ..."
#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "A&valiar/Modificar ..."
#: lazarusidestrconsts.lismenuexampleprojects
msgid "Example Projects ..."
msgstr "Projetos de exemplo ..."
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Extrair procedimento ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Arquivo"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Localizar"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Localizar ..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Localizar o outro final do bloco de código"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Localizar o início do bloco de código"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Localizar declaração sob o cursor"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Localizar referências do identificador ..."
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Localizar &nos arquivos ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Localizar &próxima"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Localizar &anterior"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Localizar referências da unidade usada"
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Opções ..."
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Ir para a diretiva de inclusão"
#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Ir para linha ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Tenta identificar IFDEF/ENDIF fora de lugar"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Tenta identificar bloco não fechado"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "Aj&uda"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "Interno IDE"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Pesquisa incremental"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Recuar seleção"
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Entrada no registro alterações"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Inserir do Mapa de Caracteres ..."
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "Inserir palavra-chave CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Data e hora atuais"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Inserir nome-de-arquivo completo ..."
#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Geral"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "Nota GPL"
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "Nota GPL (traduzida)"
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "Nota LGPL"
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "Nota LGPL (traduzida)"
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "Nota MIT"
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "Nota MIT (traduzida)"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Nota LGL modificada"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Nota LGPL modificada (traduzida)"
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Nome do usuário atual"
#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "&Inspecionar ..."
#: lazarusidestrconsts.lismenujumpback
msgid "Jump Back"
msgstr "Saltar para trás"
#: lazarusidestrconsts.lismenujumpforward
msgid "Jump Forward"
msgstr "Saltar para frente"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Saltar para"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Saltar para Implementação"
#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr "Saltar para a \"uses\" da Implementação"
#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr "Saltar para Inicialização"
#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr "Saltar para Interface"
#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr "Saltar para a \"uses\" da Interface"
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Saltar para o próximo marcador"
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Saltar para o próximo erro"
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Saltar para o marcador anterior"
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Saltar para o erro anterior"
#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr "Saltar para o começo do procedimento"
#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr "Saltar para o cabeçalho do procedimento"
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Seleção em minúsculas"
#: lazarusidestrconsts.lismenumacrolistview
msgid "Editor Macros ..."
msgstr "Editor de macros ..."
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Criar recurso \"string\" ..."
#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr "Colar multi ..."
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Novo componente"
#: lazarusidestrconsts.lismenunewcustom
msgid "New %s"
msgstr "Novo(a) %s"
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Novo formulário"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Novo ..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Novo pacote ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Novo projeto ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Novo projeto do arquivo ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nova unidade"
#: lazarusidestrconsts.lismenuok
msgctxt "lazarusidestrconsts.lismenuok"
msgid "&OK"
msgstr "&OK"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Ajuda Online"
#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "A&brir ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "Abrir arquivo sob o cursor"
#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr "Abrir pasta ..."
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Abrir pacote carregado ..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Abrir arquivo de pacote (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Abrir pacote da unidade atual"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Abrir projeto ..."
#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Abrir &recente"
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Abrir pacote recente"
#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Abrir projeto recente"
#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr "Abrir unidade ..."
#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "Pa&cote"
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Gráfico de pacotes"
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Vínculos de pacotes ..."
#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Colar da área de transferência"
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Novo componente pacote"
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Lista de procedimentos..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projeto"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspetor de projetos"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Opções de projeto ..."
#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "E&xecutar"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publicar projeto ..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Compilação rápida"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Verificação rápida de sintaxe"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Verificação rápida de sintaxe OK"
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Remover do projeto ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Renomear identificador ..."
#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Reportando uma falha (\"bug\")"
#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr "Salvar novamente formulários com i18n habilitado"
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Reexaminar diretório dos fontes do FPC"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Parar o depurador"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Reverter"
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "Executa&r"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Executar arquivo"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "&Parâmetros de execução ..."
#: lazarusidestrconsts.lismenuruntocursor
msgid "Step over to &Cursor"
msgstr "Executar até o &cursor"
#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr "Executar sem depurar"
#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Salva&r"
#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Salvar &como ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Salvar projeto"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Salvar projeto como ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Localizar"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Selecionar"
#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Selecionar tudo"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Selecionar bloco de código"
#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Selecionar linha"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Selecionar parágrafo"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Selecionar até o colchete"
#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Selecionar palavra"
#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Definir um marcador livre"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "Exibir &ponto de execução"
#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr "Dica inteligente sensível ao contexto"
#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Ordenar seleção ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "F&onte"
#: lazarusidestrconsts.lismenustepinto
msgid "Step In&to"
msgstr "Passar &dentro"
#: lazarusidestrconsts.lismenustepintocontext
msgid "Step Into (Context)"
msgstr "Passar dentro (contexto)"
#: lazarusidestrconsts.lismenustepintoinstr
msgctxt "lazarusidestrconsts.lismenustepintoinstr"
msgid "Step Into Instruction"
msgstr "Passar dentro de instrução"
#: lazarusidestrconsts.lismenustepintoinstrhint
msgctxt "lazarusidestrconsts.lismenustepintoinstrhint"
msgid "Step Into Instruction"
msgstr "Passar dentro de instrução"
#: lazarusidestrconsts.lismenustepout
msgid "Step O&ut"
msgstr "Passar &fora"
#: lazarusidestrconsts.lismenustepover
msgid "&Step Over"
msgstr "Passar &sobre"
#: lazarusidestrconsts.lismenustepovercontext
msgid "Step Over (Context)"
msgstr "Passar sobre (contexto)"
#: lazarusidestrconsts.lismenustepoverinstr
msgctxt "lazarusidestrconsts.lismenustepoverinstr"
msgid "Step Over Instruction"
msgstr "Passar sobre instrução"
#: lazarusidestrconsts.lismenustepoverinstrhint
msgctxt "lazarusidestrconsts.lismenustepoverinstrhint"
msgid "Step Over Instruction"
msgstr "Passar sobre instrução"
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Trocar maiúscula/minúscula na seleção"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Tabulações para espaços na seleção"
#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "Sobre"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Alternar comentário na seleção"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Ferramentas"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Descomentar seleção"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Retirar recuo da seleção"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Seleção em maiúsculas"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Adicionar unidade à seção \"uses\" ..."
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "E&xibir"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Editor de âncora"
#: lazarusidestrconsts.lismenuviewassembler
msgctxt "lazarusidestrconsts.lismenuviewassembler"
msgid "Assembler"
msgstr "Assembler"
#: lazarusidestrconsts.lismenuviewbreakpoints
msgid "BreakPoints"
msgstr "Pontos de parada"
#: lazarusidestrconsts.lismenuviewcallstack
msgid "Call Stack"
msgstr "Chamada de pilha"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Navegador de código"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Explorador de código"
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Paleta de Componentes"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Componentes"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Registro de eventos"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Saída da depuração"
#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Formulários ..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Histórico"
#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Histórico de saltos"
#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Variáveis locais"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Mensagens"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspetor de Objetos"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "&Exibir fonte do projeto"
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr "Entrada/saída console"
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registradores"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Navegador de restrições"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Resultados da busca"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Editor de Código"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Ordem de tabulação"
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Threads"
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Alternar exibição formulário/unidade"
#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Dependências da unidade"
#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Informações da unidade ..."
#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Unidades ..."
#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Observadores"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "O que necessita construção"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Janela"
#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Outras tabulações"
#: lazarusidestrconsts.lismeprojects
msgid "Projects"
msgstr "Projetos"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Editor Mensagens"
#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Janela de Mensagens"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Classe do método não encontrada"
#: lazarusidestrconsts.lismissingdirectory
msgid "missing directory \"%s\""
msgstr "diretório faltando \"%s\""
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Eventos faltando"
#: lazarusidestrconsts.lismissingexecutable
msgid "missing executable \"%s\""
msgstr "executável faltando \"%s\""
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Identificadores faltando"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Pacotes faltando"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Suas opções são:"
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Comentar"
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Apenas para Delphi"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Comentar as unidades selecionadas."
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Usar as unidades apenas para Delphi."
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Procurar por unidades. Caminhos encontrados serão adicionados às configurações do projeto."
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Abort now, install packages or fix paths and try again."
msgstr "3) Abortar agora, instalar pacotes ou corrigir caminhos e tentar novamente."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Caminho Busca Unidades"
#: lazarusidestrconsts.lismissingunitsskip
msgid "Skip this Unit"
msgstr "Ignorar esta Unidade"
#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
msgstr ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE.\n"
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Adições e sobreposições"
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Adiciona opções customizadas:"
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Acrescenta opções arbitrárias do fpc, ex. -O1 -ghtl -dFlag"
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Aplicar à todos os pacotes."
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Aplicar à todos os pacotes e projetos."
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
msgid "Apply to all packages matching name \"%s\""
msgstr "Aplicar à todos os pacotes cujo nome coincidir a \"%s\""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Aplicar ao projeto."
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Criar um novo grupo de opções"
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Opção customizada"
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "Excluir o alvo ou opção selecionado"
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "Não adiciona opções customizadas:"
#: lazarusidestrconsts.lismmdoesnothaveidemacro
msgid "Does not have IDE Macro %s:=%s"
msgstr "Não contém Macro IDE %s:=%s"
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "Não sobrepõe OutDir (-FU)"
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
msgid "Exclude all packages matching name \"%s\""
msgstr "Excluir todos os pacotes cujos nomes correspondam com \"%s\""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
msgid "expected \":=\" after macro name but found \"%s\""
msgstr "esperado \":=\" após o nome da macro, mas encontrado \"%s\""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
msgid "expected macro name but found \"%s\""
msgstr "nome de macro esperado, mas encontrado \"%s\""
#: lazarusidestrconsts.lismmfromto
msgid "From %s to %s"
msgstr "De %s à %s"
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "Macro IDE"
#: lazarusidestrconsts.lismmidemacro2
msgid "IDE Macro %s:=%s"
msgstr "Macro IDE %s:=%s"
#: lazarusidestrconsts.lismminvalidcharacterat
msgid "invalid character \"%s\" at %s"
msgstr "caractere inválido \"%s\" em %s"
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
msgid "invalid character in macro value \"%s\""
msgstr "caractere inválido no valor de macro \"%s\""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "faltando nome de macro"
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Mover item selecionado abaixo"
#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Mover item selecionado acima"
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Novo alvo"
#: lazarusidestrconsts.lismmoverrideoutdirfu
msgid "Override OutDir (-FU): %s"
msgstr "Sobrepor OutDir (-FU): %s"
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Sobrepor diretório de saída (-FU)"
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "Sobrepor diretório de saída -FU do alvo"
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Refazer o último desfazer nesta grade"
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Definir uma macro IDE, ex.: LCLWidgetType:=win32"
#: lazarusidestrconsts.lismmsets
msgid "Set \"%s\""
msgstr "Definir \"%s\""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Armazenado na IDE (environmentoptions.xml)"
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Armazenado no projeto (.lpi)"
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Armazenado na sessão do projeto (.lps)"
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Alvos:"
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Desfazer última alteração nesta grade"
#: lazarusidestrconsts.lismmusesystemencoding
msgid "Use system encoding"
msgstr "Usar codificação do sistema"
#: lazarusidestrconsts.lismmusesystemencodinghint
msgid "Disable support for UTF-8 default string encoding."
msgstr "Desabilitar suporte para codificação \"string\" padrão UTF-8"
#: lazarusidestrconsts.lismmvalues
msgid "Value \"%s\""
msgstr "Valor \"%s\""
#: lazarusidestrconsts.lismmwas
msgid "(was \"%s\")"
msgstr "(era \"%s\")"
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr "Alteração \"widgeset\" está disponível apenas para projetos LCL"
#: lazarusidestrconsts.lismode
msgid ", Mode: %s"
msgstr ", Modo: %s"
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA.\n"
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"Esta biblioteca é software livre; você pode redistribuí-la e/ou moficá-la sob os termos da licença GNU Library General Public License como publicada pela Free Software Foundation; ou a versão 2 da Licença, ou (a sua escolha) qualquer versão posterior com as seguintes modificações:\n"
"\n"
"Como uma exceção especial, os detentores do copyright desta biblioteca dão permissão para usá-la com módulos independentes para produzir um executável, independentemente dos termos de licença destes módulos independentes, e copiar e distribuir o executável resultante sob os termos de sua escolha, desde que você encontre, para cada módulo independente vinculado, os termos e condições da licença daquele módulo. Um módulo independente e um módulo que não é derivado ou baseado nesta biblioteca. Se você modificar esta biblioteca você deve estender esta exceção a sua versão da biblioteca, mas não é obrigado a fazer isto. Se você não quiser fazer isto, elimine o estatuto desta exceção da sua versão.\n"
"\n"
"Este programa é distribuido na esperança de que seja útil, mas SEM QUALQUER GARANTIA; nem mesmo a garantia implícita de COMERCIABILIDADE ou ADEQUAÇÃO A UMA FINALIDADE PARTICULAR. Veja a licença GNU General Public License para maiores detalhes.\n"
"\n"
"Você deve ter recebido uma cópia da licença GNU Library General Public License juntamente com esta biblioteca; senão, escreva a Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.\n"
#: lazarusidestrconsts.lismodify
msgid "&Modify"
msgstr "&Modificar"
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Mais"
#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Mais"
#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Mover"
#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Mover arquivos"
#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "Mover arquivos?"
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Mover %s arquivo(s) de %s para o diretório%s%s%sde %s?"
#: lazarusidestrconsts.lismoveonepositiondown
msgid "Move \"%s\" one position down"
msgstr "Mover \"%s\" uma posição abaixo"
#: lazarusidestrconsts.lismoveonepositionup
msgid "Move \"%s\" one position up"
msgstr "Mover \"%s\" uma posição acima"
#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "Mover ou copiar arquivos?"
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Mover ou copiar %s arquivo(s) de %s para o diretório%s%s%sde %s?"
#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Mover Página"
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Mover item selecionado abaixo (Ctrl+Seta Abaixo)"
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Move item selecionado acima (Ctrl+Seta acima)"
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Mover para:"
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Mover estas unidades irá quebras suas seções \"uses\". Veja janela de mensagens para detalhes."
#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr "Estilo C: \" => \\\""
#: lazarusidestrconsts.lismpescapequotes
msgid "Escape "es"
msgstr "Escapar &aspas"
#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr "Colar multi"
#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr "Estilo Pascal: ' => ''"
#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr "&Opções de colagem"
#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr "Pré-&visualização"
#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr "Texto &após cada linha"
#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr "Texto a&ntes de cada linha"
#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr "Remover espaços do conteúdo da área de transferência"
#: lazarusidestrconsts.lisms
msgid "(ms)"
msgstr "(ms)"
#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr "Cores de mensagem"
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr "Diretórios múltiplos são separados com ponto-e-vírgulas"
#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ", pacotes múltiplos: "
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Salvar mensagens para arquivo (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Nome"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Conflito de nome"
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Nome do mode de construção ativo"
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nome do novo procedimento"
#: lazarusidestrconsts.lisnever
msgctxt "lazarusidestrconsts.lisnever"
msgid "Never"
msgstr "Nunca"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Novo"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nova Classe"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nova aplicação \"console\""
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
msgid "Create a new editor file.%sChoose a type."
msgstr "Criar um novo arquivo do editor.%sEscolha um tipo."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Criar um novo arquivo de texto vazio."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
msgid "Create a new project.%sChoose a type."
msgstr "Criar um novo projeto.%sEscolha um tipo."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Criar um novo pacote padrão.%sUm pacote é uma coleção de unidades e componentes."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Criar uma nova unidade com um \"datamodule\"."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Criar uma nova unidade com uma borda."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Criar uma nova unidade com um formulário LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Herdar de um formulário ou componente do projeto"
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nenhum item selecionado"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Favor selecionar um item primeiro."
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nova codificação:"
#: lazarusidestrconsts.lisnewmacroname
msgid "Macro %d"
msgstr "Macro %d"
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Novo nome de macro"
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr "Novas implementações de método são inseridas entre métodos existentes desta classe. Alfabeticamente, ou como último, ou na ordem de declaração."
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr "Novas declarações de método e membros na classe..seções finais são inseridas alfabeticamente ou adicionadas por último."
#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Nova página"
#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(novo projeto)"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Novas macros gravadas. Não é para serem salvas"
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "Novas unidades serão adicionadas à seção \"uses\""
#: lazarusidestrconsts.lisno
msgid "No"
msgstr "Não"
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Sem arquivo de segurança"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Nenhum perfil selecionado para ser construído."
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Sem alterações"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nenhum código selecionado"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Nenhuma opção de compilador herdada."
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "nenhuma dica"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Nenhuma janela da IDE selecionada"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Nenhum arquivo LFM"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Nenhuma macro selecionada"
#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr "(nenhuma mensagem selecionada)"
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "sem nome"
#: lazarusidestrconsts.lisnone
msgid "%snone"
msgstr "%snenhum"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "nenhum, clique para escolher"
#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr "(Nenhum selecionado)"
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "Nenhum nó selecionado"
#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "Nenhum arquivo Pascal"
#: lazarusidestrconsts.lisnoprogramfilesfound
msgid "No program file \"%s\" found."
msgstr "Nenhum arquivo de programa \"%s\" encontrado."
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Seção de recurso \"string\" não encontrada."
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalmente o filtro é uma expressão regular. Em sintaxe simples \".\" é um caractere normal, \"*\" significa qualquer coisa, \"?\" significa qualquer caractere e \",\" e \";\" separam alternativas. Por exemplo: sintaxe simples *.pas;*.pp corresponde a ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Nenhuma constante \"string\" encontrada"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "Não é um pacote de tempo de projeto"
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Não é um pacote de instalação"
#: lazarusidestrconsts.lisnotavalidpascalidentifier
msgid "Not a valid Pascal identifier"
msgstr "Não é um identificador Pascal válido"
#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr "Nota"
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Base"
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Esquerda"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Direita"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Topo"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "NOTA: Não foi possível criar Modelo Definições para fontes Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "NOTA: Não foi possível criar Modelo Definições para fontes Lazarus"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "nenhum modelo selecionado"
#: lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated
msgctxt "lazarusidestrconsts.lisnotfoundinatlinecolumnmaybethemessageisoutdated"
msgid "%s not found in %s at line %s, column %s.%sMaybe the message is outdated."
msgstr "%s não encontrada em %s na linha %s, coluna %s.%sTalvez a mensagem seja antiga."
