File: lazaruside.fr.po

package info (click to toggle)
lazarus 4.0%2Bdfsg-3
links: PTS, VCS
area: main
in suites: forky, sid, trixie
size: 275,760 kB
sloc: pascal: 2,341,904; xml: 509,420; makefile: 348,726; cpp: 93,608; sh: 3,387; java: 609; perl: 297; sql: 222; ansic: 137
file content (21492 lines) | stat: -rw-r--r-- 738,295 bytes
msgid ""
msgstr ""
"Project-Id-Version: lazaruside\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2024-10-12 18:47+0200\n"
"Last-Translator: Vasseur Gilles <gillesvasseur58@gmail.com>\n"
"Language-Team: http://lazarus.developpez.com/\n"
"Language: fr_FR\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"Plural-Forms: nplurals=2; plural=(n > 1);\n"
"X-Generator: Poedit 3.5\n"

#: lazarusidestrconsts.cocoamfstbicommand
msgid "Command"
msgstr ""

#: lazarusidestrconsts.cocoamfstbijumpback
#, fuzzy
msgctxt "lazarusidestrconsts.cocoamfstbijumpback"
msgid "Jump Back"
msgstr "Saut vers l'arrière"

#: lazarusidestrconsts.cocoamfstbijumpforward
#, fuzzy
msgctxt "lazarusidestrconsts.cocoamfstbijumpforward"
msgid "Jump Forward"
msgstr "Saut vers l'avant"

#: lazarusidestrconsts.cocoamfstbisearch
msgid "Search Instantly"
msgstr ""

#: lazarusidestrconsts.dbgasmwindowlinktarget
msgid "Link target line"
msgstr "Ligne cible du lien"

#: lazarusidestrconsts.dbgasmwindowsourcefunc
msgid "Function name"
msgstr "Nom de fonction"

#: lazarusidestrconsts.dbgasmwindowsourceline
msgid "Source line"
msgstr "Ligne de source"

#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
#, object-pascal-format
msgid "Address Breakpoint %s"
msgstr "Adresse du point d'arrêt %s"

#: lazarusidestrconsts.dbgeventbreakataddress
#, object-pascal-format
msgid "at $%s"
msgstr "à $%s"

#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
#, object-pascal-format
msgid "at $%s: from origin %s line %d"
msgstr "à $%s : depuis l'origine %s ligne %d"

#: lazarusidestrconsts.dbgeventbreakataddresssourceline
#, object-pascal-format
msgid "at $%s: %s line %d"
msgstr "à $%s : %s ligne %d"

#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
#, object-pascal-format
msgid "Source Breakpoint %s"
msgstr "Source du point d'arrêt %s"

#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
#, object-pascal-format
msgid "Unknown Breakpoint %s"
msgstr "Point d'arrêt %s inconnu"

#: lazarusidestrconsts.dbgeventbreakwatchpoint
#, object-pascal-format
msgid "Watchpoint %s"
msgstr "Point de suivi conditionnel %s"

#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
#, object-pascal-format
msgid "Unknown Watchpoint out of scope %s"
msgstr "Point de suivi conditionnel %s inconnu ou inaccessible"

#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
#, object-pascal-format
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Point de suivi inconnu déclenché %s. Ancienne valeur \"%s\" ; nouvelle valeur \"%s\""

#: lazarusidestrconsts.dbgeventwatchscopeended
#, object-pascal-format
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr "Point de suivi conditionnel pour \"%s\" hors de portée %s"

#: lazarusidestrconsts.dbgeventwatchtriggered
#, object-pascal-format
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Le point de suivi pour \"%s\" a été déclenché %s. Ancienne valeur \"%s\" ; nouvelle valeur \"%s\""

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Utiliser le profil prédéfini"

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Réinitialiser tous les paramètres"

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Réinitialiser tous les paramètres de la gouttière"

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Réinitialiser tous les paramètres de texte"

#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Ajouter un point d'historique"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Menu contextuel"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Menu contextuel (débogage)"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Menu contextuel (tab)"

#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Aller à l'implémentation"

#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Aller à l'implémentation/autre fin de bloc"

#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Historique en arrière"

#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Historique en avant"

#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr "Inverser le curseur supplémentaire"

#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Rien/par défaut"

#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Coller"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
#, object-pascal-format
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Continuer %0:s (Lié à : %1:s)"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
#, object-pascal-format
msgid "Continue %0:s"
msgstr "Continuer %0:s"

#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Sélectionner le texte"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Sélectionner le texte (lignes)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Sélectionner le texte (unités lexicales)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Sélectionner le texte (mots)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Sélectionner le texte (mode colonne)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Sélectionner le texte (mode ligne)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Définir le signet libre"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Sélectionner la ligne en cours (complète)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Sélectionner la ligne en cours (texte)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Sélectionner le paragraphe en cours"

#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Sélectionner le mot en cours"

#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Réinitialiser le zoom"

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Cette page ne rend pas compte de vos paramètres en cours. Voyez la page avancée. Utilisez cette page pour réinitialiser les modifications avancées"

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Général"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Standard -  toutes les actions (point d'arrêt, pliage) sur clic"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Étendu - actions (point d'arrêt, pliage) sur fin de clic. Sélection sur clic et déplacement"

#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr "Étendu - actions, seulement sur la moitié de gouttière à droite"

#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr "Utiliser les numéros de lignes pour choisir les lignes"

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Gouttière"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right button click includes caret move"
msgstr "Le clic droit entraîne le déplacement du curseur"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Texte"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Bouton Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Molette Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Bouton Alt"

#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Molette Alt"

#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Bouton Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Molette Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Faire glisser la sélection (copier/coller)"

#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Bouton Extra-1"

#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Bouton Extra-2"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt Double"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl Double"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Double"

#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Maj Double"

#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Quadruple"

#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Triple"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Bouton central"

#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Central"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
msgid "Horizontal-Wheel"
msgstr "Roulette horizontale"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Gauche 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Gauche 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Droite"

#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Molette"

#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Bouton droit"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Bouton Maj-Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Maj-Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Bouton Maj-Alt"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Molette Maj-Alt"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Bouton Maj-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Molette Maj-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Bouton Maj"

#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Molette"

#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Molette Maj"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Vous avez des modifications non enregistrées. L'utilisation de cette page annulera les modifications apportées à la page avancée"

#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Défilement horizontal (vitesse système)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Défilement horizontal (une ligne)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Défilement horizontal (page)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Défilement horizontal (demi-page)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Défilement horizontal (page moins une ligne)"