#: lazarusidestrconsts.lisnotimplemented
msgid "Not implemented"
msgstr "Não implementado"
#: lazarusidestrconsts.lisnotimplementedyet
msgid "Not implemented yet:%s%s"
msgstr "Não implementado ainda:%s%s"
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "não instalado"
#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr "Pacotes não instalados"
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Agora não"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Carregado agora:"
#: lazarusidestrconsts.lisnpcreate
msgid "Create"
msgstr "Criar"
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Criar um novo projeto"
#: lazarusidestrconsts.lisnumberoffilestoconvert
msgid "Number of files to convert: %s"
msgstr "Número de arquivos à converter: %s"
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr "Inspetor de Objetos se torna visível quando componentes são selecionados no editor."
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Padrão - \"Object Pascal\""
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "caminho objeto"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Alternar para aba Favoritos do Inspetor de Objetos"
#: lazarusidestrconsts.lisoff
msgid "? (Off)"
msgstr "? (Desligado)"
#: lazarusidestrconsts.lisofpackage
msgid " of package %s"
msgstr " do pacote %s"
#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr " do Inspetor de projeto"
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Adicionar às propriedades favoritas"
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Escolha uma classe base para a propriedade favorita \"%s\"."
#: lazarusidestrconsts.lisoifclassnotfound
msgid "Class \"%s\" not found."
msgstr "Classe \"%s\" não encontrada."
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Excluir das propriedades favoritas"
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "instalação automática dinâmica"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "instalação automática estática"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Descrição: "
#: lazarusidestrconsts.lisoipdescriptiondescription
msgid "%sDescription: %s"
msgstr "%sDescrição: %s"
#: lazarusidestrconsts.lisoipfilename
msgid "Filename: %s"
msgstr "Nome de Arquivo: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "instalado dinamicamente"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "instalado estaticamente"
#: lazarusidestrconsts.lisoiplicenselicense
msgid "%sLicense: %s"
msgstr "%sLicença: %s"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "faltando"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "modificado"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Abrir pacote carregado"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nome do Pacote"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Favor selecionar um pacote"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "somente leitura"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Estado"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%sEste pacote está instalado, mas o arquivo LPK não foi encontrado"
#: lazarusidestrconsts.lisok
msgctxt "lazarusidestrconsts.lisok"
msgid "OK"
msgstr "OK"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Classe Antiga"
#: lazarusidestrconsts.lison
msgid "? (On)"
msgstr "? (Ligado)"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Na quebra linha (ou seja, teclas retorno ou \"enter\")"
#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr "disponível no repositório principal"
#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr "apenas 32bit"
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr "Apenas disponível no Windows. Executa a ferramenta em segredo."
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr "Apenas disponível no Windows. Executa a ferramenta em um novo console."
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr "Somente mensagens que correspondem a essa expressão regular:"
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr "Apenas mensagens com estes IDs FPC (separado por vírgula):"
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr "Apenas registrar os arquivos de pacote Lazarus (.lpk). Não construir."
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Somente localizar palavras inteiras"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Ao colar da Área de Transferência"
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Abrir"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Abrir como arquivo XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Abrir editor ao abrir unidade"
#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr "Formulário é carregado no editor sempre que a unidade do fonte é aberta."
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Abrir arquivo existente"
#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Abrir arquivo"
#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Abrir arquivo"
#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr "Abrir arquivo sob o cursor"
#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr "Abrir no gerenciador de arquivos"
#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr "Abrir diretório de destino no gerenciador de arquivos"
#: lazarusidestrconsts.lisopenlfm
msgid "Open %s"
msgstr "Abrir %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Abrir Pacote?"
#: lazarusidestrconsts.lisopenpackage2
msgid "Open package %s"
msgstr "Abrir pacote %s"
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Abrir Arquivo de Pacote"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Abrir projeto?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Abrir projeto"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Abrir projeto novamente"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Abrir Arquivo de Projeto"
#: lazarusidestrconsts.lisopensymlink
msgid "Open symlink"
msgstr "Abrir vínculo simbólico"
#: lazarusidestrconsts.lisopentarget
msgid "Open target"
msgstr "Abrir alvo"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Abrir arquivo como código normal"
#: lazarusidestrconsts.lisopenthepackage
msgid "Open the package %s?"
msgstr "Abrir o pacote %s?"
#: lazarusidestrconsts.lisopentheproject
msgid "Open the project %s?"
msgstr "Abrir o projeto %s?"
#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr "Abrir opções de ferramenta"
#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr "Abrir unidade"
#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr "Abrir URL"
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Abrir XML"
#: lazarusidestrconsts.lisoptions
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Opções"
#: lazarusidestrconsts.lisoptionschangedrecompilingcleanwithb
msgid "Options changed, recompiling clean with -B"
msgstr "Opções alteradas, recompilando após limpeza com -B"
#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr "ignorado"
#: lazarusidestrconsts.lisor
msgid "or"
msgstr "ou"
#: lazarusidestrconsts.lisos
msgid ", OS: %s"
msgstr ", SO: %s"
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr "outros caminhos de fontes de pacote \"%s\" contém diretório \"%s\", que já está no caminho de busca de unidades."
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr "diretório de saída de %s contém fonte de unidade pascal \"%s\""
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgstr "Sobrepor idioma. Por exemplo --language=de. Veja os valores possíveis no diretório \"languages\"."
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr "Sobrepor tipos \"string\" de resultado de função com o primeiro tipo de expressão do parâmetro"
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgstr "%ssobrepor o compilador padrão. ex. ppc386 ppcx64 ppcppc etc. padrão é armazenado em \"environmentoptions.xml\""
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "%soverride the project or IDE build mode."
msgstr "%ssobrepõe o projeto ou modo de construção da IDE."
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgstr "%ssobrepor a cpu do projeto. ex. i386 x86_64 powerpc powerpc_64 etc. padrão: %s"
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgstr "%ssobrepor o sistema operacional do projeto. ex. win32 linux. padrão: %s"
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgstr "%ssobregarrega o \"widgetset\" do projeto. ex. gtk gtk2 qt win32 carbon. padrão: %s"
#: lazarusidestrconsts.lisoverwritefile
msgid "Overwrite file?"
msgstr "Sobrescrever arquivo?"
#: lazarusidestrconsts.lisoverwritefileondisk
msgid "Overwrite file on disk"
msgstr "Sobrescrever arquivo em disco"
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Proprietário' já usado por TReader/TWriter. Favor escolher outro nome."
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Pacote"
#: lazarusidestrconsts.lispackage2
msgid "package %s"
msgstr "pacote %s"
#: lazarusidestrconsts.lispackage3
msgid ", package %s"
msgstr ", pacote %s"
#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Informação do pacote"
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Nome do pacote começa com ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Nome do pacote contém ..."
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr "Pacote necessita de diretório de saída."
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Pacote necessita instalação"
#: lazarusidestrconsts.lispackageoption
msgid "Package \"%s\" Option"
msgstr "Opção pacote \"%s\""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Diretórios de saída de pacotes"
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Diretórios de fontes de pacotes"
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr "pacotes=%s/%s unidades=%s/%s identificadores=%s/%s linhas=%s bytes=%s"
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "unidade pacote"
#: lazarusidestrconsts.lispage
msgid "Page"
msgstr "Página"
#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr "Nome página"
#: lazarusidestrconsts.lispagenamealreadyexists
msgid "Page name \"%s\" already exists. Not added."
msgstr "Nome de página \"%s\" já existe. Não adicionado."
#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr "Pânico"
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", analisado"
#: lazarusidestrconsts.lisparser
msgid "parser \"%s\": %s"
msgstr "analisar \"%s\": %s"
#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr "Analisadores:"
#: lazarusidestrconsts.lispasscount
msgid "Pass Count"
msgstr "Núm. Passos"
#: lazarusidestrconsts.lispassingcompilerdefinetwicewithdifferentvalues
msgid "passing compiler define \"%s\" twice with different values"
msgstr "passando definição de compilador \"%s\" duas vezes com valores diferentes"
#: lazarusidestrconsts.lispassingcompileroptiontwicewithdifferentvalues
msgid "passing compiler option -%s twice with different values"
msgstr "passando opção de compilador -%s duas vezes com valores diferentes"
#: lazarusidestrconsts.lispaste
msgctxt "lazarusidestrconsts.lispaste"
msgid "Paste"
msgstr "Colar"
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "colar área de transferência"
#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Colar da área de transferência."
#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr "Cores pastéis"
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Caminho"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Navegar"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Excluir caminhos inválidos"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Mover caminho abaixo (Ctrl+Seta Abaixo)"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Move caminho acima (Ctrl+Seta acima)"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Adicionar novo caminho à lista"
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Excluir o caminho selecionado"
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Excluir caminhos inexistentes (cinza) da lista"
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Substituir o caminho selecionado por um novo"
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Adicionar modelo à lista"
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Modelos de caminho"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Caminhos de busca:"
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "caminho do cache instantfpc"
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Caminho do utilitário \"make\""
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Caminho para Instância com falha:"
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Pausar"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Limpar para usar o nome do pacote"
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Desabilitar I18N do lfm"
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr "Adicionar arquivos do sistema de arquivo"
#: lazarusidestrconsts.lispckeditaddotheritems
msgid "Add other items"
msgstr "Adicionar outros itens"
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Adicionar ao projeto"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Aplicar alterações"
#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr "(disponível online)"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Chamar procedimento de %sRegistro%s da unidade selecionada"
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Limpar dependências ..."
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Limpar nome arquivo padrão/preferencial da dependência"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Compilar tudo?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compilar pacote"
#: lazarusidestrconsts.lispckeditcompileroptionsforpackage
msgid "Compiler Options for Package %s"
msgstr "Opções do compilador para o pacote %s"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "Criar fpmake.pp"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Criar \"Makefile\""
#: lazarusidestrconsts.lispckeditdefault
msgid "%s, default: %s"
msgstr "%s, padrão: %s"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Propriedades de Dependência"
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit general options"
msgstr "Editar opções gerais"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Propriedades do Arquivo"
#: lazarusidestrconsts.lispckeditfpmakepackage
msgid "(fpmake)"
msgstr "(fpmake)"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Instalar"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Versão máxima inválida"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Versão mínima inválida"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Versão Máxima:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Versão Mínima:"
#: lazarusidestrconsts.lispckeditmodified
msgid "Modified: %s"
msgstr "Modificado: %s"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Mover dependência abaixo"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Mover dependência acima"
#: lazarusidestrconsts.lispckeditpackage
msgid "Package %s"
msgstr "Pacote %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Pacote \"%s\" foi alterado.%sSalvar pacote?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
msgid "package %s not saved"
msgstr "pacote %s não salvo"
#: lazarusidestrconsts.lispckeditpage
msgid "%s, Page: %s"
msgstr "%s, Página: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Re-adicionar dependência"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Re-adicionar arquivo"
#: lazarusidestrconsts.lispckeditreadonly
msgid "Read Only: %s"
msgstr "Somente leitura: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Recompilar tudo requerido"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Recompilar limpo"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Re-compilar este e todos os pacotes requeridos?"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Complementos registrados"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Unidade de registro"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Remover dependência"
#: lazarusidestrconsts.lispckeditremovedependency2
msgid "Remove Dependency?"
msgstr "Remover Dependência?"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Remover dependência \"%s\"%s do pacote \"%s\"?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Arquivos excluídos"
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Pacotes requeridos removidos"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Remover arquivo"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Remover arquivo?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Remover arquivo \"%s\"%sdo pacote \"%s\"?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Remover item selecionado"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Pacotes Requeridos"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Salvar pacote"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Armazenar nome arquivo como padrão para esta dependência"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Armazenar nome arquivo como preferencial para esta dependência"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "A versão máxima \"%s\" não é uma versão de pacote válida.%s(bom exemplo 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "A versão mínima \"%s\" não é uma versão de pacote válida.%s(bom exemplo 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Desinstalar"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Exibir fonte do pacote"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "Base, não pode ser desinstalada"
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Instalado"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Instalar na próxima inicialização"
#: lazarusidestrconsts.lispckexplstate
msgid "%sState: "
msgstr "%sEstado: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Desinstalar na próxima inicialização (a menos que seja necessário à um pacote instalado)"
#: lazarusidestrconsts.lispckexpluninstallpackage
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Desinstalar pacote %s"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Adicionar opções para pacotes e projetos dependentes"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Adicionar caminhos para pacotes/projetos dependentes"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Autor"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Auto reconstruir se necessário"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Auto reconstruir quando reconstruindo tudo"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Personalizado"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Descrição / Abstrato"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Tempo de projeto"
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Tempo de projeto e tempo de execução"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Integração com a IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Incluir"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Tipo de pacote inválido"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Biblioteca"
#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Licença"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Vinculador"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Maior:"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Compilação manual (nunca automaticamente)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Menor:"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objeto"
#: lazarusidestrconsts.lispckoptspackageoptions
msgid "Package Options"
msgstr "Opções do Pacote"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Tipo de pacote"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Provisão"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Lançamento"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Tempo de execução"
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "O pacote \"%s\" tem o \"flag\" de instalação automática.%sIsto significa que ele será instalado na IDE.%sPacotes de Instalação devem ser pacotes de Tempo de Projeto."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Este pacote provê o mesmo que os pacotes à seguir:"
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Atualizar / Reconstruir"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Uso"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Pacote:"
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Camihos de busca por arquivos xml fpdoc. Múltiplos caminhos devem ser separados por ponto e vírgula."
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Exibir dependências desnecessárias"
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Quando o formulário é salvo, a IDE pode armazenar todas as propriedades TTranslateString para o arquivo po do pacote. Para isso você deve habilitar o I18N para este pacote, providenciar um diretório de saída para o arquivo po e deixar esta opção desmarcada."
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Abortar"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progresso"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Retrair diretório"
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Conflito encontrado"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Editar Unidade Virtual"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Expandir diretório"
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Arquivo:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Corrigir Nome de Arquivos"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nome de arquivo de unidade inválido"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nome de unidade inválido"
#: lazarusidestrconsts.lispemissingfilesofpackage
msgid "Missing files of package %s"
msgstr "Arquivos faltando no pacote %s"
#: lazarusidestrconsts.lispendingon
msgid "Pending (On)"
msgstr "Pendente (Ligado)"
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Novo arquivo não está no caminho de inclusões"
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Nenhum arquivo faltando. Todos existem."
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Remover arquivos"
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Reverter pacote"
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Salvar pacote como ..."
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Exibir hierarquia de diretórios"
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Exibir arquivos faltando"
#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Ordenar arquivos permanentemente"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Ordenar arquivos alfabeticamente"
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "O arquivo \"%s\" não está atualmente no caminho de inclusões do pacote.%sAdicionar \"%s\" ao caminho de inclusões?"
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nome de unidade:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Usar todas as unidades no diretório"
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Não usar nenhuma unidade no diretório"
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Limpar dependências de pacote"
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Limpar seleção"
#: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition
msgid "CompiledSrcPath addition"
msgstr "Caminho adicional para fontes compilados"
#: lazarusidestrconsts.lispkgdefsnamespaces
msgid "Namespaces"
msgstr "Espaços de nome"
#: lazarusidestrconsts.lispkgdefsoutputdirectory
msgid "Output directory"
msgstr "Diretório de saída"
#: lazarusidestrconsts.lispkgdefssrcdirmark
msgid "Package Source Directory Mark"
msgstr "Marca do Diretório Fonte do Pacote"
#: lazarusidestrconsts.lispkgdefsunitpath
msgid "Unit Path"
msgstr "Caminho de unidade"
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Excluir dependências"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Você deseja realmente ignorar todas as alterações no pacote %s e recarregá-lo do arquivo?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nova unidade não está no caminho de unidades"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publicar Pacote"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Reverter pacote?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "O arquivo \"%s\"%snão está atualmente no caminho de unidades do pacote.%sAdicionar \"%s\" ao caminho de unidades?"