#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Rien/par défaut"

#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Défilement (vitesse système)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Défilement (une ligne)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Défilement (page)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Défilement (demi-page)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Défilement (page moins une ligne)"

#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Zoom"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Aucun >"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Lecture seule"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Minuscules avec première lettre en majuscule"

#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr "actif"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Ajouter l'opérateur d'affectation :="

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Parenthèses en surbrillance"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Arbre de pliage de code"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur
msgid "Code folding (current)"
msgstr "Pliage de code (en cours)"

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Texte par défaut"

#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr "Texte par défaut / Fenêtre"

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Point d'arrêt désactivé"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Point d'arrêt activé"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Ligne d'erreur"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Point d'exécution"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Marqueur de code plié"

#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr "Replier la ligne de départ"

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Global"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Gouttière"

#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Ligne"

#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr "Couleurs de contour"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Édition synchronisée"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Éditer le modèle de code"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Texte"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Séparateur de gouttière"

#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr "Masquer la ligne de départ"

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Incrémentales (autres)"

#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr "Préfixe en surbrillance"

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Mettre en surbrillance le mot en cours"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Recherche incrémentale"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Point d'arrêt incorrect"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Surlignage de la ligne en cours"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Numéro de la ligne"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Ligne modifiée"

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Lien souris"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
msgid "Level 10"
msgstr "Niveau 10"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
msgid "Level  1"
msgstr "Niveau  1"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
msgid "Level  2"
msgstr "Niveau  2"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
msgid "Level  3"
msgstr "Niveau  3"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
msgid "Level  4"
msgstr "Niveau  4"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
msgid "Level  5"
msgstr "Niveau  5"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
msgid "Level  6"
msgstr "Niveau  6"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
msgid "Level  7"
msgstr "Niveau  7"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
msgid "Level  8"
msgstr "Niveau  8"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
msgid "Level  9"
msgstr "Niveau  9"

#: lazarusidestrconsts.dlgaddhiattrrecentlyused
msgid "Recently used item"
msgstr "Élément récemment utilisé"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Aire sélectionnée"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Cellule active"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Autres cellules"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Cellules synchronisées"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Cellule active"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Autres cellules"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Cellules synchronisées"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Bloc de texte"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Point d'arrêt inconnu"

#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr "Bordure de fenêtre"

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Mot entre parenthèses"

#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Caractères spéciaux visualisés"

#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr "Ajouter un nouveau mode"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Ajouter un point-virgule"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Ajuster la ligne supérieure au commentaire qui précède"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Par ordre alphabétique"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always keep caret in visible area of editor"
msgstr "Toujours maintenir le curseur dans une partie visible de l'éditeur"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Action sur fichier équivoque :"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Prévenir à la compilation"

#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr "Une icône d'erreur/d'avertissement/de conseil est présente en tête d'un message. De toute façon, la même icône est présente dans la gouttière de l'éditeur de source."

#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr "Ansi (* *)"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Paramètres de l'application"

#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Inclure le code d'assertion"

#: lazarusidestrconsts.dlgassociateddebugdesktop
#, object-pascal-format
msgid "Associated debug desktop for \"%s\""
msgstr "Bureau de débogage associé pour \"%s\""

#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr "Si vous choisissez th bureau, le bureau de débogage associé sera lui aussi sélectionné."

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Créer les fiches automatiquement :"

#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr "L'unité principale .lpr crée toutes les fiches grâce à Application.CreateForm(). Elles sont aussi libérées automatiquement."

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "Auto-create new forms"
msgstr "Créer automatiquement les nouvelles fiches"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Supprimer automatiquement"

#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Afficher automatiquement les prototypes de fonction"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse pointer when typing"
msgstr "Cacher la souris pendant la frappe"

#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Indentation automatique"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Paramétrer l'indentation intelligente)"

#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Indentation automatique"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Supprimer automatiquement les méthodes vides"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Renommer automatiquement les fichiers en minuscules"

#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr "Sauvegarde automatique du bureau actif"

#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end"
msgstr ""
"Sauvegarder le bureau actif à la fermeture de l'EDI\n"
"Sauvegarder le bureau de débogage à la fermeture de l'EDI et en fin de débogage"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Fiches disponibles :"

#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr "Ces fiches doivent être créées et libérées par le code du programme."

#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr "Éviter les sauts non nécessaires"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Arrière-plan"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(pas de sous-répertoire)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Même nom (dans un sous-répertoire)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Derrière les méthodes"

#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Sélection"

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr "Indentation de bloc (espaces)"

#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Indentation de bloc"

#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(touches d'édition)"

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Espace/tabulation comme ligne précédente"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Position seulement"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Espaces"

#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "Tabulations puis coupure"

#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Tabulations puis espaces"

#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Indentation de bloc (tabulations)"

#: lazarusidestrconsts.dlgbookmarksetscroll
msgid "Restore scroll position for bookmarks"
msgstr "Rétablir la position de défilement des signets"

#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
msgstr "L'espace de bordure peut être paramétré dans l'éditeur d'ancre. Une ligne colorée est montrée si l'espacement est > à 0."

#: lazarusidestrconsts.dlgborderspacingcolor
msgid "BorderSpacing frame"
msgstr "Cadre d'espacement des bordures"

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Parenthèses en surbrillance"

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket and quote pairs"
msgstr "Parenthèses et guillemets appariés"

#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr "Vous ne pouvez pas utiliser un bureau ancré dans un environnement non ancré et vice versa."

#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Secondary carets (multi-caret mode)"
msgstr "Curseurs secondaires (mode multi curseurs)"

#: lazarusidestrconsts.dlgcaretcolor
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret (Text-Cursor)"
msgstr "Curseur (de texte)"

#: lazarusidestrconsts.dlgcaretcolorinfo
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
msgstr "La couleur du curseur dépend des couleurs du texte et du fond situés sous lui. Le RVB de chaque pixel est inversé au niveau du bit et  traité avec XOR avec le RVB de la couleur choisie."

#: lazarusidestrconsts.dlgcaretforecolor
msgid "Main or primary caret"
msgstr "Curseur principal ou primaire"

#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr "Curseur (curseur de texte)"

#: lazarusidestrconsts.dlgcaretscrollgroupoptions
msgid "Caret (Text Cursor) past end of line"
msgstr "Caret (curseur de texte) au-delà de la fin de la ligne"

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Sensible à la casse"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Vérification des options du compilateur"

#: lazarusidestrconsts.dlgccoorphanedfilefound
#, object-pascal-format
msgid "orphaned file found: %s"
msgstr "fichier orphelin trouvé : %s"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Résultats"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Test"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Test : vérification du compilateur..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Test : vérification de la configuration du compilateur..."