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr "Mais funções para o pacote"
#: lazarusidestrconsts.lispkgfiletypebinary
msgctxt "lazarusidestrconsts.lispkgfiletypebinary"
msgid "Binary"
msgstr "Binário"
#: lazarusidestrconsts.lispkgfiletypeinclude
msgid "Include file"
msgstr "Arquivo de Inclusão"
#: lazarusidestrconsts.lispkgfiletypeissues
msgid "Issues xml file"
msgstr "Despacha arquivo xml"
#: lazarusidestrconsts.lispkgfiletypelfm
msgid "LFM - Lazarus form text"
msgstr "LFM - Lazarus Form Text (Formulários)"
#: lazarusidestrconsts.lispkgfiletypelrs
msgid "LRS - Lazarus resource"
msgstr "LRS - Lazarus Resource (Recursos)"
#: lazarusidestrconsts.lispkgfiletypemainunit
msgid "Main Unit"
msgstr "Unidade Principal"
#: lazarusidestrconsts.lispkgfiletypetext
msgctxt "lazarusidestrconsts.lispkgfiletypetext"
msgid "Text"
msgstr "Texto"
#: lazarusidestrconsts.lispkgfiletypevirtualunit
msgid "Virtual Unit"
msgstr "Unidade Virtual"
#: lazarusidestrconsts.lispkgmacropackagedirectoryparameterispackageid
msgid "Package directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Diretório de pacote. Parâmetro é a ID do pacote, ex. \"Nome\" ou \"Nome 1.0\""
#: lazarusidestrconsts.lispkgmacropackageincludefilessearchpathparameterispackageid
msgid "Package include files search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Caminho de busca de arquivos de inclusão de pacote. Parâmetro é a ID do pacote, ex. \"Nome\" ou \"Nome 1.0\""
#: lazarusidestrconsts.lispkgmacropackagenameparameterispackageid
msgid "Package name. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Nome de pacote. Parâmetro é a ID do pacote, ex. \"Nome\" ou \"Nome 1.0\""
#: lazarusidestrconsts.lispkgmacropackageoutputdirectoryparameterispackageid
msgid "Package output directory. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Diretório de saída de pacote. Parâmetro é a ID do pacote, ex. \"Nome\" ou \"Nome 1.0\""
#: lazarusidestrconsts.lispkgmacropackagesourcesearchpathparameterispackageid
msgid "Package source search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Caminho de busca de fonte de pacote. Parâmetro é a ID do pacote, ex. \"Nome\" ou \"Nome 1.0\""
#: lazarusidestrconsts.lispkgmacropackageunitsearchpathparameterispackageid
msgid "Package unit search path. Parameter is package ID, e.g. \"Name\" or \"Name 1.0\""
msgstr "Caminho de busca de unidade de pacote. Parâmetro é a ID do pacote, ex. \"Nome\" ou \"Nome 1.0\""
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sAdicionando nova dependência para o pacote %s: pacote %s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sAdicionando nova dependência para o projeto %s: pacote %s"
#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr "Adicionar unidade à cláusula \"uses\" do arquivo principal do pacote. Desabilitar isto apenas para unidades que não devem ser compiladas em todos os casos."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Unidade ambígua encontrado"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Pacotes instalados automaticamente"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sAmbos os pacotes estão vinculados. Isto significa que um pacote usa o outro, ou ambos são usados por um terceiro pacote."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dependência quebrada"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Dependências circulares encontradas"
#: lazarusidestrconsts.lispkgmangcompilepackage
msgid "Compile package %s"
msgstr "Compilar pacote %s"
#: lazarusidestrconsts.lispkgmangdeletefailed
msgid "Delete failed"
msgstr "Falha na exclusão"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Excluir arquivo de pacote antigo?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
msgid "Delete old package file \"%s\"?"
msgstr "Excluir arquivo de pacote antigo \"%s\"?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
msgid "Dependency without Owner: %s"
msgstr "Dependência sem proprietário: %s"
#: lazarusidestrconsts.lispkgmangerrorreadingfile
msgid "Error reading file"
msgstr "Erro na leitura do arquivo"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Erro na leitura do Pacote"
#: lazarusidestrconsts.lispkgmangerrorupdatingpofilesfailedforpackage
msgid "Error: updating po files failed for package %s"
msgstr "Erro: atualização arquivos \"po\" falhou para pacote %s"
#: lazarusidestrconsts.lispkgmangerrorwritingfile
msgctxt "lazarusidestrconsts.lispkgmangerrorwritingfile"
msgid "Error writing file"
msgstr "Erro na escrita do arquivo"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Erro na escrita do Pacote"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Arquivo já está no pacote"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Arquivo está no Projeto"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Nome do arquivo difere do Nome do Pacote"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Nome de arquivo em uso por outro pacote"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Nome de arquivo em uso pelo projeto"
#: lazarusidestrconsts.lispkgmangfilenotfound
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "Arquivo \"%s\" não encontrado."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Arquivo não salvo"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
msgid "Installing the package %s will automatically install the package:"
msgstr "Instalando o pacote %s instalará automaticamente o pacote:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
msgid "Installing the package %s will automatically install the packages:"
msgstr "Instalando o pacote %s instalará automaticamente os pacotes:"
#: lazarusidestrconsts.lispkgmanginvalidcompilerfilename
msgid "invalid Compiler filename"
msgstr "Nome de arquivo do compilador inválido"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Extensão de arquivo inválida"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Extensão do arquivo de pacote inválida"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nome de arquivo do pacote inválido"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nome de pacote inválido"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nome de Pacote Inválido"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Carregar o pacote %s substituirá o pacote %s%sdo arquivo %s.%sO pacote antigo pacote será alterado.%sSalvar pacote antigo %s?"
#: lazarusidestrconsts.lispkgmangnewpackage
msgid "NewPackage"
msgstr "NovoPacote"
#: lazarusidestrconsts.lispkgmangpackage
msgid "Package: %s"
msgstr "Pacote: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Conflitos de Pacotes"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "Pacote não é um pacote de tempo de projeto"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Pacote requerido"
#: lazarusidestrconsts.lispkgmangpackagemainsourcefile
msgid "package main source file"
msgstr "arquivo fonte principal do pacote"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "O nome do pacote já existe"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Pacotes devem ter a extensão .LPK"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Favor compilar o pacote primeiro."
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Favor salvar o arquivo antes de adicioná-lo a um pacote."
#: lazarusidestrconsts.lispkgmangproject
msgid "Project: %s"
msgstr "Projeto: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Reconstruir Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Renomear Arquivo para minúsculas?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
msgid "Replace existing file \"%s\"?"
msgstr "Substituir arquivo existente \"%s\"?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Substituir Arquivo"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Um ou mais pacotes requeridos não foram encontrados. Veja gráfico de pacotes para detalhes."
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name.\n"
msgstr ""
"O pacote %s já está aberto na IDE.\n"
"Você não pode salvar um pacote com o mesmo nome.\n"
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Salvar Pacote?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
msgid "Save Package %s (*.lpk)"
msgstr "Salvar Pacote %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "O arquivo deve ser renomeado em minúsculas para%s\"%s\"?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Ignorar este pacote"
#: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile
msgid "static packages config file"
msgstr "Arquivo de configuração de pacotes estáticos"
#: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable
msgid "The compiler file for package %s is not a valid executable:%s%s"
msgstr "O arquivo de compilador para o pacote %s não é um executável válido:%s%s"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "O arquivo \"%s\"%sjá está no pacote %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
msgid "The file \"%s\" is not a Lazarus package."
msgstr "O arquivo \"%s\" não é um pacote Lazarus."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "O nome de arquivo \"%s\" não corresponde ao nome de pacote \"%s\" no arquivo.%sAlterar nome do pacote para \"%s\"?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "O nome de arquivo \"%s\" é parte do projeto atual.%sProjetos e pacotes não devem compartilhar arquivos."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "O nome de arquivo \"%s\" está em uso por %so pacote \"%s\"%sno arquivo \"%s\"."
#: lazarusidestrconsts.lispkgmangthefileofpackagewasnotfound
msgid "The file \"%s\" of package %s was not found."
msgstr "O arquivo \"%s\" do pacote %s não foi encontrado."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Falha ao carregar o seguinte pacote:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Falha ao carregar os seguintes pacotes:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sAs seguintes unidades serão adicionadas a seção \"uses\" de%s%s:%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati
msgid "The package \"%s\" failed to compile.%sRemove it from the installation list?"
msgstr "Falha ao compilar o pacote \"%s\".%sRemovê-lo da lista de instalação?"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "O nome de arquivo do pacote \"%s\" em%s\"%s\" não é um nome de pacote Lazarus válido."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "O pacote %s é um pacote apenas de tempo de execução.%sOs pacotes de tempo de execução, não podem ser instalados no IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "O pacote \"%s\" é compilado automaticamente e seu diretório de saída é \"%s\", ao qual está no caminho padrão de buscas de unidades do compilador. O pacote usa outros pacotes que também usam o caminho padrão de buscas de unidades do compilador. Isto cria um laço infinito.%sVocê pode resolver este problema removendo o caminho de sua configuração de compilador (ex. fpc.cfg)%sou desabilitando a auto atualização deste pacote ou removendo dependências."
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "O pacote \"%s\" está marcado para instalação, mas não foi encontrado.%sRemover dependência da lista de instalação de pacotes?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "O pacote %s é requerido por %s, que está marcado para instalação.%sVeja o gráfico de pacotes."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "O nome de pacote \"%s\" não é válido%sFavor escolher outro nome (ex: package1.lpk)"
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "O nome de pacote \"%s\" de%sdo arquivo \"%s\" é inválido."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "O pacote \"%s\" foi marcado.%sAtualmente o Lazarus apenas suporta pacotes estaticamente vinculados. A desinstalação real necessita reconstruir e reiniciar o Lazarus.%sReconstruir o Lazarus agora?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "O pacote \"%s\" foi marcado para instalação.%sAtualmente o Lazarus apenas suporta pacotes estaticamente vinculados. A instalação real necessita reconstruir e reiniciar o Lazarus.%sReconstruir o Lazarus agora?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "O projeto requer o pacote \"%s\".%sMas ele não foi encontrado. Veja Projeto -> Inspetor de projetos."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Há duas unidades com o mesmo nome:%s1. \"%s\" de %s%s2. \"%s\" de %s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "Há uma dependência circular nos pacotes. Veja gráfico de pacotes."
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Há uma unidade FPC com o mesmo nome do pacote:%s\"%s\" "
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Há uma unidade FPC com o mesmo nome como: %s\"%s\" de %s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Há outro pacote com o nome \"%s\".%sPacote em conflito: \"%s\"%sArquivo: \"%s\""
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Já existe um pacote \"%s\" carregado%sdo arquivo \"%s\".%sVeja Pacotes -> Gráfico de pacotes.%sImpossível substituir."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Há um pacote não salvo nos pacotes requeridos. Veja o gráfico de pacotes."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Há uma unidade com o mesmo nome do pacote:%s1. \"%s\" de %s%s2. \"%s\""
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Este é um pacote virtual. Ele não tem um fonte ainda. Favor salvar o pacote primeiro."
#: lazarusidestrconsts.lispkgmangunabletocreatedirectory
msgid "Unable to create directory"
msgstr "Incapaz de criar o diretório"
#: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage
msgid "Unable to create output directory \"%s\"%sfor package %s."
msgstr "Incapaz de criar o diretório de saída \"%s\"%spara o pacote %s."
#: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage
msgid "Unable to create package source directory \"%s\"%sfor package %s."
msgstr "Incapaz de criar um diretório fonte de pacote \"%s\"%spara o pacote %s."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Incapaz de criar diretório alvo para o Lazarus:%s\"%s\".%sEste diretório é necessário para a nova IDE alterada com seus pacotes personalizados."
#: lazarusidestrconsts.lispkgmangunabletodeletefile
msgid "Unable to delete file \"%s\"."
msgstr "Incapaz de excluir arquivo \"%s\"."
#: lazarusidestrconsts.lispkgmangunabletodeletefilename
msgid "Unable to delete file"
msgstr "Incapaz de excluir arquivo"
#: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage
msgid "Unable to delete old state file \"%s\"%sfor package %s."
msgstr "Incapaz de excluir arquivo de estado antigo \"%s\"%spara pacote %s."
#: lazarusidestrconsts.lispkgmangunabletoloadpackage
msgid "Unable to load package"
msgstr "Incapaz de carregar pacote"
#: lazarusidestrconsts.lispkgmangunabletoopenthepackage
msgid "Unable to open the package \"%s\".%sThis package was marked for installation."
msgstr "Incapaz de abrir o pacote \"%s\".%sEsse pacote foi marcado para instalação."
#: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror
msgid "Unable to read state file \"%s\"%sof package %s.%sError: %s"
msgstr "Incapaz de ler arquivo de estado \"%s\"%sdo pacote %s.%sErro: %s"
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Incapaz de gravar pacote \"%s\"%spara o arquivo \"%s\".%sErro: %s"
#: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror
msgid "Unable to write state file \"%s\"%sof package %s.%sError: %s"
msgstr "Incapaz de gravar arquivo de estado \"%s\"%sdo pacote %s.%sErro: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Desinstalar pacote?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
msgid "Uninstall package %s?"
msgstr "Desinstalar pacote %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Pacote não salvo"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Usar unidade"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Aviso: O arquivo \"%s\"%spertence ao projeto atual."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "manter"
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "novo"
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "remover"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Selecione um pacote"
#: lazarusidestrconsts.lispkgsinstalled
msgctxt "lazarusidestrconsts.lispkgsinstalled"
msgid "Installed"
msgstr "Instalado"
#: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit
msgid "Cannot register components without unit"
msgstr "Incapaz de registrar componentes sem uma unidade"
#: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined
msgid "Component Class \"%s\" already defined"
msgstr "Classe de componente \"%s\" já definida"
#: lazarusidestrconsts.lispkgsysfilename
msgid "%s%sFile Name: \"%s\""
msgstr "%s%sNome do Aquivo: \"%s\""
#: lazarusidestrconsts.lispkgsysinvalidcomponentclass
msgid "Invalid component class"
msgstr "Classe de componente inválida"
#: lazarusidestrconsts.lispkgsysinvalidunitname
msgid "Invalid Unitname: %s"
msgstr "Nome de unidade inválido: %s"
#: lazarusidestrconsts.lispkgsyslpkfilename
msgid "%s%slpk file: \"%s\""
msgstr "%s%sarquivo lpk: \"%s\""
#: lazarusidestrconsts.lispkgsyspackagefilenotfound
msgid "Package file not found"
msgstr "Arquivo de pacote não encontrado"
#: lazarusidestrconsts.lispkgsyspackageregistrationerror
msgid "Package registration error"
msgstr "Erro registro pacote"
#: lazarusidestrconsts.lispkgsysregisterprocedureisnil
msgid "Register procedure is nil"
msgstr "Procedimento de Registro nulo (\"nil\")"
#: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering
msgid "RegisterUnit was called but no package is registering."
msgstr "\"RegisterUnit\" foi chamada, mas o nenhum pacote está registrando."
#: lazarusidestrconsts.lispkgsysthelpkfilewasnotfound
msgid "%s%sThe lpk file was not found."
msgstr "%s%sO arquivo lpk não foi encontrado."
#: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound
msgid "The package \"%s\" is installed but no valid package file (.lpk) was found.%sA broken dummy package was created."
msgstr "O pacote \"%s\" está instalado, mas nenhum arquivo de pacote válido (.lpk) foi encontrado.%sUm pacote fictício foi criado."
#: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents
msgid "This is the default package. Used only for components without a package. These components are outdated."
msgstr "Este é o pacote padrão. Usado apenas para componentes sem um pacote. Estes componentes são obsoletos."
#: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound
msgid "This package is installed but the lpk file was not found. All its components are deactivated. Please fix this."
msgstr "Este pacote está instalado, mas o arquivo LPK não foi encontrado. Todos os seus componentes estão desativados. Favor corrigir."
#: lazarusidestrconsts.lispkgsysunitname
msgid "%s%sUnit Name: \"%s\""
msgstr "%s%sNome de unidade: \"%s\""
#: lazarusidestrconsts.lispkgsysunitwasnotfoundinthelpkfileprobablythislpkfilewasn
msgid "Unit \"%s\" was not found in the lpk file.%sProbably this lpk file was not used for building this IDE. Or the package misuses the procedure RegisterUnit."
msgstr "Unidade \"%s\" não encontrada no arquivo lpk.%sProvavelmente este arquivo lpk não foi usado na construção desta IDE. Ou o pacote utiliza indevidamente o procedimento \"RegisterUnit\"."
#: lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk
msgctxt "lazarusidestrconsts.lispkgsysunitwasremovedfrompackagelpk"
msgid "Unit \"%s\" was removed from package (lpk)"
msgstr "Unidade \"%s\" removida do pacote (lpk)"
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr "As seguintes dependências são desnecessárias, devido à transitoriedade automática entre dependências de pacote."
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "O projeto sobrepõe o diretório de saída dos seguintes pacotes.%sVeja Projeto / Opções de projeto (seção opções compilador) / Adições e sobreposições%s%s"
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "O arquivo não está em nenhum pacote carregado."
#: lazarusidestrconsts.lispkgtransitivity
msgid "Transitivity"
msgstr "Transitoriedade"
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Incapaz de ler arquivo de pacote \"%s\".%sErro: %s"
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Reproduzir"
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Global"
#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr "Online"
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr "Pacotes online não podem ser apagados"
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Vínculos de pacotes"
#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr "Exibir vínculos globais em "
#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr "Exibir vínculos online"
#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr "Exibir vínculos de usuário em "
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr "Alguns pacotes não podem ser apagados"
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Usuário"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr "Favor corrigir o erro mostrado na janela de mensagens, que se localiza normalmente abaixo do editor de código."
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Favor abrir uma unidade antes de executar."
#: lazarusidestrconsts.lispleaseselectatleastonebuildmode
msgid "Please select at least one build mode."
msgstr "Favor selecionar ao menos um modo de construção."
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Favor selecionar algum código para extrair um novo procedimento/método."
#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Todos>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Alterar Fonte"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copiar nome de método para Área de Transferência"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrar por correspondência com qualquer parte do método"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrar por correpondência com início do método"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Saltar para a seleção"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Nenhum>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objetos"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Lista de Procedimentos"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Escolha o diretório do arquivo .po"
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Não salvar informações de sessão"
#: lazarusidestrconsts.lispointer
msgid "Pointer"
msgstr "Ponteiro"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr "Salvar em arquivo .lps no diretório de configurações da IDE"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Salvar em arquivo .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Salvar em arquivo .lps no diretório de projeto"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Salvar informação de sessão em"
#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ".lpi é o arquivo de informação principal do projeto, .lps é um arquivo separado para os dados de sessão apenas."
#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr "Posição"
#: lazarusidestrconsts.lispositionoutsideofsource
msgid "%s (position outside of source)"
msgstr "%s (posição fora do fonte)"
#: lazarusidestrconsts.lisppuinwrongdirectory
msgid "ppu in wrong directory=%s."
msgstr "ppu em diretório errado=%s"
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr "%s.ppu não encontrado. Verificar seu fpc.cfg."
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Palavra precedente"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
msgid "primary config directory where Lazarus stores its config files. Default is "
msgstr "diretório primário de configuração, onde Lazarus armazena seus arquivos de configuração. O padrão é "
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Caminho primário configuração"
#: lazarusidestrconsts.lisprior
msgid "prior %s"
msgstr "anterior a %s"
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Prioridade"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Privado"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Método Privado"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Provavelmente você necessita instalar alguns pacotes antes de continuar.%sAviso:%sO projeto usa os seguintes pacotes de tempo de projeto, que podem ser necessários para abrir o formulário no editor. Se você continuar, poderá obter erros de componentes faltando e a carga do formulário provavelmente criará resultados indesejáveis.%sÉ recomendado cancelar e instalar estes pacotes primeiro."
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Procedimento"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procedimento com interface"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programa"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Programa detectado"
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Um programa de linha de comando Free Pascal com algumas definições úteis adicionadas."
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "O fonte do programa precisa ter uma extensão Pascal como .pas, .pp ou .lpr"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Já existe a dependência"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Adicionar arquivos do editor"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Versão Min-Max inválida"
#: lazarusidestrconsts.lisprojaddinvalidpascalunitname
msgid "Invalid Pascal unit name"
msgstr "Nome de unidade Pascal inválido"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Versão Inválida"
#: lazarusidestrconsts.lisprojaddlocalpkg
msgid "Local (%s)"
msgstr "Local (%s)"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Versão Máxima (opcional):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Versão Mínima (opcional):"
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr "Novo requerimento FPMake"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Novo requerimento"
#: lazarusidestrconsts.lisprojaddonlinepkg
msgid "Online (%s)"
msgstr "Online (%s)"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nome do Pacote:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Pacote não encontrado"
#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr "Tipo de pacote:"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "A dependência \"%s\" não foi encontrada.%sFavor escolher um pacote existente."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "A versão máxima \"%s\" é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "A versão máxima é menor que a versão mínima."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "A versão mínima \"%s\" é inválida.%sFavor usar o formato maior.menor.lançamento.construção%sPor exemplo: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
msgid "The project has already a dependency for the package \"%s\"."
msgstr "o projeto já tem uma dependência para o pacote \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "O nome de unidade \"%s\" já existe no projeto%scom arquivo: \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "O nome de unidade \"%s\" já existe na seleção%scom arquivo: \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier
msgid "The unit name \"%s\" is not a valid Pascal identifier."
msgstr "O nome de unidade \"%s\" não é um identificador Pascal válido."
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Nome da unidade já existe"
#: lazarusidestrconsts.lisproject
msgid "Project %s"
msgstr "Projeto %s"
#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Projeto:"
#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "projeto"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Projeto alterado"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Projeto alterado no disco"
#: lazarusidestrconsts.lisprojectcount
msgid "%d projects"
msgstr "%d projetos"
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Diretório do projeto"
#: lazarusidestrconsts.lisprojectdirectoryisshowedinidetitlebar
msgid "Title in taskbar shows also directory path of the project"
msgstr "Título na Barra de Tarefas também mostra o caminho do projeto"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nome de arquivo do projeto"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Caminho inclusões do projeto"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Arquivo de informações de projeto detectado"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Projeto é executável"
#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr "Gera um executável binário que pode ser executado."
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Projeto"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Propriedades macro do projeto"
#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr "Espaços de nome de projeto"
#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Opção projeto"
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Diretório de saída do Projeto (ex. o diretório ppu)"
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Diretório de saída de projeto"
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Diretório onde o arquivo principal do projeto deve estar"
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Sessão de Projeto"
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "Sessão do projeto alterada"
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Diretórios fontes do projeto"
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s No endereço %1:x"
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
msgid "Project %s raised exception class '%s'."
msgstr "Projeto %s elevou classe exceção '%s'."
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Projeto %s elevou classe exceção '%s' com a mensagem:%s%s"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s No arquivo '%1:s' no endereço %2:x"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s No arquivo '%1:s' na linha %2:d"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:s No arquivo '%1:s' na linha %2:d:%0:s%3:s"
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Caminho Fonte do Projeto"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "unidade projeto"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Caminho unidades do projeto"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Assistente de Projeto"
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Confirmar exclusão de dependência"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Confirmar remoção arquivo"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
msgid "Delete dependency for %s?"
msgstr "Excluir dependência para %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
msgid "Project Inspector - %s"
msgstr "Inspetor de projetos - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Pacotes requeridos removidos"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
msgid "Remove file %s from project?"
msgstr "Remover arquivo %s do projeto?"
#: lazarusidestrconsts.lisprojinspremoveitemsf
msgid "Remove %s items from project?"
msgstr "Remover %s itens do projeto?"
#: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror
msgid "Unable to read state file %s of project %s%sError: %s"
msgstr "Incapaz de ler arquivo de estado %s do projeto %s%sErro: %s"
#: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror
msgid "Unable to write state file for project %s%sError: %s"
msgstr "Incapaz de escrever arquivo de estado para o projeto %s%sErro: %s"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Sempre construir (mesmo se nada for alterado)"
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr "Pode ser necessário se houver um defeito na verificação de dependência, normalmente desnecessário."
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Erro"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Incapaz de alterar a lista de auto-criação de formulários no fonte do programa.%sFavor corrigir os erros primeiro."
#: lazarusidestrconsts.lisprojprojectsourcedirectorymark
msgid "Project Source Directory Mark"
msgstr "Marca do Diretório Fonte do Projeto"
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Perguntar por valor"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Propriedades (substituir ou excluir)"
#: lazarusidestrconsts.lisproperty
msgid "%s property"
msgstr "propriedade %s"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protegido"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Método Protegido"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Método Publico"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Método Publicado"
#: lazarusidestrconsts.lispublishedto
msgid "Published to %s"
msgstr "Publicado em %s"
#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr "Arquivos pertencentes ao projeto / pacote serão incluídos automaticamente."
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Diretório publicação do projeto"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Publicar projeto"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Salvar arquivo .LRS no diretório de saída."
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr "O recurso estará disponível para o FPC."
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Uma unidade Pascal deve ter extensão .pp ou .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Editar unidade virtual"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Já existe uma unidade com este nome.%sArquivo: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "O nome de unidade não é um identificador Pascal válido."
#: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses
msgctxt "lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses"
msgid "The unitname is used when the IDE extends uses clauses"
msgstr "O nome de unidade é usado quando a IDE estende a cláusula \"uses\"."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Nome de unidade e nome de arquivo não correspondem.%sEx: unit1.pas e Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Converter Projeto &Delphi"
#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "&Novo projeto"
#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "&Abrir projeto"
#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Abrir projeto &recente"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "&Exibir projetos de exemplo"
#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "Erro de correção rápida."
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Correções rápidas"
#: lazarusidestrconsts.lisquickfixremoveunit
msgid "Quick fix: Remove unit"
msgstr "Correção rápida: Remover unidade"
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Localizar identificador"
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Sair"
#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "&Sair do Lazarus"
#: lazarusidestrconsts.lisrange
msgctxt "lazarusidestrconsts.lisrange"
msgid "Range"
msgstr "Faixa"
#: lazarusidestrconsts.lisreaderror
msgid "Read Error"
msgstr "Erro de Leitura"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Excluir realmente?"
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Tabulações recentes"
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Gravar"
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Gravado"
#: lazarusidestrconsts.lisrecordstruct
msgid "Record/Structure"
msgstr "Registro/Estrutura"
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Refazer"
#: lazarusidestrconsts.lisregisters
msgctxt "lazarusidestrconsts.lisregisters"
msgid "Registers"
msgstr "Registradores"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Expressão regular"
#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Relativo"
#: lazarusidestrconsts.lisrelativepaths
msgid "Relative paths"
msgstr "Caminhos relativos"
#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Remover"
#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Remover?"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Remover todas as propriedades inválidas"
#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Remover todos os filtros de tipo de mensagem"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Remover todas unidades"
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Remover opção de compilador ocultar mensagem"
#: lazarusidestrconsts.lisremovedependenciesfrompackage
msgid "Remove %s dependencies from package \"%s\"?"
msgstr "Remover %s dependências do pacote \"%s\"?"
#: lazarusidestrconsts.lisremovedpropertys
msgid "Removed property \"%s\"."
msgstr "Propriedade removida \"%s\"."
#: lazarusidestrconsts.lisremovefilesfrompackage
msgid "Remove %s files from package \"%s\"?"
msgstr "Remover %s arquivos do pacote \"%s\"?"
#: lazarusidestrconsts.lisremovefrominstalllist
msgid "Remove from install list"
msgstr "Remover da lista instalação"
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Remover do projeto"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Remover do caminho de busca"
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Remover caminho inclusão?"
#: lazarusidestrconsts.lisremovelocalvariable
msgid "Remove local variable %s"
msgstr "Remover variável local %s"
#: lazarusidestrconsts.lisremovelocalvariable3
msgid "Remove local variable \"%s\""
msgstr "Remover variável local \"%s\""
#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Remover filtro tipo de mensagem"
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Remover arquivos inexistentes"
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Remover unidades selecionadas"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Removê-los"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Remover caminhos de \"Outros fontes\""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Remover caminho unidade?"
#: lazarusidestrconsts.lisremoveuses
msgid "Remove uses \"%s\""
msgstr "Remover \"uses\" \"%s\""
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Renomear"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Renomear ..."
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Renomear arquivo?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Falha ao renomear arquivo"
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Exibir lista de Identificadores renomeados"
#: lazarusidestrconsts.lisrenameto
msgid "Rename to %s"
msgstr "Renomear para %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Renomear para minúsculas"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Reabrir projeto"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Reabrir com outra codificação"
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Repetir"
#: lazarusidestrconsts.lisrepeatcount
msgid "Repeat Count:"
msgstr "Núm. Repetição:"
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Substituir"
#: lazarusidestrconsts.lisreplacedpropertyswiths
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "Propriedade substituída \"%s\" com \"%s\"."
#: lazarusidestrconsts.lisreplacedtypeswiths
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "Tipo substituído \"%s\" com \"%s\"."
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Substituição"
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Funções de substituição"
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Substituições"
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Corrigir propriedades e tipos desconhecidos"
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Substituir o identificador inteiro"
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Substituição da seleção falhou."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Re-examinar"
#: lazarusidestrconsts.lisreset
msgid "Reset"
msgstr "Redefinir"
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Redefinir todos os filtros de arquivo para os padrões?"
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "Redefinir esquerda, topo, largura, altura dos componentes selecionados para os valores de seus ancestrais?"
#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr "Nome de recurso deve ser único."
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Erro ao salvar recurso"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Tipo de recurso do projeto"
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Reiniciar"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Resultado:"
#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
msgstr ""
"Retorna palavra indexada-parâmetro da linha atual precedendo a posição do cursor.\n"
"\n"
"Palavras em uma linha são numeradas 1,2,3,... da esquerda para a direita, exceto a última\n"
"que é sempre um comando macro que deve expandir e tem número 0, portanto $PrevWord(0)\n"
"é sempre a macro atual.\n"
"\n"
"Linha exemplo:\n"
"i 0 count-1 forb|\n"
"Aqui $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"No final de seu modelo use $PrevWord(-1) que expande para uma \"string\" vazia, mas realiza uma operação importante de limpeza de todos os $PrevWords encontrados. Adicionalmente aqui está uma \"regexp\" usada para detectar palavras para esta macro: [\\w\\-+*\\(\\)\\[\\].^@]+\n"
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent // the case list will be generated without extra indentation\n"
msgstr ""
"Retorna lista de todos os valores da variável \"case\" em frente da variável.\n"
"\n"
"Parâmetros opcionais (separados por vírgula):\n"
"WithoutExtraIndent // a lista \"case\" será gerada sem indentação extra\n"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Falha na reversão"
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Direito"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Ancoragem a direita"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr ""
"Espaço da borda direita.\n"
"Este valor será adicionado ao espaço da borda base e\n"
"usado para o espaço à direita do controle.\n"
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr ""
"Este é o controle irmão ao qual o lado direito está ancorado.\n"
"Deixar vazio para ancorar ao pai no estilo Delphi (Espaço da borda e lado referência não importam).\n"
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Lados Direito"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Justificar à direita"
#: lazarusidestrconsts.lisroot
msgid "Root"
msgstr "Raiz"
#: lazarusidestrconsts.lisrootdirectory
msgid "Root Directory"
msgstr "Diretório raiz"
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Executar"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "Pacotes \"de tempo de execução e projeto\" não têm limitações."
#: lazarusidestrconsts.lisrunbuttonhint
msgctxt "lazarusidestrconsts.lisrunbuttonhint"
msgid "Run"
msgstr "Executar"
#: lazarusidestrconsts.lisrunning
msgid "%s (running ...)"
msgstr "%s (executando ...)"
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Arquivo não executável"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
msgid "The host application \"%s\" is not executable."
msgstr "A aplicação servidora \"%s\" não é executável."
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Executar"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Apenas de tempo de execução, não pode ser instalado na IDE"
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "Pacotes \"de tempo de execução apenas\", são apenas para projetos. Não podem ser instalados na IDE, mesmo indiretamente."
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr "Pacotes \"de tempo de execução\" são usados por projetos. Não podem ser instalados na IDE, a menos que algum pacote de tempo de projeto os requeiram."
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Falha executar até"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Métodos abstratos - ainda não sobrepostos"
#: lazarusidestrconsts.lissamabstractmethodsof
msgid "Abstract methods of %s"
msgstr "Método abstrato de %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Cursor não está em uma declaração de classe"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE está ocupada"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s é uma classe abstrata, e tem %s métodos abstratos."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Nenhum método abstrato encontrado"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Sobrepor todos selecionados"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Sobrepor primeiro selecionado"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Selecionar nenhum"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Existem %s métodos abstratos para sobrepor.%sSelecionar os métodos para os quais devem ser criados \"stubs\":"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Não existem métodos abstrados sobrando para sobrepor."
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Este método não pode ser sobreposto porque está definido na classe atual"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Incapaz de exibir métodos abstratos da classe atual, porque"
#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Salvar"
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Salvar tudo"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Salvar todos marcados"
#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Salvar todos os arquivos alterados"
#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Salvar tudo/Mensagens originais para arquivo ..."
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Save and exit dialog"
msgstr "Salvar e fechar diálogo"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Save and rebuild IDE"
msgstr "Salvar e reconstruir IDE"
#: lazarusidestrconsts.lissaveas
msgctxt "lazarusidestrconsts.lissaveas"
msgid "Save As"
msgstr "Salvar como"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Salvar arquivos modificados?"
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Salvar alterações?"
#: lazarusidestrconsts.lissavechangestoproject
msgid "Save changes to project %s?"
msgstr "Salvar alterações no projeto \"%s\"?"
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Salvar o arquivo atual do editor"
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "Salvo com as configurações da IDE"
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Salvo com a sessão do projeto"
#: lazarusidestrconsts.lissavefileas
msgid "Save file as"
msgstr "Salvar arquivo como"
#: lazarusidestrconsts.lissavefilebeforeclosingform
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Salvar arquivo \"%s\"%santes de fechar o formulário \"%s\"?"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Salvar macro como"
#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Salvar mensagens"
#: lazarusidestrconsts.lissaveproject
msgid "Save project %s (*%s)"
msgstr "Salvar projeto %s (*%s)"
#: lazarusidestrconsts.lissavesessionchangestoproject
msgid "Save session changes to project %s?"
msgstr "Salvar alterações da sessão para o projeto %s?"
#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Salvar informação de retração"
#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr "Editor de código suporta retração (temporariamente oculto) de blocos de código."
#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Salvar histórico de saltos"
#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr "Ctrl-Clique em um identificador no editor de código é armazenado no histórico de saltos."
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Salvar Configurações"
#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Salvar mensagens exibidas par arquivo ..."
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Salvar "
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr "Salvando o arquivo \"%s\" como \"%s\" perde caracteres na linha %s, coluna %s."
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Fator de escala:"
#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr "Examinar arquivos no diretório pai"
#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr "Localizar arquivos fonte nos diretórios filhos (diretório pai e seus filhos)"
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Examinando"
#: lazarusidestrconsts.lisscanning2
msgid "%s. Scanning ..."
msgstr "%s. Examinando ..."
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Escaneando diretório pai"
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Caminhos de busca"
#: lazarusidestrconsts.lissearchunit
msgid "Search Unit \"%s\""
msgstr "Localizar unidade \"%s\""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
msgid "secondary config directory where Lazarus searches for config template files. Default is "
msgstr "diretório de configuração secundário, onde Lazarus procura por arquivos de configuração de modelos. Padrão é"
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Caminho secundário configuração"
#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr "&Segundo teste"
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Veja mensagens."
#: lazarusidestrconsts.lisseeprojectprojectinspector
msgid "%sSee Project -> Project Inspector"
msgstr "%sVer Projeto -> Inspetor de projetos"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Selecionar um item de ajuda:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Selecione um nó"
#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr "Selecionar outra \"widgeset\" LCL (macro LCLWidgetType)"
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Selecionar arquivos de formulários Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Selecionado"
#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr "Adição selecionada:"
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "Selecionados e controles filhos"
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(vizinho da base selecionado)"
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Mapeamento de comandos selecionado"
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "selecionado para instalação"
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "selecionado para desinstalação"
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(vizinho da esquerda selecionado)"
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr "Mensagem selecionada na janela de mensagens:"
#: lazarusidestrconsts.lisselectedmodeswerecompiled
msgid "Selected %d modes were successfully compiled."
msgstr "%d modos selecionados foram compilados com sucesso."
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(vizinho da direita selecionado)"
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(vizinho do topo selecionado)"
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Selecionar o arquivo"
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Selecionar diretório dos fontes FPC"
#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr "Selecionar quadro"
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Seleção excede a constante \"string\""
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Ferramenta de seleção"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Selecionar diretório dos fontes Lazarus"
#: lazarusidestrconsts.lisselectpathto
msgid "Select path to %s"
msgstr "Selecionar caminho para %s"
#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "Selecionar diretório alvo"
#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Definir todas as cores:"
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Definir padrão"
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr ""
"Defina isto para traduzir as mensagens do compilador para outro idioma (isto é, não Inglês).\n"
"Por exemplo: Alemão: $(FPCSrcDir)/compiler/msg/errordu.msg.\n"
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Configurar identação padrão)"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Curto:"
#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Curto, nenhum caminho"
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr "O componente \"%s\" deve ser auto criado quando a aplicação inicia?"
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Exibir"
#: lazarusidestrconsts.lisshowabstractmethodsof
msgid "Show abstract methods of \"%s\""
msgstr "Exibir métodos abstratos de \"%s\""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Exibir árvore de componentes"
#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr "Exibir console"
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Exibir dicas declarações"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Exibir diferenças entre modos ..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Exibir unidades/pacotes vazios"
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr "Exibir a mensagem FPC \"linhas compiladas\""
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Exibir glifos para"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Exibir medianiz"
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Exibir ajuda"
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Exibir dicas no Inspetor de Objetos"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Exibir identificadores"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Exibir caixa de informação"
#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Exibir ID de tipo da mensagem"
#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr "Exibir múltiplas linhas"
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Exibir apenas modificado"
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr ""
"Exibir apenas um botão na barra de tarefas para toda a IDE, ao invés de um por janela.\n"
"Alguns gerenciadores de janela Linux como Cinnamon não suportam isto e sempre exibem um botão por janela.\n"
#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr "Exibir saída"
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview gutter"
msgstr "Exibir medianiz de visão geral"
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Exibir pacotes"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Exibir posição do editor de código"
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "Exibir identificadores usados recentemente no topo"
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Exibir caminhos relativos"
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr "Exibir todos os controles na hierarquia de árvore."
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr "Uma caixa na base exibe a descrição da propriedade selecionada."
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings"
msgstr "Exibir diálogo para as mais importantes configurações"
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Exibir caracteres especiais"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Exibir barra de estado"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Exibir unidades"
#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr "Exibir unidades com seções inicialização/finalização"
#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr "Estas unidades podem inicializar dados globais usados pelo programa/aplicação. Remover com cuidado."
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Exibir unidades não usadas ..."
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Exibir dicas de valores durante a depuração"
#: lazarusidestrconsts.lisshowversionandexit
msgid "show version and exit"
msgstr "Exibir versão e sair"
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Encolher ao menor"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Irmão"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Programa simples"
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "Um programa de linha de comando Free Pascal mais simples."