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Test : vérification de la date du compilateur..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Test : compilation d'un fichier vide..."

#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr "Test : vérification des unités RTL..."

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Test : vérification des codes sources dans les chemins de recherche des fichiers ppu de FPC..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Test : compilation d'un fichier vide"

#: lazarusidestrconsts.dlgccousingconfigfile
#, object-pascal-format
msgid "using config file %s"
msgstr "utilisation du fichier de configuration %s"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Ordre des classes"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "En dernier"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "minuscules"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Aperçu (longueur de ligne maximale = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Préfixe Read"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Suffixe stocké"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "MAJUSCULES"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Préfixe de variable"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Préfixe Write"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Enregistrer sous : renommer les fichiers Pascal en minuscules"

#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Vérifier et enregistrer automatiquement les fichiers"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Vérifier les paquets à la création de la fiche"

#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr "La fiche peut nécessiter l'utilisation d'un paquet. Installer automatiquement un tel paquet."

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Choisir le fichier de modèle de code (*.dci)"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Afficher les boutons de fermeture dans l'éditeur"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Profil des couleurs"

#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "Macros de style C (globales)"

#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Utiliser les chaînes Ansi"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Style de type assembleur"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Messages"

#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Vérifications et assertion"

#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Commandes du compilateur"

#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Opérateurs de style C (*=, +=, /= et -=)"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Créer le Makefile"

#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Débogage"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Ajout d'un chemin au débogueur (aucun) :"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Création de code"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Les deux"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Replier"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Masquer"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Inverser l'ordre de pliage dans le menu surgissant"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate info for the debugger (slower / increases exe-size)"
msgstr "Générer les informations de débogage (ralentit et augmente la taille de l'exécutable)"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Utiliser l'unité Heaptrc (test des fuites de mémoire)"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Inclure les fichiers (-Fi) :"

#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Debugger info"
msgstr "Informations concernant le débogueur"

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Bibliothèques (-Fl)"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Édition des liens"

#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Les options du compilateur peuvent être enregistrées dans un fichier XML."

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Modifier la couleur)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Non modifié"

#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Couleurs"

#: lazarusidestrconsts.dlgcolorstml
msgid "TML Setup"
msgstr "Mise en place de TML"

#: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile
#, object-pascal-format
msgid "Sample text file not found: %1:s"
msgstr "Fichier texte d'exemple introuvable : %1:s"

#: lazarusidestrconsts.dlgcolorstmlerror
msgid "Error:"
msgstr "Erreur :"

#: lazarusidestrconsts.dlgcolorstmlfromfile
msgid "File:"
msgstr "Fichier :"

#: lazarusidestrconsts.dlgcolorstmlinfo
#, object-pascal-format
msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed."
msgstr "Voici la liste des Highlighter (Textmate) trouvés dans le dossier %1:s.%0:sCette liste peut inclure des fichiers avec des erreurs et des fichiers qui ne sont pas encore actifs dans l'EDI.%0:sPour activer les fichiers nouvellement ajoutés/modifiés, redémarrer l'EDI.%0:sLe bouton \"Recharger\" mettra à jour la liste ci-dessous, en vérifiant si des erreurs ont été corrigées."

#: lazarusidestrconsts.dlgcolorstmlmissinginclude
#, object-pascal-format
msgid "Did not find all includes: %1:s"
msgstr "Impossible de trouver toutes les inclusions : %1:s"

#: lazarusidestrconsts.dlgcolorstmlnofilesfound
msgid "No files found."
msgstr "Aucun fichier trouvé."

#: lazarusidestrconsts.dlgcolorstmlnosampletxt
msgid "No sample text configured"
msgstr "Aucun exemple de texte configuré"

#: lazarusidestrconsts.dlgcolorstmlok
msgid "OK"
msgstr "OK"

#: lazarusidestrconsts.dlgcolorstmlrefresh
msgid "Reload"
msgstr "Recharger"

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Paramètres de la ligne de commande (sans le nom de l'application)"

#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr "Indentation maximale pour une nouvelle ligne si le préfixe est basé sur le début de la première ligne du commentaire :"

#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Limiter l'indentation à"

#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Préfixer les commentaires lors d'un passage à la ligne"

#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Correspondre à la ligne en cours"

#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "Correspondre au texte incluant \"*\" de l'unité lexicale \"(*\""

#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "Correspondre à la ligne entière"

#: lazarusidestrconsts.dlgcommentcontinuematchtext
#, object-pascal-format
msgid "Match text after token \"%s\""
msgstr "Correspondre au texte après l'unité lexicale \"%s\""

#: lazarusidestrconsts.dlgcommentcontinuematchtoken
#, object-pascal-format
msgid "Match text including token \"%s\""
msgstr "Correspondre au texte incluant l'unité lexicale \"%s\""

#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Préfixer la nouvelle ligne"

#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Aligner le préfixe sur l'indentation de la ligne précédente"

#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "Aligner le préfixe sous le début du commentaire pour la première ligne de ce dernier"

#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "Ne pas indenter le préfixe"

#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments and Strings"
msgstr "Commentaires et chaînes"

#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend if matched or not matched"
msgstr "Étendre avec ou sans correspondance"

#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend if matched or not matched (not at EOL)"
msgstr "Étendre avec ou sans correspondance (pas en fin de ligne)"

#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend if matched"
msgstr "Étendre si correspondance"

#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr "Étendre si correspondance et curseur au sein du texte (pas en fin de ligne)"

#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Compilation et édition des liens"

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Messages du compilateur"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "Fichier de langue des messages du compilateur (*.msg)"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Compléter les propriétés"

#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr "Le composant sous le curseur de la souris est tout d'abord sélectionné, ensuite les commandes du menu surgissant entrent en action."

#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Configuration et cible"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Fichiers de configuration"

#: lazarusidestrconsts.dlgconsolesizenotsupported
msgid "Current debugger does not support this."
msgstr "Le débogueur en cours ne prend pas en charge cette fonction."