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Sintaxe simples"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Ignorar erros"
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Ignorar arquivo"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Ignorar arquivo e continuar carregando"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project"
msgstr "Ignorar carregamento do último projeto"
#: lazarusidestrconsts.lisskipthesewarnings
msgid "Skip these warnings"
msgstr "Ignorar estes avisos"
#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr "Mais lento mas mais preciso."
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Menor ao invés de mais rápido"
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Correspondência"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Desculpe, este tipo ainda não foi implementado"
#: lazarusidestrconsts.lissortforscope
msgid "Sort for scope"
msgstr "Ordenar o escopo"
#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr "Ordenar"
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Ascendente"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Sensível maiúsc./minúsc."
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Descendente"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domínio"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorar Espaço"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Linhas"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Opções"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Parágrafos"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Visualizar"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Aceitar"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Ordenar Seleção"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Palavras"
#: lazarusidestrconsts.lissortunicoderangelistalphabetically
msgid "Sort Unicode range list alphabetically"
msgstr "Ordenar lista de faixa Unicode alfabeticamente"
#: lazarusidestrconsts.lissourceanddestinationaresame
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr "Diretórios origem \"%s\"%se destino \"%s\"%ssão os mesmos. Favor selecionar outro diretório."
#: lazarusidestrconsts.lissourceanddestinationarethesame
msgid "Source and Destination are the same:%s%s"
msgstr "Fonte e Destino são os mesmos:%s%s"
#: lazarusidestrconsts.lissourcebreakpoint
msgid "&Source Breakpoint ..."
msgstr "&Ponto de parada Fonte ..."
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
msgid "Source directory \"%s\" does not exist."
msgstr "Diretório fonte \"%s\" não existe."
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Gerenciador de janela do Editor de Código"
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Fonte modificado"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Fonte da página \"%s\" foi alterado. Salvar?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "Fontes das páginas foram alterados. Salvar página \"%s\"? (mais %d)"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Caminhos dos fontes"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Justificar"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "SO Fonte"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Localizando"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Localizar texto"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Iniciar Conversão"
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Iniciar IDE"
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Iniciar com um novo projeto"
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr "Barra de estado exibe o nome da propriedade e a classe quando esta for publicada."
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Parar"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Parar a depuração atual e reconstruir o projeto?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Parar Depuração?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Parar depuração?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Parar em exceções"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Parar a depuração?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Armazenar delimitadores de caminho \\ e / como"
#: lazarusidestrconsts.lisstrangelpifile
msgid "Strange lpi file"
msgstr "Arquivo lpi estranho"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Erro de Fluxo"
#: lazarusidestrconsts.lisstring
msgid "String"
msgstr "\"String\""
#: lazarusidestrconsts.lisstyle
msgctxt "lazarusidestrconsts.lisstyle"
msgid "Style"
msgstr "Estilo"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Sub procedimento"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Sub procedimento no mesmo nível"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Sucesso"
#: lazarusidestrconsts.lissuccessfullyexported
msgid "Successfully exported to \"%s\"."
msgstr "Exportado com sucesso para \"%s\"."
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr "Exportado(s) %d modo(s) de construção com sucesso para \"%s\"."
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
msgid "Successfully exported compiler options to \"%s\"."
msgstr "Exportado com sucesso as opções de compilador para \"%s\"."
#: lazarusidestrconsts.lissuccessfullyimported
msgid "Successfully imported from \"%s\"."
msgstr "Importado com sucesso de \"%s\"."
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr "Importado(s) %d modo(s) de construção com sucesso de \"%s\"."
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
msgid "Successfully imported compiler options from \"%s\"."
msgstr "Importado com sucesso as opções de compilador de \"%s\"."
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Sugerir nome padrão do novo arquivo em minúsculas"
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Caminho inclusões suspeito"
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Caminho unidade suspeito"
#: lazarusidestrconsts.lissvnrevision
msgid "SVN Revision: "
msgstr "Revisão SVN: "
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nome de variável inválido"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" não é um identificador válido."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Sobrepor variável de sistema"
#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Mudar configurações de filtro"
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr "Mudar para aba favoritos após perguntar pelo nome do componente."
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Modo sintaxe"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "system.ppu não encontrado. Verificar fpc.cfg"
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tabulação"
#: lazarusidestrconsts.listaborderconfirmsort
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Classificar ordens de tabulação de todos os controles filhos de \"%s\" por suas posições?"
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Mover o controle selecionado abaixo na ordem de tabulação"
#: lazarusidestrconsts.listaborderof
msgid "Tab Order of %s"
msgstr "Ordem de tabulação de %s"
#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr "Calcular ordem das abas recursivamente para os controles filhos."
#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr "recursivamente"
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Calcular a ordem de tabulação dos controles pelas suas posições X- e Y-"
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Mover o controle selecionado acima na ordem de tabulação"
#: lazarusidestrconsts.listabsfor
msgid "Tabs for %s"
msgstr "Tabs para %s"
#: lazarusidestrconsts.listakesnapshot
msgid "Take a Snapshot"
msgstr "Tirar um instantâneo"
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Alvo:"
#: lazarusidestrconsts.listarget2
msgid ", Target: %s"
msgstr ", Alvo: %s"
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "CPU Alvo"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Nome arquivo alvo: (-o, vazio = usar diretório de saída de unidades)"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Nome arquivo alvo (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Nome de arquivo alvo do projeto"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Nome Arquivo Alvo + parâmetros"
#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "Alvo é somente leitura"
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "SO alvo"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Célula Editável"
#: lazarusidestrconsts.listemplateeditparamcellhelp
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "Insere uma Célula editável. Células podem ser navegadas usando a tecla tab.%0:sA macro \"param\" toma uma lista de argumentos separados por vírgula.%0:sO primeiro argumento é o valor padrão.%0:sO segundo argumento (opcional) pode ser usado para vincular uma célula a outra (edição síncrona)%0:s%0:s while param(\"foo\") do param(foo);%0:sInsere 2 células independentes, ambas com o texto padrão \"foo\"%0:sAs aspas são opcionais%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInsere 2 células vinculadas, editando qualquer uma, irá alterar a outra também%0:sO valor \"1\" refere-se à posição do outro \"param()\", então se houver mais parâmetros:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sA segunda e a terceira serão vinculadas. (a 3ª refere-se ao \"2\") %0:s%0:s\"sync pode ser abreviado para \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sA segunda e a terceira serão vinculadas.%0:sNota: \"Sync não tem posição e nenhum \"=\", então ele sincroniza para a célula anterior com o mesmo padrão(neste caso \"foo\")"
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "Arquivo de modelo"
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Diretório de teste"
#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "URL teste"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
msgid "The Application Bundle was created for \"%s\""
msgstr "A Aplicação Encartada foi criada para \"%s\""
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "A classe \"%s\" é um TControl e não pode ser colada em um objeto que não é um controle.%sIncapaz de colar."
#: lazarusidestrconsts.listhecodetoolsfoundanerror
msgid "The Codetools found an error:%s%s"
msgstr "As Ferramentas de Código encontraram um erro:%s%s"
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "O arquivo de compilador \"%s\" parece incorreto:%s%s"
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "O componente %s não pode ser excluído, porque é propriedade de %s."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "O editor de componente da classe \"%s\" criou o erro:%s\"%s\""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "O componente editor da classe \"%s\"%schamado com o verbo #%s \"%s\"%scriou o erro:%s\"%s\""
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "O componente %s é herdado de %s.%sPara excluir o componente herdado, abra o ancestral e exclua de lá."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "O componente %s é herdado de %s.%sPara renomear um componente herdado abra seu ancestral e renomei-o lá."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "O nome do componente deve ser único entre todos os componentes no formulário/\"datamodule\".O nome é comparado desconsiderando maiúsculas/minúsculas, como um identificador Pascal normal."
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "A configuração será desatualizada/convertida."
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "O %s contém um diretório inexistente:%s%s"
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "O %s contém um asterisco (*).%sLazarus usa este como um caractere normal e não o expande como uma máscara de arquivo."
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "O FPC atual não tem um arquivo de configuração. Ele irá provavelmente perder algumas unidades. Verificar sua inslatação do FPC."
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "O depurador \"%s\"%snão existe ou não é executável.%sVeja Ferramentas -> Opções -> Opções do Depurador"
#: lazarusidestrconsts.listhedebuggerexecutabletypicallyhasthenamepleasegive
msgid "The debugger executable typically has the name \"%s\". Please give the full file path."
msgstr "O executável do depurador geralmente tem o nome \"%s\". Favor informar o caminho completo para o arquivo."
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "O modo padrão deve ser armazenado no projeto, não na sessão."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
msgid "The destination directory%s\"%s\" does not exist."
msgstr "O diretório de destinos%s\"%s\" não existe."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep
msgid "The destination directory \"%s\" does not exist.%sPlease check the project target file name Menu > Project > Project Options."
msgstr "O diretório destino \"%s\" não existe.%sFavor verificar o nome do arquivo alvo do projeto. Menu -> Projeto -> Opções Projeto."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "O diretório \"%s\" não contém mais arquivos de inclusão de projeto. Remover este diretório do caminho de busca de inclusões de projeto?"
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "O diretório \"%s\" não contém mais unidades de projeto. Remover este diretório do caminho de busca de unidades de projeto?"
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "O diretório \"%s\" não é mais necessário no caminho das unidades.%sRemovê-lo?"
#: lazarusidestrconsts.listhedirectoryisnotwritable
msgid "The directory \"%s\" is not writable."
msgstr "O diretório \"%s\" não é gravável."
#: lazarusidestrconsts.listhedirectorywasnotfound
msgid "The directory %s was not found."
msgstr "O diretório %s não foi encontrado."
#: lazarusidestrconsts.listhefile
msgid "The file \"%s\""
msgstr "O arquivo \"%s\""
#: lazarusidestrconsts.listhefiledoesnotlooklikealpifile
msgid "The file %s does not look like a lpi file."
msgstr "O arquivo %s não parece ser um arquivo lpi."
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "O índice de arquivo é necessário para funcções como a localização de declarações. Enquanto escaneando você pode editar e compilar os fontes, mas funções como a localização de declarações exibirão erros de unidade-não-encontrada. Isto pode levar alguns minutos."
#: lazarusidestrconsts.listhefileisasymlinkopeninstead
msgid "The file \"%s\" is a symlink.%sOpen \"%s\" instead?"
msgstr "O arquivo \"%s\" é um vínculo simbólico.%sAbrir \"%s\" ao invés dele?"
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "O arquivo \"%s\" não é um projeto Lazarus.%sCriar um novo projeto para este \"%s\"?"
#: lazarusidestrconsts.listhefilemaskisinvalid
msgid "The file mask \"%s\" is invalid."
msgstr "Máscara de arquivo \"%s\" inválida."
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "A máscara de arquivo \"%s\" não é uma expressão regular válida."
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "O arquivo \"%s\" parece ser um programa.%sFechar o projeto atual e criar um novo projeto Lazarus para esse programa?%s\"Não\" carregará o arquivo como um fonte normal."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "O arquivo %s parece ser um arquivo de programa de um projeto Lazarus existente."
#: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac
msgid "The file \"%s\"%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%sDelete ambiguous file?"
msgstr "O arquivo \"%s\"%s foi encontrado em um dos diretórios fontes do pacote %s e parece uma unidade compilada. Unidades compiladas devem estar no diretório de saída do pacote, caso contrário outros pacotes podem ter problemas ao usar este.%sExcluir arquivo ambíguo?"
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "O arquivo \"%s\" não foi encontrado.%sDeseja localizá-lo você mesmo?"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "O arquivo \"%s\" não foi encontrado.%sIgnorar continuará carregando o projeto,%sAbortar irá parar o carregamento."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "Os seguintes métodos usados por %s não estão no fonte%s%s%s%s%sRemover as referências pendentes?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "O diretório fonte FPC \"%s\" parece incorreto:%s%s"
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "O executável do compilador Free Pascal tipicamente tem o nome \"%s\". Você também pode usar um alvo específico do compilador como \"%s\". Favor informar o caminho completo do arquivo."
#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr "A IDE ainda está em construção."
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "O identificador é uma unidade. Favor usar Salvar Arquivo como função para renomear a unidade."
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "A tecla %s já está atribuída para %s%s.%s%sRemover a atribuição antiga e atribuir a tecla para a nova função %s?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "A aplicação inclusa %s%snecessária para execução não existe ou não é executável.%sDeseja criar uma?%sVeja Projeto -> Opções de projeto -> Configuração da aplicação."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "A aplicação iniciando \"%s\"%s não existe ou não é executável.%sVeja Executar -> Parâmetros de execução -> Local"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "O diretório Lazarus contém os fontes da IDE e os arquivos de pacotes da LCL e muitos pacotes padrão. Por exemplo, ele contém o arquivo \"ide%slazarus.lpi\". Os arquivos de traduções estão localizados lá também."
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "O diretório do Lazarus \"%s\" parece incorreto:%s%s"
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "O arquivo LFM (formulário Lazarus) contém propriedades inválidas. Isto significa por ex., que ele contém algumas propriedades/classes, que não existem na LCL atual. A correção natural é remover essas propriedades do LFM e corrigir o código Pascal manualmente."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "A macro \"%s\" não se inicia com \"%s\"."
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "O executável do \"make\" geralmente tem o nome \"%s\". Ele é necessário para construir a IDE. Favor informar o caminho completo para o arquivo."
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "O novo arquivo de inclusão ainda não está no caminho de busca.%sAdicionar diretório %s?"
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "A nova unidade ainda não está no caminho de unidades.%sAdicionar diretório %s?"
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "A configuração antiga será atualizada."
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "Os \"Outros fontes\" contém um diretório já existente em \"Outros arquivos de unidades\".%s%s"
#: lazarusidestrconsts.listheoutputdirectoryismissing
msgid "The output directory \"%s\" is missing."
msgstr "O diretório de saída \"%s\" está faltando."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "O diretório de saída de %s está listado no caminho de busca de inclusões de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "O diretório de saída de %s está listado no caminho de busca herdada de inclusões de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "O diretório de saída de %s está listado no caminho de busca herdada de unidade de %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "O diretório de saída de %s está listado no caminho de busca de unidade de %s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "O diretório de saída deve ser separado e não deve conter quaisquer arquivos fonte."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "A classe proprietária tem este nome"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "O proprietário tem este nome"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "O pacote %s adiciona o caminho \"%s\" ao caminho de inclusões da IDE.%sProvavelmente trata-se de uma má configuração do pacote."
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "O pacote %s adiciona o caminho \"%s\" ao caminho de unidades da IDE.%sProvavelmente trata-se de uma má configuração do pacote."
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "O pacote já contém uma unidade com este nome."
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr "O pacote %s não pode ser instalado, porque ele requer o pacote \"%s\", que é um pacote apenas de tempo de execução."
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr "O pacote %s não pode ser desinstalado, porque é necessário pela própria IDE."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "O pacote %s não tem nenhum procedimento \"Register\", o que tipicamente significa que não é para a IDE. Instalá-lo provavelmente apenas aumentará o tamanho da IDE, tornando-a instável.%sDica: Se deseja usar um pacote em seu projeto, use o item de menu \"Adicionar ao projeto\""
#: lazarusidestrconsts.listhepackageisalreadyinthelist
msgid "The package %s is already in the list"
msgstr "O pacote %s já está na lista"
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "O pacote %s não é de tempo de projeto. Ele não pode ser instalado na IDE."
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "O caminho para o \"make\" está incorreto: \"%s\""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "O programa \"make\" não foi encontrado.%s Esta ferramenta é necessária para construir o Lazarus."
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "As opções de compilação do projeto e as diretivas do fonte principal diferem. Para a nova unidade, o modo e o tipo \"string\" das opções do projeto são usados:"
#: lazarusidestrconsts.listheprojectdoesnotusedwarf
msgid "The project does not write debug info in Dwarf format. The \"%s\" supports only Dwarf."
msgstr "O projeto não escreve informações de depuração no formato Dwarf. O \"%s\" suporta apenas Dwarf."
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "O projeto não usa a unidade interfaces LCL, que é requerida por LCLBase.%sVocê obterá erros estranhos do vinculador se utilizar a LCL sem interfaces."
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "O projeto não possui um arquivo fonte principal."
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "O arquivo de informações de projeto \"%s\"%sé o mesmo que o fonte principal do projeto!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "O arquivo de informações do projeto \"%s\"%sfoi alterado no disco."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "O projeto deve ser salvo antes de construir%sSe você definir o diretório de Teste nas opções da IDE,%svocê poderá criar novos projetos e contruí-los imediatamente.%sSalvar projeto?"
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr "O projeto usa recursos FPC, que requerem ao menos FPC 2.4"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "O projeto usa SO alvo=%s e CPU=%s.%s O \"system.ppu\" para este alvo não foi encontrado no diretório binário do FPC. %sCertifique-se que o FPC está instalado corretamente para este alvo e que \"fpc.cfg\" contenha os diretórios certos."
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr "O projeto grava os símbolos de depuração em um arquivo externo. O \"%s\" suporta apenas símbolos dentro do executável."
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr "O projeto escreve os símbolos de depuração dentro do executável, ao invés de um arquivo externo. O \"%s\" suporta apenas símbolos em um arquivo externo."
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
msgid "%sThere are additional notes for this message on%s"
msgstr "%sHá notas adicionais para esta mensagem em%s"
#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr "Não há teclas conflitantes."
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Há outros arquivos no diretório com o mesmo nome,%sque apenas diferem em:%s%s%sExcluí-los?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "Há um arquivo com o mesmo nome e extensão similar no disco:%sArquivo: %s%sArquivo Ambíguo: %s%sExcluir arquivo ambíguo?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Já existe um modo de construção com este nome."
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
msgid "There is already a component class with the name %s."
msgstr "Já existe uma classe de componente com o mesmo nome %s."
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Já existe um componente com este nome"
#: lazarusidestrconsts.listhereisalreadyafilein
msgid "There is already a file%s%s%sin %s"
msgstr "Já existe um arquivo%s%s%sem %s"
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr "Já existe um arquivo \"%s\" em %s%sAntigo: %s%sNovo: %s%s%sContinuar?"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
msgid "There is already a form with the name \"%s\""
msgstr "Já existe um formulário com o nome \"%s\""
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
msgid "There is already a macro with the name \"%s\"."
msgstr "Já existe uma macro com o nome \"%s\"."