#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Autres informations de débogage"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Débordement"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Analyse"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Copier/coller avec les informations de pliage"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy current word when no selection exists"
msgstr "Copier le mot en cours si aucun mot n'est sélectionné"

#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Intervalle"

#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Déplaçable"

#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Définir comme options par défaut du compilateur"

#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "&Afficher les options"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Lien intelligent"

#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Autres sources (fichiers .pp/.pas, utilisés seulement par l'EDI, pas par le compilateur)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Pile"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Éliminer les symboles de l'exécutable"

#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Type d'information de débogage"

#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automatique"

#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf 2"
msgstr "Dwarf 2"

#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf 2 with sets"
msgstr "Dwarf 2 avec ensembles"

#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf 3 (beta)"
msgstr "Dwarf 3 (béta)"

#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Stabs"

#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Variables de corbeille"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Style de l'unité"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Générer le code pour valgrind"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Verbosité"

#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "INLINE de style C++"

#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr "Créer de nouveaux paramètres d'exécution"

#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Accolades { }"

#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr "Actuellement respectés par la fenêtre des messages, sauter l'historique et les résultats des recherches."

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Curseur au-delà de la fin de ligne"

#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr "Le curseur à droite ou à gauche supprime la sélection (pas de mouvement)"

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Caret skips selection"
msgstr "Le curseur saute la sélection"

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Caret skips tabs"
msgstr "Le curseur saute les tabulations"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Extension utilisateur (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr "débogage"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Éditeur de chemin"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Type de débogueur et chemin"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Police par défaut pour l'éditeur"

#: lazarusidestrconsts.dlgdefaulttabfont
msgid "Default tab font"
msgstr "Police d'onglet par défaut"

#: lazarusidestrconsts.dlgdefaultwinpos
msgid "Default Window/Console position and size"
msgstr "Position et taille par défaut de la fenêtre/console"

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Valeur par défaut"

#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr "Supprimer le mode"

#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
msgid "Delete"
msgstr "Supprimer"

#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
msgid "Delete selected desktop"
msgstr "Supprimer le bureau sélectionné"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Supprimer le modèle de code "

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Les boutons "

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Conseils"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Les menus "

#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr "Nom du bureau"

#: lazarusidestrconsts.dlgdesktopsexported
#, object-pascal-format
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr "%d bureau(x) exporté(s) avec succès vers \"%s\""

#: lazarusidestrconsts.dlgdesktopsimported
#, object-pascal-format
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr "%d bureau(x) importé(s) avec succès depuis \"%s\""

#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr "Différentes valeurs d'arrière-plan"

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Sens"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Désactiver l'anticrénelage"

#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr "La distance entre les points de la grille est le plus petit déplacement possible pour un contrôle."

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Utiliser la couleur de la marge de droite"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Dessiner le diviseur de niveaux"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Couleur de ligne imbriquée"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Couleur de ligne"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedure/Function"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (local)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Divisions de l'unité"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Clause uses"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"

#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr "Écrire le nom du composant au-dessous."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Retour"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Gras"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Sous-répertoire"

#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Modèles de code"

#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Ajouter l'instruction de fermeture pour les blocs en Pascal"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Extension utilisateur"

#: lazarusidestrconsts.dlgeddelayinsec
#, object-pascal-format
msgid "(%s sec delay)"
msgstr "(délai de %s sec)"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Affichage"

#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Éditeur de fichiers"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Compléter l'identificateur"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Inverser"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Ignorer les verrouillages et utiliser le plus long éditeur non utilisé"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Ignorer les verrouillages si l'éditeur est celui en cours"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Ignorer les verrouillages si l'éditeur est la fenêtre en cours"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Verrouillé si le texte est visible"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Déverrouillé"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Déverrouillé si le texte est en vue centrée"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Nouvel onglet, nouvelle fenêtre ou existante"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Nouvel onglet dans une nouvelle fenêtre"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Nouvel onglet dans la fenêtre existante"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Cette option utilise le plus long éditeur non utilisé pour le fichier, même s'il est verrouillé et/ou a besoin de défiler. La détermination du plus long éditeur non utilisé n'examine pas l'ordre dans lequel les fenêtres ont reçu le focus, même si c'est l'option choisie par le paramètre \"même critère d'ordre\". Cette option va toujours réussir ; les autres options ne sont jamais testées."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Cette option va vérifier si l'éditeur actif en cours possède le fichier cible et si c'est le cas, il va utiliser l'éditeur en cours, même s'il est verrouillé et/ou a besoin de défiler."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Cette option va vérifier s'il y a un éditeur pour le fichier cible dans la fenêtre en cours et s'il y est, il utilisera cet éditeur même s'il est verrouillé et/ou a besoin de défiler."

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Cette option va utiliser un éditeur verrouillé (et seulement un verrouillé) qui n'a pas besoin de défiler dans le but d'afficher la cible du saut (la cible du saut est toujours dans la partie visible de l'écran)."

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Cette option utilisera n'importe quel éditeur non verrouillé."

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Cette option utilisera un éditeur non verrouillé qui n'a pas besoin de défilement pour afficher la cible du saut (la cible du saut cible est déjà dans la zone centrale de l'écran visible, excluant entre 2 et 5 lignes en haut et en bas)."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Cette option va ouvrir un nouvel onglet dans une fenêtre existante ou nouvelle si aucun onglet déverrouillé n'est trouvé. Cette option va toujours réussir ; les options supplémentaires ne sont jamais testées."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Si aucun onglet déverrouillé n'est trouvé, cette option va ouvrir un nouvel onglet dans une nouvelle fenêtre (même si d'autres fenêtres existantes pourraient être utilisées pour le nouvel onglet). Cette option va toujours réussir ; les options supplémentaires ne sont jamais testées."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr "Si aucun onglet déverrouillé n'est trouvé, cette option va ouvrir un nouvel onglet dans une fenêtre existante (et seulement dans une existante). Un onglet n'est ouvert que s'il existe une fenêtre qui n'a pas encore d'éditeur pour le fichier cible."