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Já existe uma macro IDE com o nome \"%s\"."
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
msgid "There is already a package %s in the list"
msgstr "Já existe um pacote %s na lista"
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr "Já existe uma unidade \"%s\" em %s%sAntigo: %s%sNovo: %s%sVocê deve certificar-se que o caminho de busca de unidade possua apenas uma delas.%s%sContinuar?"
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Já existe uma unidade com o nome \"%s\". Identificadores Pascal devem ser únicos."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Há uma unidade com o nome \"%s\" no projeto.%sFavor escolher um nome diferente"
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr "Não há nenhum fpc.exe no diretório de %s. Geralmente o executável make é instalado juntamente com o compilador FPC."
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Deve haver ao menos um modo de contrução."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "A classe de recurso \"%s\" descende de \"%s\". Provavelmente isto é um erro de digitação para \"TForm\";"
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Ocorreu um erro durante a escrita do componente selecionado %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Ocorreu um erro ao converter o fluxo binário do componente selecionado %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Ocorreu um erro ao copiar o fluxo do componente para Área de Transferência:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "O componente raiz não pode ser excluído."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Estes arquivos serão excluídos"
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Estas configurações são armazenadas com o projeto."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Estas unidades não foram encontradas:"
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Os fontes dos pacotes Free Pascal são requeridos para navegação e complementação do código. Por exemplo ele tem o arquivo \"%s\"."
#: lazarusidestrconsts.listhetargetdirectoryisafile
msgid "The target directory is a file:%s"
msgstr "O diretório alvo é um arquivo:%s"
#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr "O nome de arquivo alvo é um diretório."
#: lazarusidestrconsts.listhetargetisnotwritable
msgid "The target %s is not writable."
msgstr "O alvo %s não é gravável."
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "O diretório de teste não pode ser encontrado:%s\"%s\"%s(veja opções IDE)"
#: lazarusidestrconsts.listheunitalreadyexists
msgid "The unit \"%s\" already exists."
msgstr "A unidade \"%s\" já existe."
#: lazarusidestrconsts.listheunitbelongstopackage
msgid "The unit belongs to package %s."
msgstr "A unidade pertence ao pacote %s."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "A unidade %s existe duas vezes no caminho de unidades da %s:"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "A unidade tem este nome"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "O nome de arquivo da unidade \"%s\" não está em minúsculas.%sO compilador Free Pascal não procura por maiúsc./minúsc. É recomendado usar nomes de arquivos em minúsculas.%sRenomear arquivo para minúsculas?"
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "A unidade %s é parte dos fontes do FPC, mas o arquivo fpdoc xml correspondente não foi encontrado.%sOu você ainda não adicionou o diretório dos fpdocs ao caminhos de busca ou a unidade ainda não foi documentada.%sOs arquivos fpdoc dos fontes FPC poder ser baixados de: %s%sFavor adicionar o diretório nas opções do editor fpdoc.%sA fim de criar um novo arquivo o diretório deve ter acesso de escrita."
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "A unidade %s é usada por outro arquivo.%sAtualizar referências automaticamente?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "A própria unidade já tem o nome \"%s\". Identificadores Pascal devem ser únicos."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "O caminho de busca unidade de \"%s\" contém o diretório fonte \"%s\" do pacote %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "O diretório de trabalho \"%s\" não existe.%sFavor verificar no Menu -> Executar -> Parâmetros de execução."
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
msgid "This component already contains a class with the name %s."
msgstr "Este componente já contém uma classe com o mesmo nome %s."
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Esta função requer um arquivo .lfm aberto no editor código."
#: lazarusidestrconsts.listhishelpmessage
msgid "this help message"
msgstr "esta mensagem de ajuda"
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr "Este é um projeto de teste para um pacote de tempo de projeto, teste-o fora da IDE."
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Este parece um arquivo Pascal.%sÉ recomendado usar nomes de arquivo em minúsculas, para evitar vários problemas em alguns sistemas de arquivos e compiladores diferentes.%sRenomeá-lo usando minúsculas?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Este projeto não tem um arquivo fonte principal"
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Este projeto tem apenas o modo de construção padrão."
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Este conjunto de opções para contrução do Lazarus não é suportado por esta instalação.%sO diretório \"%s\" não é gravável.%sConsulte a página internet do Lazarus para outras maneiras de instalação."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Esta declaração não pode ser extraída.%sFavor selecionar algum código para extrair um novo procedimento/método."
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr "Isto irá permitir alterar todos os modos de construção de uma vez. Ainda não implementado."
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Isto criará uma dependência circular."
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "Isto é colocar muito texto (%s) na área de transferência.%sProsseguir?"
#: lazarusidestrconsts.listhreads
msgctxt "lazarusidestrconsts.listhreads"
msgid "Threads"
msgstr "Threads"
#: lazarusidestrconsts.listhreadscurrent
msgctxt "lazarusidestrconsts.listhreadscurrent"
msgid "Current"
msgstr "Atual"
#: lazarusidestrconsts.listhreadsfunc
msgctxt "lazarusidestrconsts.listhreadsfunc"
msgid "Function"
msgstr "Função"
#: lazarusidestrconsts.listhreadsgoto
msgid "Goto"
msgstr "Ir para"
#: lazarusidestrconsts.listhreadsline
msgctxt "lazarusidestrconsts.listhreadsline"
msgid "Line"
msgstr "Linha"
#: lazarusidestrconsts.listhreadsnotevaluated
msgid "Threads not evaluated"
msgstr "Threads não avaliadas"
#: lazarusidestrconsts.listhreadssrc
msgctxt "lazarusidestrconsts.listhreadssrc"
msgid "Source"
msgstr "Fonte"
#: lazarusidestrconsts.listhreadsstate
msgctxt "lazarusidestrconsts.listhreadsstate"
msgid "State"
msgstr "Estado"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Título"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgstr "Título na barra de tarefas mostra por exemplo: project1.lpi - Lazarus"
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Título (deixar vazio para padrão)"
#: lazarusidestrconsts.listmfunctionappendpathdelimiter
msgid "Function: append path delimiter"
msgstr "Função: adicionar o delimitador de caminho"
#: lazarusidestrconsts.listmfunctionchomppathdelimiter
msgid "Function: remove trailing path delimiter"
msgstr "Função: retirar o delimitador de caminho do final"
#: lazarusidestrconsts.listmfunctionextractfileextension
msgid "Function: extract file extension"
msgstr "Função: extrair extensão do arquivo"
#: lazarusidestrconsts.listmfunctionextractfilenameextension
msgid "Function: extract file name+extension"
msgstr "Função: extrair nome+extensão do arquivo"
#: lazarusidestrconsts.listmfunctionextractfilenameonly
msgid "Function: extract file name only"
msgstr "Função: extrair apenas nome do arquivo"
#: lazarusidestrconsts.listmfunctionextractfilepath
msgid "Function: extract file path"
msgstr "Função: extrair caminho do arquivo"
#: lazarusidestrconsts.listmunknownmacro
msgid "(unknown macro: %s)"
msgstr "(macro desconhecida: %s)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Caminho:"
#: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa
msgid "Toggle showing filenames with full path or with relative path"
msgstr "Alterar exibição nomes de arquivo com caminho completo ou relativo"
#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr "Configuração da barra de ferramentas"
#: lazarusidestrconsts.listoolbaroptions
msgid "Toolbar"
msgstr "Barra de ferramentas"
#: lazarusidestrconsts.listoolbaroptionshighlight
msgid "Highlight toolbars buttons"
msgstr "Realçar os botões da barra de ferramentas"
#: lazarusidestrconsts.listoolbaroptionsraise
msgid "Raise toolbars"
msgstr "Elevar as barras de ferramentas"
#: lazarusidestrconsts.listoolhasnoexecutable
msgid "tool \"%s\" has no executable"
msgstr "ferramenta \"%s\" não tem executável"
#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "Cabeçalho ferramenta: Falhou"
#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "Cabeçalho ferramenta: Executando"
#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "Cabeçalho ferramenta: Deslocado acima"
#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "Cabeçalho ferramenta: Sucesso"
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "ferramenta parou com o código de saída %s. Use o menu contexto para obter mais informações."
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr "ferramenta parou com \"ExitCode 0\" e \"ExitStatus %s\". Use o menu contexto para obter maiores informações."
#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Topo"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Ancoragem superior"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr ""
"Espaço da borda superior.\n"
"Este valor será adicionado ao espaço da borda base e\n"
"usado para o espaço acima do controle.\n"
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Procedure hint"
msgstr "Exibir dicas de Classe/Proc"
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Topos"
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr ""
"Este é o controle irmão o qual o lado superior está ancorado.\n"
"Deixar vazio para ancorar ao pai no estilo Delphi (Espaço da borda e lado de referência não importam).\n"
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Justificar acima"
#: lazarusidestrconsts.listotalpages
msgid "Total Pages: %s"
msgstr "Páginas totais: %s"
#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "Traduzir as mensagens em inglês"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Árvore necessita atualização"
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Dois arquivos movidos têm o mesmo nome de arquivo:%s%s%s%s%sem %s"
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Tipos (não removidos se nenhuma substituição)"
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Diretórios adicionais:"
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Todas as unidades de pacote"
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Todas as unidades do editor de código"
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Todas as unidades"
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "Por padrão apenas as unidades de projeto e as do editor de código serão examinadas. Adicone aqui uma lista dos diretórios separados por ponto-e-vírgula para também serem examinados."
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Retrair todos os nós"
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Expandir todos os nós"
#: lazarusidestrconsts.lisudfile
msgid "File: %s"
msgstr "Arquivo: %s"
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Filtro)"
#: lazarusidestrconsts.lisudimplementationuses
msgid "Implementation Uses: %s"
msgstr "Uses da seção Implementation: %s"
#: lazarusidestrconsts.lisudimplementationuses2
msgid "implementation uses: %s"
msgstr "uses da seção implementation: %s"
#: lazarusidestrconsts.lisudinterfaceuses
msgid "Interface Uses: %s"
msgstr "Uses da seção Interface: %s"
#: lazarusidestrconsts.lisudinterfaceuses2
msgid "interface uses: %s"
msgstr "uses da seção interface: %s"
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Projetos e pacotes"
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Examinando ..."
#: lazarusidestrconsts.lisudscanningunits
msgid "Scanning: %s units ..."
msgstr "Examinando: %s unidades ..."
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Localizar)"
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "Encontrar a próxima ocorrência desta frase"
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "Encontrar a próxima unidade com esta frase"
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "Encontrar a ocorrência anterior desta frase"
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "Encontrar a unidade anterior com esta frase"
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Unidades selecionadas"
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Exibir nós para diretórios"
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "Exibir nós para projetos e pacotes"
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Unidades"
#: lazarusidestrconsts.lisudunits2
msgid "Units: %s"
msgstr "Unidades: %s"
#: lazarusidestrconsts.lisudusedbyimplementations
msgid "Used by Implementations: %s"
msgstr "Usado pela seção Implementation: %s"
#: lazarusidestrconsts.lisudusedbyimplementations2
msgid "used by implementations: %s"
msgstr "usado pela seção implementation: %s"
#: lazarusidestrconsts.lisudusedbyinterfaces
msgid "Used by Interfaces: %s"
msgstr "Usados pela seção Interfaces: %s"
#: lazarusidestrconsts.lisudusedbyinterfaces2
msgid "used by interfaces: %s"
msgstr "usado pela seção interfaces: %s"
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Não exibir esta mensagem novamente."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Error em expressão regular"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Fonte sem UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Ir para Linha :"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Não encontrado"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Substituir esta ocorrência de \"%s\"%s com \"%s\"?"
#: lazarusidestrconsts.lisuesearching
msgid "Searching: %s"
msgstr "Localizando: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Continuar a localizar do início?"
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Continuar a localizar do final?"
#: lazarusidestrconsts.lisuesearchstringnotfound
msgid "Search string '%s' not found!"
msgstr "Sequência \"%s\" não encontrada!"
#: lazarusidestrconsts.lisuethecurre
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "A fonte atual do editor não suporta UTF-8, mas seu sistema parece utilizá-la.%sIsto significa que caracteres não ASCII provavelmente serão vistos incorretamente.%sVocê pode selecionar outra fonte nas opções do editor."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Limpar cache de inclusões"
#: lazarusidestrconsts.lisuidbytes
msgid "%s bytes"
msgstr "%s bytes"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Incluído por:"
#: lazarusidestrconsts.lisuidinproject
msgid "In project:"
msgstr "No projeto:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Linhas:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nome:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "não"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Tamanho:"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Tipo:"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "sim"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Exibir valores das Ferramentas de Código"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Incapaz de converter fluxo binário em texto"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Incapaz de copiar componentes para Área de Transferência"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Incapaz de adicionar comentário de cabeçalho de recurso no arquivo de recurso %s\"%s\".%sProvavelmente um erro de syntaxe."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Incapaz de adicionar recurso T%s:FORMDATA para arquivo de recurso %s\"%s\".%sProvavelmente um erro de sintaxe."
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr "Incapaz de adicionar a dependência %s, porque o pacote %s já tem uma dependência %s"
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr "Incapaz de adiconar a dependência %s, porque isto criará uma dependência circular. Dependência %s"
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Incapaz de adicionar %s ao projeto, porque já existe uma unidade com o mesmo nome no Projeto."
#: lazarusidestrconsts.lisunabletobackupfileto
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Incapaz de fazer cópia de segurança do arquivo \"%s\" para \"%s\"!"
#: lazarusidestrconsts.lisunabletochangeclassofto
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sIncapaz de alterar classe de %s para %s"
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
msgid "Unable to change project scaled in source.%s%s"
msgstr "Incapaz de alterar a escala do projeto no fonte.%s%s"
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
msgid "Unable to change project title in source.%s%s"
msgstr "Incapaz de alterar o título do projeto no fonte.%s%s"
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Incapaz de limpar o diretório de destino"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Incapaz de limpar \"%s\".%sFavor verificar as permissões."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Incapaz de converter texto componente em formato binário:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Incapaz de converter arquivo \"%s\"%sErro: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Incapaz de converter os dados texto do arquivo %s\"%s\"%sno fluxo binário. (%s)"
#: lazarusidestrconsts.lisunabletoconverttoencoding
msgid "Unable to convert to encoding \"%s\""
msgstr "Incapaz de converter a codificação \"%s\""
#: lazarusidestrconsts.lisunabletocopyfile
msgid "Unable to copy file"
msgstr "Incapaz de copiar arquivo"
#: lazarusidestrconsts.lisunabletocopyfileto
msgid "Unable to copy file \"%s\"%sto \"%s\""
msgstr "Incapaz de copiar o arquivo \"%s\"%spara \"%s\""
#: lazarusidestrconsts.lisunabletocreatedirectory
msgid "Unable to create directory \"%s\"."
msgstr "Incapaz de criar diretório \"%s\"."
#: lazarusidestrconsts.lisunabletocreatefile
msgid "Unable to create file"
msgstr "Incapaz de criar arquivo"
#: lazarusidestrconsts.lisunabletocreatefile2
msgid "Unable to create file \"%s\""
msgstr "Incapaz de criar arquivo \"%s\""
#: lazarusidestrconsts.lisunabletocreatefile3
msgid "Unable to create file%s\"%s\""
msgstr "Incapaz de criar arquivos%s\"%s\""
#: lazarusidestrconsts.lisunabletocreatelinkwithtarget
msgid "Unable to create link \"%s\" with target \"%s\""
msgstr "Incapaz de criar vínculo \"%s\" com alvo \"%s\""
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file because there is already a directory with this name."
msgstr "Incapaz de criar novo arquivo, porque já existe um diretório com este nome."
#: lazarusidestrconsts.lisunabletocreatenewmethod
msgid "Unable to create new method."
msgstr "Incapaz de criar novo método."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Incapaz de criar \"buffer\" LFM temporário."
#: lazarusidestrconsts.lisunabletodelete
msgid "Unable to delete"
msgstr "Incapaz de excluir"
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Incapaz de excluir arquivo ambíguo \"%s\""
#: lazarusidestrconsts.lisunabletoexecute
msgid "unable to execute: %s"
msgstr "Incapaz de executar: %s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Incapaz de localizar uma seção de recurso de \"string\" nesta ou em qualquer outra unidade usada."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
msgid "Unable to find a valid classname in \"%s\""
msgstr "Incapaz de localizar um nome de classe válido em \"%s\""
#: lazarusidestrconsts.lisunabletofindfile
msgid "Unable to find file \"%s\"."
msgstr "Incapaz de localizar o arquivo \"%s\"."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Incapaz de localizar arquivo \"%s\".%sSe ele pertence ao seu projeto, verifique caminho de busca em%sProjeto -> Opções do compilador -> Caminhos de busca -> Outros Arquivos de Unidade. Se ele pertence a um pacote, verifique as opções de compilador de pacotes apropriadas. Se ele pertence ao Lazarus, tenha certeza de uma compilação limpa. Se ele pertence ao FPC, verifique \"fpc.cfg\". Se não tiver certeza, verifique Projeto -> Opções do compilador -> Teste"
#: lazarusidestrconsts.lisunabletofindinlfmstream
msgid "Unable to find %s in LFM Stream."
msgstr "Incapaz de localizar %s no fluxo LFM"
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Incapaz de localizar método."
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "Incapaz de localizar unidade pascal (.pas,.pp) para arquivo .lfm %s\"%s\""
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "Incapaz de localizar a classe do componente \"%s\".%sEla não foi registrada via RegisterClass e nenhum lfm foi encontrado.%sEla é necessária na unidade:%s%s"
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Incapaz de coletar alterações do editor."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Incapaz de obter o fonte para o editor."
#: lazarusidestrconsts.lisunabletoloadfile2
msgid "unable to load file %s: %s"
msgstr "incapaz de carregar o arquivo %s: %s"
#: lazarusidestrconsts.lisunabletoloadpackage
msgid "Unable to load package \"%s\""
msgstr "Incapaz de carregar pacote \"%s\""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "Incapaz de carregar classe componente \"%s\", porque ele depende dele mesmo."
#: lazarusidestrconsts.lisunabletoopen
msgid "Unable to open \"%s\""
msgstr "Incapaz de abrir \"%s\""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Incapaz de abrir componente ancestral"
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Incapaz de abrir editor.%sA classe %s não descende de uma classe designável como \"TForm\" ou \"TDataModule\"."