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Italique"

#: lazarusidestrconsts.dlgeditexportbackcolor
msgid "Use Background color in HTML export"
msgstr "Utiliser la couleur d’arrière-plan dans l’exportation HTML"

#: lazarusidestrconsts.dlgeditmaxlength
msgid "(Edit Max Length)"
msgstr "(Modifier la longueur maximale)"

#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Taille de la police de l'éditeur"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Options de l'éditeur"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Globaux pour le profil"

#: lazarusidestrconsts.dlgedmisc
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Divers"

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Désactivé"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Activé"

#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Tabulation et indentation"

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Souligné"

#: lazarusidestrconsts.dlgelastictabs
msgid "Elastic tabs"
msgstr "Onglets élastiques"

#: lazarusidestrconsts.dlgelastictabswidths
msgid "Elastic min Widths"
msgstr "Largeurs minimales élastiques"

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Attributs des éléments"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "La touche Fin va à la fin la plus proche"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Demander"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Remarque : les fichiers du projet sont tous ceux figurant dans son répertoire"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Sauvegarde"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Fichiers"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Grille"

#: lazarusidestrconsts.dlgenvidestartup
msgid "IDE Startup"
msgstr "Démarrage de l'EDI"

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Langage"

#: lazarusidestrconsts.dlgenvlanguagerestarthint
msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint"
msgid "Restart the IDE to complete the language change."
msgstr "Redémarrer l'EDI pour terminer le changement de langue."

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Lignes directrices"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Divers"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Aucun"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Autres fichiers"

#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Onglets du projet"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Type"

#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr "Focus sur les messages lors de la compilation"

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra character spacing"
msgstr "Espace supplémentaire entre les caractères"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Interligne supplémentaire"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external debug symbols file"
msgstr "Utiliser un fichier d'informations de débogage externe"

#: lazarusidestrconsts.dlgfileassociationinos
msgid "Opening Files from OS"
msgstr "Ouverture des fichiers à partir du système d'exploitation"

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Extensions de fichier"

#: lazarusidestrconsts.dlgfiles
#, object-pascal-format
msgid "%s files"
msgstr "%s fichiers"

#: lazarusidestrconsts.dlgfilterall
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Tous les fichiers"

#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr "Fichier modèle d'outils de code"

#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr "Fichier DCI"

#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr "Fiche Delphi"

#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Paquet Delphi"

#: lazarusidestrconsts.dlgfilterdelphiproject
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Projet Delphi"

#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Unité Delphi"

#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr "Exécutable"

#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr "Fichier de messages FPC"

#: lazarusidestrconsts.dlgfilterfppkgconfigurationfile
msgid "Fppkg configuration file"
msgstr "Fichier de configuration de Fppkg"

#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr "Fichiers HTML"

#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr "Images Bitmap"

#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr "Images Pixmap"

#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr "Images PNG"

#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Paramètres du bureau Lazarus"

#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "Types de fichiers de l'éditeur"

#: lazarusidestrconsts.dlgfilterlazarusfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Fichier Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusform
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Fiche Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusinclude
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Fichier d'inclusion Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Autre fichier Lazarus"

#: lazarusidestrconsts.dlgfilterlazaruspackage
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Paquet Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusproject
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Projet Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusprojectsource
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Code source du projet Lazarus"

#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr "Session Lazarus"

#: lazarusidestrconsts.dlgfilterlazarusunit
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Unité Lazarus"

#: lazarusidestrconsts.dlgfilterpackagelistfiles
msgid "Package list files"
msgstr "Fichiers de liste de paquets"

#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "Fichier Pascal"

#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Programmes"

#: lazarusidestrconsts.dlgfilterxml
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "Fichiers XML"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Chercher le texte sous le curseur"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Bloc"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Section de bloc"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Commentaire"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Nœud"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Item"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "List <>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Objet (inherited, inline)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (local)"

#: lazarusidestrconsts.dlgfoldpasanonprocedure
msgid "Anonymous Procedure"
msgstr "Procédure anonyme"

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Commentaire (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (imbriqué)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Commentaire { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"

#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr "For/Do"

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"

#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "If/Then/Else"

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Commentaire imbriqué"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (procédure)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedure"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"

#: lazarusidestrconsts.dlgfoldpasrecordcase
msgid "Record case"
msgstr "Cas d'enregistrement"

#: lazarusidestrconsts.dlgfoldpasrecordcasesect
msgid "Record case section"
msgstr "Section des cas d'un enregistrement"

#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Commentaire //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unité"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Section Unit"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (global)"

#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr "While/Do"

#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr "With/Do"

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Commentaire"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Nœud"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Instruction de traitement"

#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr "Forcer la mise à l'échelle DPI à la conception"

#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr "Lorsque cette case est cochée, les paramètres de mise à l'échelle du projet seront ignorés - seule la propriété Scaled de la fiche, du cadre ou du module de données sera prise en compte."

#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr "L'instance en cours de Lazarus ne peut pas accepter un quelconque fichier."

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Avant-plan"

#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr "Changer le contenu de l'inspecteur d'objets en cliquant sur la barre de titre de la fiche"

#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr "Montrer les propriétés de la fiche dans l'inspecteur d'objets en cliquant sur sa barre de titre."

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Règles d'insertion des procédures"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Préserver l'ordre des procédures"

#: lazarusidestrconsts.dlgfpcexecutable
#, object-pascal-format
msgid "Compiler executable (e.g. %s)"
msgstr "Exécutable du compilateur (par exemple %s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Répertoire des codes sources de FPC"

#: lazarusidestrconsts.dlgfppkgconfigurationfile
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
msgstr "Fichier de configuration Fppkg (ex. fppkg.cfg)"

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Marque-texte"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Éditeur de fiche"

#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "&Depuis le début"

#: lazarusidestrconsts.dlgfromcursor
msgid "From c&ursor"
msgstr "Depuis le c&urseur"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Global"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Générer du code pour GPROF"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Couleur d'accroche"

#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr "Les bureaux grisés sont réservés à un environnement avec ancrage."

#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr "Les bureaux grisées sont pour un environnement non ancré."

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Couleur de la grille"

#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr "La grille est constituée de petits points qui facilitent l'alignement des contrôles."

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Taille de grille X"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Pas d'espacement horizontal de la grille"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Taille de grille Y"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Pas d'espacement vertical de la grille"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Explorateur de code"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Outils de code"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Débogueur"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Éditeur"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Environnement"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Défaire groupé"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Afficher les lignes directrices"

#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr "Quand un contrôle est aligné horizontalement ou verticalement avec d'autres contrôles, une ligne bleue de repère est affichée."

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Gouttière"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Replié"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Couleur de gouttière"

#: lazarusidestrconsts.dlgguttercurrentlinenumber
msgid "Current Line (number)"
msgstr "Ligne en cours (numéro)"

#: lazarusidestrconsts.dlgguttercurrentlineother
msgid "Current Line (other)"
msgstr "Ligne en cours (autre)"

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Couleur du bord de gouttière"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Index du séparateur de gouttière"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Défilement d'une demi-page"

#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Tailles de pile et de tas"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Taille du tas"

#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr "Hauteur d'une propriété dans la grille."