#: lazarusidestrconsts.lisunabletoread
msgid "Unable to read %s"
msgstr "Incapaz de ler %s"
#: lazarusidestrconsts.lisunabletoreadfile
msgid "Unable to read file"
msgstr "Incapaz de ler arquivo"
#: lazarusidestrconsts.lisunabletoreadfile2
msgid "Unable to read file \"%s\"."
msgstr "Incapaz de ler arquivo \"%s\"."
#: lazarusidestrconsts.lisunabletoreadfileerror
msgid "Unable to read file \"%s\"%sError: %s"
msgstr "Incapaz de ler arquivo \"%s\"%sErro: %s"
#: lazarusidestrconsts.lisunabletoreadlpi
msgid "Unable to read lpi"
msgstr "Incapaz de ler lpi"
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "Incapaz de ler o processo ExitStatus"
#: lazarusidestrconsts.lisunabletoreadtheprojectinfofile
msgctxt "lazarusidestrconsts.lisunabletoreadtheprojectinfofile"
msgid "Unable to read the project info file%s\"%s\"."
msgstr "Incapaz de ler arquivo informações projetos%s\"%s\"."
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Incapaz de remover arquivo antigo da cópia de segurança \"%s\"!"
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
msgid "Unable to remove project scaled from source.%s%s"
msgstr "Incapaz de remover projeto dimensionado do fonte. %s%s"
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
msgid "Unable to remove project title from source.%s%s"
msgstr "Incapaz de remover o título do projeto do fonte.%s%s"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Incapaz de renomear arquivo ambíguo \"%s\"%spara \"%s\""
#: lazarusidestrconsts.lisunabletorenamefile
msgid "Unable to rename file"
msgstr "Incapaz de renomear arquivo"
#: lazarusidestrconsts.lisunabletorenamefileto
msgid "Unable to rename file \"%s\" to \"%s\"!"
msgstr "Incapaz de renomear arquivo \"%s\" para \"%s\"!"
#: lazarusidestrconsts.lisunabletorenamefileto2
msgid "Unable to rename file \"%s\"%sto \"%s\"."
msgstr "Incapaz de renomear arquivo \"%s\"%spara \"%s\"."
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Incapaz de renomear formulário no fonte."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Incapaz de renomear método. Favor corrigir o erro mostrado na janela de mensagens."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Incapaz de renomear variável no fonte."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Incapaz de executar"
#: lazarusidestrconsts.lisunabletorun2
msgid "Unable to run \"%s\""
msgstr "Incapaz de executar \"%s\""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Incapaz de definir lado ancoragem do controle."
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Incapaz de exibir método."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Incapaz de obter fluxo dos componentes selecionados."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Incapaz de obter fluxo dos componentes selecionados."
#: lazarusidestrconsts.lisunabletostreamt
msgid "Unable to stream %s:T%s."
msgstr "Incapaz de obter fluxo %s:T%s"
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Incapaz de transformar fluxo binário do componente de %s:T%s em texto."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Incapaz de atualizar declaração \"CreateForm\" no fonte do projeto"
#: lazarusidestrconsts.lisunabletowrite2
msgid "Unable to write \"%s\""
msgstr "Incapaz de gravar \"%s\""
#: lazarusidestrconsts.lisunabletowritefile
msgid "Unable to write file"
msgstr "Incapaz de gravar arquivo"
#: lazarusidestrconsts.lisunabletowritefile2
msgid "Unable to write file \"%s\"."
msgstr "Incapaz de gravar arquivo \"%s\"."
#: lazarusidestrconsts.lisunabletowritefileerror
msgid "Unable to write file \"%s\"%sError: %s"
msgstr "Incapaz de gravar arquivo \"%s\"%sErro: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectinfofileerror
msgid "Unable to write the project info file%s\"%s\".%sError: %s"
msgstr "Incapaz de gravar o arquivo info. projetos%s\"%s\".%sErro: %s"
#: lazarusidestrconsts.lisunabletowritetheprojectsessionfileerror
msgid "Unable to write the project session file%s\"%s\".%sError: %s"
msgstr "Incapaz de gravar o arquivo de sessão do projeto%s\"%s\".%sErro: %s"
#: lazarusidestrconsts.lisunabletowritetofile2
msgid "Unable to write to file \"%s\"."
msgstr "Incapaz de gravar o arquivo \"%s\"."
#: lazarusidestrconsts.lisunabletowritexmlstreamtoerror
msgid "Unable to write xml stream to %s%sError: %s"
msgstr "Incapaz de escrever fluxo xml para %s%sErro: %s"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Desmarcar tudo"
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Desfazer"
#: lazarusidestrconsts.lisuninstall
msgid "Uninstall %s"
msgstr "Desinstalar %s"
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Impossível desinstalar"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Desinstalar seleção"
#: lazarusidestrconsts.lisunit
msgctxt "lazarusidestrconsts.lisunit"
msgid "Unit"
msgstr "Unidade"
#: lazarusidestrconsts.lisunithaschangedsave
msgid "Unit \"%s\" has changed. Save?"
msgstr "Unidade \"%s\" foi alterada. Salvar?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Identificador de unidade existe"
#: lazarusidestrconsts.lisunitinpackage
msgid "%s unit %s in package %s"
msgstr "%s unidade %s no pacote %s"
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Nome de unidade já existe no projeto"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Nome da unidade começa com ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Nome da unidade contém ..."
#: lazarusidestrconsts.lisunitnotfound
msgid "unit %s not found"
msgstr "unidade %s não encontrada"
#: lazarusidestrconsts.lisunitnotfoundatnewposition
msgid "unit %s not found at new position \"%s\""
msgstr "unidade %s não encontrada na posição \"%s\""
#: lazarusidestrconsts.lisunitnotfoundinproject
msgid "A unit not found in project %s"
msgstr "Uma unidade não encontrada no projeto %s"
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Diretório de saída de unidade"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "caminho das unidades"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Caminho das unidades"
#: lazarusidestrconsts.lisunitrequirespackage
msgid "unit %s requires package %s"
msgstr "unidade %s requer o pacote %s"
#: lazarusidestrconsts.lisunitsnotfoundinproject
msgid "Units not found in project %s"
msgstr "Unidades não encontradas no projeto %s"
#: lazarusidestrconsts.lisunsigned
msgid "Unsigned"
msgstr "Não assinado"
#: lazarusidestrconsts.lisunusedunitsof
msgid "Unused units of %s"
msgstr "Unidades não usadas de %s"
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Nome de arquivo de compilador incomum. Usualmente ele inicia-se por fpc, ppc ou ppcross."
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr "Nome de arquivo incomum do compilador pas2js. Usualmente se inicia com pas2js."
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Acima"
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Atualizar info."
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Atualizar outras assinaturas de procedimentos apenas quando houver mudança de letra maiúscula/minúscula"
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Atualizar referências?"
#: lazarusidestrconsts.lisupdatingpofilesfailedforpackage
msgid "Updating PO files failed for package %s"
msgstr "Atualizar arquivos PO falhou para o pacote %s"
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Atualizar"
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Configuração de Atualização"
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "seq.caracteres maiúsculas"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter."
msgstr "\"String\" maiúsculas dada como parâmetro."
#: lazarusidestrconsts.lisurlonwikithebaseurlis
msgid "URL on wiki (the base url is %s)"
msgstr "URL na wiki (a url básica é %s)"
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Mensagem forma de uso (opção -h)"
#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr "Usar"
#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Usar \"Ansistrings\""
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Usar \"checkbox\" para valores boleanos"
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Usar comentários em opções customizadas"
#: lazarusidestrconsts.lisusedby
msgid " used by %s"
msgstr " usado por %s"
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Usar pacotes de tempo de projeto"
#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr "Usado para formulários auto-criados."
#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr "Usar filtro para incluir arquivos extras"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Identificador \"Use\""
#: lazarusidestrconsts.lisuseidentifierinat
msgid "Use identifier %s in %s at %s"
msgstr "Usar identificador %s em %s no %s"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Inicializando aplicação"
#: lazarusidestrconsts.lisusepackageinpackage
msgid "Use package %s in package %s"
msgstr "Usar pacote %s no pacote %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Usar pacote no pacote"
#: lazarusidestrconsts.lisusepackageinproject
msgid "Use package %s in project"
msgstr "Usar pacote %s no projeto"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Usar pacote no projeto"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
msgid "Add to list \"%s\""
msgstr "Adicionar à lista \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Indicador texto definido pelo usuário"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
msgid "Remove from list \"%s\""
msgstr "Remover da lista \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
msgid "Toggle on list \"%s\""
msgstr "Alternar na lista \"%s\""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Diretório padrão do usuário"
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Adicionar unidade à seção \"uses\""
#: lazarusidestrconsts.lisuseunitinunit
msgid "Use unit %s in unit %s"
msgstr "Usar unidade %s na unidade %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 com Marca Ordem \"Byte\" (BOM)"
#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Valor"
#: lazarusidestrconsts.lisvalue2
msgid "Value%s"
msgstr "Valor%s"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Valor:"
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Valores"
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr "Valores que são alterados do padrão são armazenados no arquivo .lfm e são exibidos diferentemente no Inspetor de Objetos."
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Variável"
#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr "Detalhado"
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Verificar chamadas de método"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Versão"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Versão incompatível"
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Vertical"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Copiar informações de versão para Área de Transferência"
#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "Muito detalhado"
#: lazarusidestrconsts.lisviewbreakpointproperties
msgctxt "lazarusidestrconsts.lisviewbreakpointproperties"
msgid "Breakpoint Properties ..."
msgstr "Propriedades Pontos de Paradas ..."
#: lazarusidestrconsts.lisviewsource
msgid "View Source"
msgstr "Exibir Fonte"
#: lazarusidestrconsts.lisviewsourcedisass
msgctxt "lazarusidestrconsts.lisviewsourcedisass"
msgid "View Assembler"
msgstr "Exibir Assembler"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Exibir Fonte (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Aviso: "
#: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis
msgid "Warning: ambiguous file found: \"%s\". Source file is: \"%s\""
msgstr "Aviso: arquivo ambíguo encontrado: \"%s\". Arquivo fonte é : \"%s\""
#: lazarusidestrconsts.liswarnings
msgid ", Warnings: %s"
msgstr ", Aviso: %s"
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sAviso: Esta é a unidade principal. A nova unidade principal será %s.pas"
#: lazarusidestrconsts.liswatch
msgid "&Watch"
msgstr "&Observar"
#: lazarusidestrconsts.liswatchdata
msgid "Watch:"
msgstr "Observador:"
#: lazarusidestrconsts.liswatchkind
msgid "Watch action"
msgstr "Ação observador"
#: lazarusidestrconsts.liswatchkindread
msgid "Read"
msgstr "Ler"
#: lazarusidestrconsts.liswatchkindreadwrite
msgid "Read/Write"
msgstr "Ler/Gravar"
#: lazarusidestrconsts.liswatchkindwrite
msgid "Write"
msgstr "Gravar"
#: lazarusidestrconsts.liswatchpoint
msgid "&Data/Watch Breakpoint ..."
msgstr "&Dados/Observar ponto de parada ..."
#: lazarusidestrconsts.liswatchpointbreakpoint
msgid "&Data/watch Breakpoint ..."
msgstr "&Dados/Observar ponto de parada ..."
#: lazarusidestrconsts.liswatchpropert
msgid "Watch Properties"
msgstr "Propriedades Observador"
#: lazarusidestrconsts.liswatchscope
msgid "Watch scope"
msgstr "Escopo observador"
#: lazarusidestrconsts.liswatchscopeglobal
msgctxt "lazarusidestrconsts.liswatchscopeglobal"
msgid "Global"
msgstr "Global"
#: lazarusidestrconsts.liswatchscopelocal
msgid "Declaration"
msgstr "Declaração"
#: lazarusidestrconsts.liswatchtowatchpoint
msgid "Create &Data/Watch Breakpoint ..."
msgstr "Criar &Dados/Observar ponto de parada ..."
#: lazarusidestrconsts.liswelcometolazaruside
msgid "Welcome to Lazarus IDE %s"
msgstr "Bem-Vindo ao IDE Lazarus %s"
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Bem-vindo ao Lazarus %s%sJá existe uma configuração da versão %s em%s%s"
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "O que necessita construção"
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Quando uma unidade for renomeada, atualizar referências"
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr "Quando ativo, as opções atuais são salvas para um modelo, que é usado ao criar novos projetos"
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr "Quando há somente um item de complemento possível usá-lo imediatamente, sem exibir a caixa de complementos"
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Ao mover o cursor do editor fonte, exibir o nó atual no explorador de código"
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr "Menu janela exibe nomes de formulário no editor ao invés de título"
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr "Especialmente útil se o título for deixado vazio."
#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr "Janela permanece no topo"
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", que inclui"
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Sem um compilador apropriado a navegação de código e compilação serão decepcionantes."
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr "Sem um depurador apropriado, a depuração será decepcionante."
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Sem um diretório Lazarus apropriado você obterá muitos avisos."
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr "Sem um executável \"make\" apropriado, não será possível a compilação da IDE."
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Sem os fontes FPC apropriados a navegação de código e complementação será bem limitada."
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Com pacotes requeridos"
#: lazarusidestrconsts.liswldeleteall
msgid "De&lete All"
msgstr "E&liminar tudo"
#: lazarusidestrconsts.liswldisableall
msgid "D&isable All"
msgstr "D&esabilitar Tudo"
#: lazarusidestrconsts.liswlenableall
msgid "E&nable All"
msgstr "H&abillitar tudo"
#: lazarusidestrconsts.liswlexpression
msgid "Expression"
msgstr "Expressão"
#: lazarusidestrconsts.liswlinspectpane
msgid "Inspect pane"
msgstr "Painel de inspeção"
#: lazarusidestrconsts.liswlproperties
msgid "&Properties"
msgstr "&Propriedades"
#: lazarusidestrconsts.liswlwatchlist
msgctxt "lazarusidestrconsts.liswlwatchlist"
msgid "Watches"
msgstr "Observadores"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Palavra sob o cursor no editor atual"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Diretório de trabalho para construção"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Diretório de trabalho para execução"
#: lazarusidestrconsts.liswriteerror
msgid "Write Error"
msgstr "Erro de Escrita"
#: lazarusidestrconsts.liswriteerrorfile
msgid "Write error: %s%sFile: %s%s%s"
msgstr "Erro escrita: %s%sArquivo: %s%s%s"
#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr "Falha ao gravar arquivo de informações do pacote."
#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr "Falha ao gravar arquivo de informação do projeto."
#: lazarusidestrconsts.liswrongversionin
msgid "wrong version in %s: %s"
msgstr "versão incorreta em %s: %s"
#: lazarusidestrconsts.lisxmlerror
msgid "XML Error"
msgstr "Erro XML"
#: lazarusidestrconsts.lisxmlparsererrorinfileerror
msgid "XML parser error in file %s%sError: %s"
msgstr "Erro análise XML no arquivo %s%sErro: %s"
#: lazarusidestrconsts.lisyes
msgid "Yes"
msgstr "Sim"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Você pode desabilitar isso para formulários individuais via editor de pacotes"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Você pode desativar esta opção para formulários individuais através do menu de contexto no inspetor de projeto"
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr "Você pode baixar o FPC e seu código fonte de http://sourceforge.net/projects/lazarus/?source=directory"
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Você não pode reconstruir o Lazarus enquanto estiver depurando ou compilando."
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr "Você não pode alterar o modo de construção enquanto compilando."
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr "Você pode selecionar itens simplesmente pressionando letras subscritas"
#: lazarusidestrconsts.lis_all_
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Todos>"
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Editor de Código"
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr "Excluir selecionado"
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr "inválido"
#: lazarusidestrconsts.lrspldlpkfileinvalid
msgid "lpk file invalid (%s)"
msgstr "arquivo lpk inválido (%s)"
#: lazarusidestrconsts.lrspldlpkfilevalid
msgid "lpk file valid (%s)"
msgstr "arquivo lpk válido (%s)"
#: lazarusidestrconsts.lrspldunabletodeletefile
msgid "Unable to delete file \"%s\""
msgstr "Incapaz de excluir o arquivo \"%s\""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr "válido"
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr "Reexaminar arquivos lpl"
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Adicionar unidade pacote à cláusula \"uses\""
#: lazarusidestrconsts.regdlgbinary
msgctxt "lazarusidestrconsts.regdlgbinary"
msgid "Binary"
msgstr "Binário"
#: lazarusidestrconsts.regdlgdecimal
msgctxt "lazarusidestrconsts.regdlgdecimal"
msgid "Decimal"
msgstr "Decimal"
#: lazarusidestrconsts.regdlgdisplaytypeforselectedregisters
msgid "Display type for selected Registers"
msgstr "Exibir tipo para os Registradores selecionados"
#: lazarusidestrconsts.regdlgformat
msgid "Format"
msgstr "Formatar"
#: lazarusidestrconsts.regdlghex
msgid "Hex"
msgstr "Hex"
#: lazarusidestrconsts.regdlgoctal
msgid "Octal"
msgstr "Octal"
#: lazarusidestrconsts.regdlgraw
msgid "Raw"
msgstr "Raw"
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Adicionar Reverso"
#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr "Adicionar novo termo"
#: lazarusidestrconsts.rsattachto
msgid "Attach to"
msgstr "Anexar à"
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Atributos"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Auto incrementar número construção"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr "Incrementar todas as vezes que o projeto é compilado."
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "&Construção:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Conjunto caracteres:"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page"
msgstr "Fechar página atual"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Definições condicionais"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Criar nova definição"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Ativar \"i18n\""
#: lazarusidestrconsts.rsenterpid
msgid "Enter PID"
msgstr "Digite PID"
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string"
msgstr "Filtrar as linhas na lista com a \"string\""
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found but not listed here: "
msgstr "Encontrado, mas não listado aqui:"
#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr "Excluído"
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr "Forçar atualização dos arquivos PO na próxima construção"
#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr "Identificadores:"
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Opções \"i18n\""
#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr "Originais:"
#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr "Informação de versão é armazenada se o formato do executável suportá-la."