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Hauteur :"

#: lazarusidestrconsts.dlghideideonrun
#, fuzzy
#| msgid "Hide IDE windows on run"
msgid "Hide IDE windows on Run/Debug"
msgstr "Cacher l'EDI à l'exécution ou au débogage"

#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr "Ne pas du tout montrer l'EDI pendant l'exécution du programme."

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Cacher l'onglet dans les fenêtres d'une seule page"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Couleur de surlignage"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Couleur de surlignage de la police"

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Caret"
msgstr "Gauche du curseur"

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Caret"
msgstr "Droite du curseur"

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Afficher les conseils pour le paramètre \"Sender\" non utilisé"

#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Afficher les conseils pour les unités non utilisées"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "La touche \"Home\" va au début le plus proche"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Application hôte"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Complétion des identificateurs"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Règles pour les identificateurs"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Options de l'EDI"

#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "Code $IFDEF actif"

#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "Code $IFDEF inactif"

#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "État $IFDEF mixte (code)"

#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Nœud $IFDEF actif"

#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Nœud $IFDEF inactif"

#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "État $IFDEF mixte (nœud)"

#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:"
msgstr ""
"Un bureau portant le même nom existe déjà.\n"
"Veuillez confirmer le nom du bureau :"

#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
msgid "Include code templates"
msgstr "Inclure les modèles de code"

#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr "Inclure les identificateurs avec préfixe"

#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
msgid "Include all keywords and operators"
msgstr "Inclure tous les mots-clés et les opérateurs"

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Inclure les variables système"

#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr "Inclure les mots"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr "ne pas inclure"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr "depuis toutes les unités"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr "depuis l'unité en cours"

#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr "Indenter"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr "Tabulations"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "En tête des méthodes"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Le nom du constructeur doit être \"init\" (le destructeur doit être \"done\")"

#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Insérer les parties de classe"

#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Implementation"

#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Interface"

#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr "Insérer les implémentations de méthodes"

#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Insertion dans la clause uses de"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Insérer un espace après"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Insérer un espace devant"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Intervalle en secondes"

#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr "Position verticale pour un saut de bloc de code en % (0 = sommet ; 100 = bas)"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Sauts"

#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr "Position verticale pour un saut de ligne en % (0 = sommet ; 100 = bas)"

#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr "Aller directement au corps de la méthode"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep caret X position when navigating up/down"
msgstr "Préserver la position X du curseur lors d'une navigation vers le haut/le bas"

#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Touche d'édition)"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Assignation des touches"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Erreurs d'assignation de touches"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Règles pour les mots-clés"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Autoriser LABEL et GOTO"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Langue"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "À la fin du code source"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Répertoire de Lazarus (par défaut pour tous les projets)"

#: lazarusidestrconsts.dlglazarusinstances
msgid "Lazarus instances"
msgstr "Instances de Lazarus"

#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Lignes directrices (gauche, haut)"

#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly with small limitations)"
msgstr "Niveau 1 (rapide, avec débogueur convivial et quelques limitations)"

#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (-O1 + optimisations rapides)"

#: lazarusidestrconsts.dlglevel3opt
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (-O2 + optimisations lentes)"

#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr "4 (-O3 + optimisations agressives - à utiliser avec prudence)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization, for debugging)"
msgstr "Niveau 0 (pas d'optimisations, pour débogage)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Coupure de ligne"

#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Lier intelligemment"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Afficher les numéros des lignes dans les traces d'erreurs à l'exécution"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Afficher les fiches du projet"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Afficher les cadres du projet"

#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Afficher les unités du projet"

#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "Exécutable Make"

#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr "Gestion des bureaux"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Marge et gouttière"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Couleur de marqueur"

#: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec
#, object-pascal-format
msgid "(%s sec delay after caret move)"
msgstr "(%s s de sélai après le déplacement du curseur)"

#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr "Marque verticale"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight all occurrences of Word under Caret"
msgstr "Mettre en évidence toutes les occurrences du mot sous le curseur"

#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr "Schéma (global)"

#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr "Attention : aucune couleur n'est configurée pour la langue sélectionnée"

#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Balise définie par l'utilisateur"

#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Supprimer"

#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
#, object-pascal-format
msgid "Delete list \"%s\"?"
msgstr "Voulez-vous supprimer la liste \"%s\" ?"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term by key"
msgstr "Ajouter un mot ou un terme par clé"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term by key"
msgstr "Retirer un mot ou un terme par clé"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term by key"
msgstr "Inverser un mot ou un terme par clé"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Dupliquer un terme"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
#, object-pascal-format
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "Le terme %s existe déjà. Les doublons seront supprimés lorsque la liste sera enregistrée."

#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Ajouter/retirer dans tous les éditeurs"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Supprimer la liste"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Nom"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Ajouter la liste"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Sensible à la casse"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Établir la limite à la fin du terme"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Établir la limite au début du terme"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Ignorer les limites pour les termes plus longs que"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "sélection"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "mot courant"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Paramètres pour les termes ajoutés par clé"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "Appariement intelligent des limites de sélection"

#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Nouvelle liste"

#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "Aucune liste"

#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Sélectionner..."

#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key mappings"
msgstr "Assignation des touches"

#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Paramètres principaux"

#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr "Parenthèses de mot au curseur (global)"

#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match whole words, if length is less or equal to:"
msgstr "Vérifier les limites d'un mot pour une longueur inférieure ou égale à :"

#: lazarusidestrconsts.dlgmarkupwordkeycombo
#, object-pascal-format
msgid "Markup current word by key: %s"
msgstr "Marquer le mot actuel par la clé : %s"

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Ignorer les mots-clés"

#: lazarusidestrconsts.dlgmarkupwordoncaretmove
msgid "Automatically markup current word on caret move"
msgstr "Marquer automatiquement le mot en cours lors du mouvement du curseur"

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Supprimer les espaces (quand on surligne la sélection courante)"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Nombre maximum"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Longueur maximale d'une ligne :"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Maximum de fichiers récents"

#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr "La valeur 0 signifie illimité."