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Incluir informações de versão no executável"
#: lazarusidestrconsts.rslanguageafrikaans
msgid "Afrikaans"
msgstr "Africâner"
#: lazarusidestrconsts.rslanguagearabic
msgid "Arabic"
msgstr "Árabe"
#: lazarusidestrconsts.rslanguageautomatic
msgid "Automatic (or English)"
msgstr "Automático (ou inglês)"
#: lazarusidestrconsts.rslanguagecatalan
msgid "Catalan"
msgstr "Catalão"
#: lazarusidestrconsts.rslanguagechinese
msgid "Chinese"
msgstr "Chinês"
#: lazarusidestrconsts.rslanguageczech
msgid "Czech"
msgstr "Tcheco"
#: lazarusidestrconsts.rslanguagedutch
msgid "Dutch"
msgstr "Holandês"
#: lazarusidestrconsts.rslanguageenglish
msgid "English"
msgstr "Inglês"
#: lazarusidestrconsts.rslanguagefinnish
msgid "Finnish"
msgstr "Finlandês"
#: lazarusidestrconsts.rslanguagefrench
msgid "French"
msgstr "Francês"
#: lazarusidestrconsts.rslanguagegerman
msgid "German"
msgstr "Alemão"
#: lazarusidestrconsts.rslanguagehebrew
msgid "Hebrew"
msgstr "Hebraíco"
#: lazarusidestrconsts.rslanguagehungarian
msgid "Hungarian"
msgstr "Húngaro"
#: lazarusidestrconsts.rslanguageindonesian
msgid "Indonesian"
msgstr "Indonésio"
#: lazarusidestrconsts.rslanguageitalian
msgid "Italian"
msgstr "Italiano"
#: lazarusidestrconsts.rslanguagejapanese
msgid "Japanese"
msgstr "Japonês"
#: lazarusidestrconsts.rslanguagelithuanian
msgid "Lithuanian"
msgstr "Lituano"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Opções idioma"
#: lazarusidestrconsts.rslanguagepolish
msgid "Polish"
msgstr "Polonês"
#: lazarusidestrconsts.rslanguageportuguese
msgid "Portuguese"
msgstr "Português"
#: lazarusidestrconsts.rslanguageportuguesebr
msgid "Brazilian Portuguese"
msgstr "Português do Brasil"
#: lazarusidestrconsts.rslanguagerussian
msgid "Russian"
msgstr "Russo"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Seleção idioma:"
#: lazarusidestrconsts.rslanguageslovak
msgid "Slovak"
msgstr "Eslovaco"
#: lazarusidestrconsts.rslanguagespanish
msgid "Spanish"
msgstr "Espanhol"
#: lazarusidestrconsts.rslanguageturkish
msgid "Turkish"
msgstr "Turco"
#: lazarusidestrconsts.rslanguageukrainian
msgid "Ukrainian"
msgstr "Ucraniano"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "Versão &Maior:"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Versão Me&nor:"
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Outras informações"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Diretório de saída PO"
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Recurso"
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "Excluir todos os recursos?"
#: lazarusidestrconsts.rsresourcefilename
msgid "File name"
msgstr "Nome de arquivo"
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Tipo"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Revisão:"
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Selecionar uma entrada herdada"
#: lazarusidestrconsts.rsstartanewsearch
msgid "Start a new search"
msgstr "Iniciar nova busca"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Numeração versão"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Comandos do menu Ajuda"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Comandos de Comando"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Comandos das Ferramentas de Código"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Comandos seleção coluna texto"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Comandos de movimentação do Cursor"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Comandos de Edição de Texto"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Comandos do menu Arquivo"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Comandos retração texto"
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Macros"
#: lazarusidestrconsts.srkmcatmarker
msgid "Text bookmark commands"
msgstr "Comandos do marcador texto"
#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr "Comandos multi cursor texto"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Comandos do menu Pacotes"
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Comandos do menu Projeto"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Comandos do menu Executar"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Comandos de busca e substituição de Texto"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Comandos de seleção de texto"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Comandos Fonte do \"Notebook\""
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Edição Síncrona"
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Edição Síncrona (fora Célula)"
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Edição Síncrona (enquanto selecionando)"
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Edição Modelo"
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Edição Modelo (fora Célula)"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Comandos do menu Ferramentas"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Comandos do menu Exibir"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Comando:"
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Conflito "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "abortar construção"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Métodos abstratos ..."
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "adicionar ponto de parada ao endereço"
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "adicionar ponto de parada ao fonte"
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "adicionar dado/ponto de observação"
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Adicionar ponto de salto"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "adicionar observador"
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Anexar ao programa"
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Complemento modelo de código"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Copiar Bloco"
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Excluir Bloco"
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Ir para início Bloco"
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Ir para final Bloco"
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Ocultar Bloco"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent block"
msgstr "Recuar bloco"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Mover Bloco"
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Definir início bloco"
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Definir final bloco"
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Exibir Bloco"
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Alternar bloco"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent block"
msgstr "Retirar recuo bloco"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Construir programa/projeto"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Construir arquivo"
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Construir Lazarus"
#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr "construir muitos modos"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Caractere"
#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr "limpar e construir"
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Excluir todo o texto"
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Limpar todos os marcadores"
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "Limpar marcadores para o arquivo atual"
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Selecionar coluna abaixo"
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Selecionar final absoluto da coluna"
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Selecionar ínicio absoluto da coluna"
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Seleciona coluna esquerda"
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Selecionar fim linha coluna"
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Selecionar início linha coluna"
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Seleção Coluna para início do texto na linha"
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Selecionar base página coluna"
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Selecionar página abaixo coluna"
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Selecionar topo página coluna"
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Selecionar página acima coluna"
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Selecionar coluna direita"
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Selecionar coluna acima"
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Selecionar palavra esquerda coluna"
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Selecionar palavra direita coluna"
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Modo de seleção de coluna"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "compilar programa/projeto"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "configurar arquivo de construção"
#: lazarusidestrconsts.srkmeccopy
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Copiar"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Copiar editor para nova janela"
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Copiar editor para nova janela livre"
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Copia editor para janela livre anterior"
#: lazarusidestrconsts.srkmeccut
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Recortar"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Excluir até o início da linha"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Excluir caractere sob o cursor"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Excluir até o final da linha"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Excluir último caractere"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Excluir até o início da palavra"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Excluir linha atual"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Excluir até o final da palavra"
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Desanexar do programa"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diferenciar (Diff)"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "Mover cursor abaixo"
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Mover o cursor para o final absoluto"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Mover o cursor para o início absoluto"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Métodos vazios ..."
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Opções IDE"
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "avaliar/modificar"
#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Extrair procedimento"
#: lazarusidestrconsts.srkmecexttool
msgid "External tool %d"
msgstr "Ferramenta externa %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Configuração de ferramentas externas"
#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Localizar texto"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Localizar final do bloco"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Localizar início do bloco"
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Localizar declaração"
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Localizar referências do identificador"
#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Localizar nos arquivos"
#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Localizar próximo"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Localizar próxima ocorrência da palavra"
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr "Localizar sobrecargas"
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr "Localizar sobrecargas ..."
#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Localizar anterior"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Localizar ocorrência anterior da palavra"
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Localizar definição do procedimento"
#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr "Localizar método do procedimento"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Retrair sob o cursor"
#: lazarusidestrconsts.srkmecfoldlevel
msgid "Fold to Level %d"
msgstr "Retrair ao nível %d"
#: lazarusidestrconsts.srkmecgotoeditor
msgid "Go to editor %d"
msgstr "Ir para editor %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Ir para diretiva de inclusão do arquivo de inclusão atual"
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Ir para o número da linha"
#: lazarusidestrconsts.srkmecgotomarker
msgid "Go to bookmark %d"
msgstr "Ir para marcador %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Ir para XY"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Tenta identificar $IFDEF mal colocado"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr "Mover cursor meia palavra à esquerda (ex. CamelCase)"
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr "Mover cursor meia palavra à direita (ex. CamelCase)"
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Inserir entrada Registro de Alterações"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Inserir do Mapa de Caracteres"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Inserir palavra-chave CVS \"Author\""
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Inserir palavra-chave CVS \"Date\""
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Inserir palavra-chave CVS \"Header\""
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Inserir palavra-chave CVS \"ID\""
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Inserir palavra-chave CVS \"Log\""
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Inserir palavra-chave CVS \"Name\""
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Inserir palavra-chave CVS \"Revision\""
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Inserir palavra-chave CVS \"Source\""
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Inserir data e hora atual"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Inserir nome-de-arquivo completo"
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Inserir nota GPL"
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr "Inserir nota GPL (traduzida)"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Inserir um \"GUID\""
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Inserir nota LGPL"
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr "Inserir nota LGPL (traduzida)"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Interromper linha, manter o cursor"
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr "Inserir nota MIT"
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr "Inserir nota MIT (traduzida)"
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Modo de Inserção"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Inserir nota LGPL modificada"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr "Inserir nota LGPL modificada (traduzida)"
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Inserir nome de usuário atual"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspecionar"
#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Inverter atribuição"
#: lazarusidestrconsts.srkmeckeymapleft
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Esquerda"
#: lazarusidestrconsts.srkmeckeymapright
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Direita"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "Mover cursor à esquerda"
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Interromper linha e mover o cursor"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Mover o cursor para o final da linha"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Modo de seleção de linha"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Mover cursor para o início da linha"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Mover cursor para início do texto na linha"
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Bloquear Editor"
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "Criar recurso \"string\""
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Ir para o parêntese correspondente"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Mover editor a esquerda"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Mover editor extremo esquerdo"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Mover editor para nova janela"
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Mover editor para próxima janela livre"
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Mover editor para janela anterior livre"
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Mover editor a direita"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Mover editor extremo direito"
#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr "Colar multi"
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Próximo Marcador"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Ir para o próximo editor"
#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr "Ir para o próximo editor no histórico"
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Ir para o próximo editor com o mesmo Fonte"
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Ir para nova janela"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Modo de seleção normal"
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "Abrir arquivo sob o cursor"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Modo Sobrescrever"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Mover o cursor para base da página"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Mover o cursor uma página abaixo"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Mover cursor uma página a esquerda"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Mover cursor uma página a direita"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Mover cursor para topo da página"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Mover o cursor uma página acima"
#: lazarusidestrconsts.srkmecpaste
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Colar"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "pausar programa"
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr "Limpas todos os cursores texto extra"
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr "Teclas de cursor limpam todos os cursores texto extra"
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr "Teclas de cursor movem todos os cursores texto extra"
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr "Adicionar cursor texto extra"
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr "Alterar cursor texto exttra"
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr "Remover cursor texto extra"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Marcador Anterior"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Ir para o editor anterior"
#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr "Ir para editor anterior no histórico"
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Ir para editor anterior com o mesmo Fonte"
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Ir para janela anterior"
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "compilação rápida, sem vinculação"
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "remover ponto de parada"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Remover métodos vazios"
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Remover unidades não usadas"
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Renomear identificador"
#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Substituir texto"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Reportando um erro"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "parar depurador"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "Mover cursor à direita"
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "executar programa"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "executar arquivo"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "parâmetros de execução"
#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr "executar sem depurar"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Rolar abaixo uma linha"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Rolar a esquerda um caractere"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Rolar a direita um caractere"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Rolar acima uma linha"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Selecinar abaixo"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Selecionar Tudo"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Converter tabulações em espaços na seleção"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Selecionar o final absoluto"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Selecionar o início absoluto"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Selecionar ir para XY"
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr "Selecionar meia palavra à esquerda (ex. CamelCase)"
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr "Selecionar meia palavra à direita (ex. CamelCase)"
#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr "Selecionar à esquerda"
#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Selecionar o final da linha"
#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Selecionar o início da Linha"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Selecionar para ínicio do texto na linha"
#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Selecionar base da página"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Selecionar página abaixo"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Selecionar página a esquerda"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Selecionar página a direita"
#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Selecionar topo da página"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Selecionar página acima"
#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr "Selecionar à direita"
#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr "Seleção inteligente de palavra à esquerda (início/fim da palavra)"
#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr "Seleção inteligente de palavra à direita (início/fim da palavra)"
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr "Iniciar seleção aderente"
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr "Iniciar seleção aderente (Colunas)"
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr "Iniciar seleção aderente (Linha)"
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr "Encerrar seleção aderente"
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Selecionar acima"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Selecionar final da palavra à esquerda"
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Selecionar final da palavra à direita"
#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Selecionar palavra a esquerda"
#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Selecionar palavra a direita"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Definir um Marcador livre"
#: lazarusidestrconsts.srkmecsetmarker
msgid "Set bookmark %d"
msgstr "Definir marcador %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Exibir métodos abstratos"
#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr "Exibir contexto de código"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "exibir ponto execução"
#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr "Movimentação inteligente de cursor à esquerda (início/fim da palavra)"
#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr "Movimentação inteligente de cursor à direita (início/fim da palavra)"
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "parar programa"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Executar macro"
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Gravar macro"
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Ir para última posição na célula"
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Ir para primeira posição na célula"
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Selecionar Célula"
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Escape"
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Próxima Célula"
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Próxima Célula (tudo selecionado)"
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Próxima célula (primeiros apenas)"
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Próxima célula (tudo selecionado / primeiros apenas)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Célula Anterior"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Célula Anterior (tudo selecionado)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Célula anterior (primeiros apenas)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Célula anterior (tudo selecionado / primeiros apenas)"
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Iniciar edição Sincro"
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Ir para última posição na célula"
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Ir para primeira posição na célula"
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Selecionar célula"
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Escape"
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Encerrar"
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Próxima Célula"
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Próxima Célula (rotacionar)"
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Próxima Célula (tudo selecionado)"
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Próxima Célula (rotacionar / tudo selecionado)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Próxima célula (primeiros apenas)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr "Próxima célula (rotacionar / primeiros apenas)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Próxima célula (tudo selecionado / primeiros apenas)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr "Próxima célula (rotacionar / tudo selecionado / primeiros apenas)"
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Célula Anterior"
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Célula Anterior (tudo selecionado)"
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Célula anterior (primeiros apenas)"
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Célula anterior (tudo selecionado / primeiros apenas)"
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Verificação de Sintaxe"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Exibir assembler"
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "alternar ponto de parada"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Exibir Pontos de parada"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Exibir chamada de pilha"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Exibir navegador de código"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Exibir Explorador de Código"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Exibir paleta de componentes"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Exibir saída do depurador"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Alternar entre formulários e unidades"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Exibir Editor de Documentação"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Exibir botões da IDE"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Exibir variáveis locais"
#: lazarusidestrconsts.srkmectogglemarker
msgid "Toggle bookmark %d"
msgstr "Alternar marcador %d"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Alternar realce Palavra Atual"
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Exibir mensagens"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Modo alternado"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Exibir Inspetor de Objetos"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Exibir registradores"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Exibir navegador de restrições"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Exibir Resultados da Pesquisa"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Exibir Editor de Código"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Exibir observadores"
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Expandir tudo"
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Expandir sob o Cursor"
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "comando do editor desconhecido"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Unidades não usadas ..."
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "Mover cursor acima"
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Exibir editor de âncoras"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Exibir componentes"
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Exibir editor de macros"
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Exibir formulários"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Exibir Histórico"
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr "Exibir entrada/saída console"
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Exibir Ordem de Tabulação"
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Exibir Threads"
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Exibir dependências da unidade"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Exibir informações da unidade"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Exibir unidades"
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Complemento de palavras"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "Mover cursor final da palavra à esquerda"
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "Mover cursor final da palavra à direita"
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Mover cursor uma palavra a esquerda"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Mover cursor uma palavra a direita"
#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr "Zoom +"
#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr "Zoom -"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Editar teclas do comando"
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr "Continuar com a próxima ação \"mouse\" acima"
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr "Retrair comentários"
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Retrair comentários na seleção"
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr "Retrair Ifdef inativo"
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr "Retrair Ifdef inativo (exclue estado misto)"
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr "Retrair Ifdef inativo na seleção"
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr "Retrair Ifdef inativo na seleção (exclue estado misto)"
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Ocultar comentários"
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Ocultar comentários na seleção"
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr "Botão de ação correspondente ao \"mouse\" abaixo"
#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr "Linha de ação correspondente ao \"mouse\" abaixo"
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr "Modificadores de ação correspondentes ao \"mouse\" abaixo"
#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr "Posição de ação correspondente ao \"mouse\" abaixo"
#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr "Localizar todas as ações do \"mouse\" abaixo"
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr "Expandir Ifdef ativo"
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr "Expandir Ifdef ativo na seleção"
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Expandir tudo"
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr "Expandir todos Ifdef"
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr "Expandir todos Ifdef na seleção"
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr "Expandir tudo na seleção"
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr "Expandir comentários"
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr "Expandir comentários na seleção"
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr "Expandir Ifdef inativo"
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr "Expandir Ifdef inativo na seleção"
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Arquivo é somente leitura"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "O arquivo \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" não pode ser escrito."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Bloqueado"
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Gravando"
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Pausa gravação"
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Adicionar &Observador sob o Cursor"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "Adicionar &Ponto de observação no Cursor"
#: lazarusidestrconsts.uembookmarknset
msgid "Bookmark &%s: %s"
msgstr "Marcador &%s: %s"
#: lazarusidestrconsts.uembookmarknunset
msgid "Bookmark &%s"
msgstr "Marcador &%s"
#: lazarusidestrconsts.uembookmarknunsetdisabled
msgid "Bookmark %s"
msgstr "Marcador %s"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Fechar todas as &Outras Páginas"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Fechar página"
#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Copiar nome de arquivo"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Clonar para a nova janela"
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Clonar para outra janela"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nova Janela"
#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Depurar"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Codificação"
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "&Avaliar/Modificar ..."
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Localizar Declaração"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Localizar em outra janela"
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Ir para marcador"
#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr "Ir para marcador ..."
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Realçador"
#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "&Inspecionar ..."
#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Inverter atribuição"
#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Finalização de linha"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Bloquear Página"
#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Mover página à esquerda"
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Mover página à extrema esquerda"
#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Mover página à direita"
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Mover página à extrema direita"
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Mover para a nova janela"
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Mover para outra janela"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nova Janela"
#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Ir para o próximo marcador"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Modificado"
#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "&Abrir arquivo sob o cursor"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Ir para o marcador anterior"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Saltar para Procedimento"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Somente leitura"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Refatorar"
#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Definir um marcador livre"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Exibir número de linhas"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Fonte"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "&Alternar marcador"
#: lazarusidestrconsts.uemtogglebookmarknset
msgid "Toggle Bookmark &%s: %s"
msgstr "Alternar marcador &%s: %s"
#: lazarusidestrconsts.uemtogglebookmarknunset
msgid "Toggle Bookmark &%s"
msgstr "Alternar marcador &%s"
#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr "Alternar marcador ..."
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "&Alternar pontos de parada"
#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Exibir chamada de pilha"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Não implementado ainda"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Somente leitura"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informações de versão"
|