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Maximum de fichiers de projets récents"

#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
msgid "Middle-click-modifier to close all other tabs"
msgstr "Clic moyen-modificateur pour fermer tous les autres onglets"

#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
msgid "Middle-click-modifier to close tabs on the right"
msgstr "Clic moyen-modificateur pour fermer les onglets à droite"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Mélanger méthodes et propriétés"

#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr "Mode"

#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Action de la souris"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Simple"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Double"

#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Triple"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Quadruple"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Tous"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Gauche"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Milieu"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Chemin de Make"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Droite"

#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Molette vers le bas"

#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
msgid "Wheel left"
msgstr "Roulette gauche"

#: lazarusidestrconsts.dlgmouseoptbtnwheelright
msgid "Wheel right"
msgstr "Roulette droite"

#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Molette vers le haut"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Capture"

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Déplacer le curseur (extra)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Action sur fin de clic"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Action"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Clic"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Éditer la souris"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Entrée dupliquée"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Cette entrée entre en conflit avec une entrée existante"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Bouton"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr "Curseur"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Contexte"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Clic"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Action"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Haut/Bas"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Option"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Ordre"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Priorité"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Maj"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Souris"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Avancé"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Commande de l'EDI"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "O"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Maj"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "O"

#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Tout"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Gouttière"

#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr "Changements de ligne"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Arbre de pliage"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Réduit [+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Développé [-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr "Aperçu"

#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr "Marque d'aperçu"

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Numéros de lignes"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Texte"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Sélection"

#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Opt"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "D'autres actions utilisant le même bouton"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Ils peuvent être exécutés en fonction des touches de modification, des paramétrages d'échecs, simple/double, haut/bas..."

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Filtrer les Mod-Keys"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Priorité"

#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Déboguer"

#: lazarusidestrconsts.dlgmsgwincolorurgenterror
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Erreur"

#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr "Fatal"

#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "Conseil"

#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr "Important"

#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr "Normal"

#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr "Note"

#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr "Panique"

#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr "Heure et statistiques"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr "Verbeux"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr "Verbosité 2"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr "Verbosité 3"

#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Avertissement"

#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr "Les touches de navigation déplacent tous les curseurs (sélection de colonne)"

#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr "Ne pas tenir compte de la touche Supp. en fin de ligne"

#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr "Curseurs multiples"

#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr "Les touches de navigation déplacent tous les curseurs"

#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr "Activer les curseurs multiples pour la sélection de colonne"

#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr "toujours démarrer une nouvelle instance"

#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr "ne pas autoriser plusieurs instances"

#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr "ouvrir les fichiers dans l'instance en cours"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Multisélection"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Jump target priority between multiple editors"
msgstr "Priorité de cible de saut entre plusieurs éditeurs"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Classement à utiliser pour les éditeurs répondant aux mêmes critères"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Le plus récent éditeur ayant le focus pour ce fichier"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "L'éditeur (pour fichier) dans la plus récente fenêtre ayant le focus"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Liste prioritaire de critères pour choisir un éditeur :"

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Pages et fenêtres"

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Position des onglets de l'éditeur de source"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Nommage"

#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr "Nouveau bureau..."

#: lazarusidestrconsts.dlgnewprojecttype
msgid "New Project Type"
msgstr "Nouveau type de projet"

#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Pas de renommage automatique"

#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Pas d'unité disponible à ajouter."

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Pas de surlignage"

#: lazarusidestrconsts.dlgnonformbackgroundcolor
msgid "Other Designer background (e. g. TDataModule)"
msgstr "Fond des autres concepteurs (par ex. TDataModule)"

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Position des onglets de l'éditeur de source"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Ne pas couper la ligne après"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Ne pas couper la ligne devant"

#: lazarusidestrconsts.dlgnsprincipalclass
msgid "NSPrincipalClass"
msgstr "NSPrincipalClass"

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Inspecteur d'objets"

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height (0 = auto)"
msgstr "Hauteur d'élément (0 = automatique)"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Divers"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Configuration rapide"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Utiliser les paramètres par défaut de Delphi"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Utiliser les paramètres par défaut de Lazarus"

#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Niveaux d'optimisation"

#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Autres optimisations"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Autres fichiers unités (-Fu)"

#: lazarusidestrconsts.dlgoverviewgutterback1color
msgid "Background 1"
msgstr "Arrière-plan 1"

#: lazarusidestrconsts.dlgoverviewgutterback2color
msgid "Background 2"
msgstr "Arrière-plan 2"

#: lazarusidestrconsts.dlgoverviewguttercolor
msgid "Overview Gutter"
msgstr "Plan d'ensemble de la gouttière"

#: lazarusidestrconsts.dlgoverviewgutterpagecolor
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
msgid "Page"
msgstr "Page"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Écraser le bloc"

#: lazarusidestrconsts.dlgoverwritedesktop
#, object-pascal-format
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?"
msgstr ""
"Un bureau portant le nom \"%s\" a été trouvé.\n"
"L'ancien bureau doit-il être remplacé ?"

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Conseils pour la palette de composants"

#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Extension Pascal par défaut"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Surligner les instructions de contrôle comme des mots-clés"

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr "Pascal étendu : options des mots-clés"

#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr "Balisage (au curseur)"

#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Mots-clés appariés"

#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr "Schéma"

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Passer les options à l'éditeur de liens avec \"-k\", le délimiteur étant l'espace"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr "Mettre en évidence le mot-clé \"String\""

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Par défaut"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Aucun"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Seulement \"String\""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Bloc persistant"

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Visible caret in unfocused editor"
msgstr "Curseur visible dans un éditeur non actif"

#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr "Le curseur dans un éditeur inactif ne clignote pas"

#: lazarusidestrconsts.dlgpoansiutf8
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
msgstr "La codepage ANSI est UTF-8 (Windows 10 1903+)"

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Application"

#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "comme invocateur (asInvoker)"

#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "Effacer l'icône"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Créer un ensemble application"

#: lazarusidestrconsts.dlgpodebugger
msgctxt "lazarusidestrconsts.dlgpodebugger"
msgid "Debugger"
msgstr "Débogueur"

#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Icône par &défaut"

#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr "Prise en compte du DPI"

#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr "désactivé"

#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr "Vista-8 : désactivé, 8.1+ : par moniteur"

#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr "Vista-8 : activé, 8.1+ : par moniteur"

#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr "Vista-8 : on, 8.1/10+ : par moniteur/V2"

#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr "activé"

#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Niveau d'exécution"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Fiches"

#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "le plus grand possible (highestAvailable)"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Icône :"

#: lazarusidestrconsts.dlgpoicondesc
#, object-pascal-format
msgid "(size: %d:%d, bpp: %d)"
msgstr "(taille : %d:%d, bpp : %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(aucun)"

#: lazarusidestrconsts.dlgpointertypecheck
msgid "@<pointer> returns a typed pointer"
msgstr "@<pointer> renvoie un pointeur typé"

#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "&Charger une icône"

#: lazarusidestrconsts.dlgpolongpathaware
msgid "Long path awareness (Windows 10 1607+)"
msgstr "Prise en charge des chemins longs (Windows 10 1607+)"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Divers"

#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "administrateur requis (requireAdministrator)"

#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Ressources"

#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "&Enregistrer l'icône"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Session"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Titre :"

#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "Accès UI (uiAccess)"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr "Utiliser l'ensemble application pour exécuter et déboguer"

#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr "Utiliser la mise à l'échelle LCL (Hi-DPI)"

#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest resource (and enable themes)"
msgstr "Utiliser les ressources \"manifest\" (et autoriser les thèmes)"

#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Préférer le double-clic au clic simple"

#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Priorités"

#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Projet"

#: lazarusidestrconsts.dlgprojectoptionsfor
#, object-pascal-format
msgid "Options for Project: %s"
msgstr "Options pour le projet : %s"

#: lazarusidestrconsts.dlgprojecttoopenorcreate
msgid "Project to Open or Create"
msgstr "Projet à créer ou à ouvrir"

#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Fichiers du projet"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "&Invite pour les remplacements"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Complétion de propriété"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Nom de propriété"

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project and packages at start"
msgstr "Ouvrir les derniers projet et paquets au démarrage"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Voir l'espacement des bordures"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Afficher la grille"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Aligner sur la grille"

#: lazarusidestrconsts.dlgreallydeletedesktop
#, object-pascal-format
msgid "Really delete desktop \"%s\"?"
msgstr "Voulez-vous vraiment supprimer le bureau \"%s\" ?"

#: lazarusidestrconsts.dlgredirappend
msgid "To file (append)"
msgstr "Vers le fichier (ajout)"

#: lazarusidestrconsts.dlgredirinput
msgid "From file"
msgstr "Depuis le fichier"

#: lazarusidestrconsts.dlgredirinputend
msgid "From file (at EOF)"
msgstr "Depuis le fichier (à la fin)"

#: lazarusidestrconsts.dlgrediroff
msgid "No redirection"
msgstr "Pas de redirection"

#: lazarusidestrconsts.dlgrediroverwrite
msgid "To file (overwrite)"
msgstr "Vers le fichier (écraser)"

#: lazarusidestrconsts.dlgredirstderr
msgid "Redirect StdErr"
msgstr "Rediriger StdErr"

#: lazarusidestrconsts.dlgredirstdin
msgid "Redirect StdIn"
msgstr "Rediriger Stdln"

#: lazarusidestrconsts.dlgredirstdnotsupported
msgid "Current debugger does not support redirection."
msgstr "Le débogueur en cours ne prend pas en charge la redirection."

#: lazarusidestrconsts.dlgredirstdout
msgid "Redirect StdOut"
msgstr "Rediriger StdOut"

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Référence"

#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "&Expressions régulières"

#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr "Renommer le bureau"

#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
msgid "Rename"
msgstr "Renommer"

#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
msgid "Rename selected desktop"
msgstr "Renommer le bureau sélectionné"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "&Tout remplacer"

#: lazarusidestrconsts.dlgreplacewith
msgid "Replace wit&h"
msgstr "&Remplacer par"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Rapport"

#: lazarusidestrconsts.dlgreset
msgctxt "lazarusidestrconsts.dlgreset"
msgid "Reset"
msgstr "Réinitialiser"

#: lazarusidestrconsts.dlgresetall
msgid "Reset all"
msgstr "Tout réinitialiser"

#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Lignes directrices (droite, bas)"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Clic droit pour sélectionner"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Marge droite"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Répertoire de travail"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Sélectionner les petits-enfants"

#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Création de code"

#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Sélection de code"

#: lazarusidestrconsts.dlgrunninginstancemodalerror
#, object-pascal-format
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s"
msgstr ""
"L'instance en cours de Lazarus ne peut pas accepter de fichiers.\n"
"Voulez-vous en ouvrir grâce à une nouvelle instance de l'EDI ?\n"
"\n"
"%s"

#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr "L'instance de Lazarus est en cours d'exécution, mais ne répond pas."

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Affichage (pas pour Win32 ; par exemple : 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Environnement"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Local"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Variables système"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Utiliser l'affichage"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Redéfinitions de l'utilisateur"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Paramètres d'exécution"

#: lazarusidestrconsts.dlgrunwithdebug
msgid "Run uses the debugger (disable for release-mode)"
msgstr "L'exécution utilise le débogueur (désactiver pour la publication)"

#: lazarusidestrconsts.dlgsavecurrentdesktop
msgid "Save current desktop"
msgstr "Enregistrer le bureau courant"

#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr "Enregistrer le bureau courant sous"

#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
msgid "Save active desktop as ..."
msgstr "Sauvegarder le bureau actif sous..."

#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
msgid "Save active desktop as"
msgstr "Sauvegarder le bureau actif sous"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Ligne enregistrée"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Enregistrer les informations de l'éditeur pour les fichiers fermés"

#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr "Les fichiers sont disponibles dans la liste d'historique \"Récemment ouverts\"."

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Enregistrer les informations de l'éditeur seulement pour les fichiers projets"

#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr "Seulement les fichiers de ce projet."

#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr "Enregistrer dans"

#: lazarusidestrconsts.dlgscrollbarpasteolfixed
msgid "Force 1024 columns minimum for horizontal scroll range"
msgstr "Forcer 1024 colonnes minimum pour la plage de défilement horizontal"

#: lazarusidestrconsts.dlgscrollbarpasteolnone
msgid "Do not add any permanent space to horizontal scroll range"
msgstr "Ne pas ajouter d'espace permanent à la plage de défilement horizontal"

#: lazarusidestrconsts.dlgscrollbarpasteolpage
msgid "Always add one page to horizontal scroll range"
msgstr "Toujours ajouter une page à la plage de défilement horizontal"

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Faire défiler d'un de moins"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Défilement"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Afficher les conseils de défilement"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Défilement après la fin du fichier"

#: lazarusidestrconsts.dlgscrollpastendline
msgid "Allow Caret to move past the end of line"
msgstr "Autoriser le curseur à franchir la fin de ligne"

#: lazarusidestrconsts.dlgseachdirectorynotfound
#, object-pascal-format
msgid "Search directory \"%s\" not found."
msgstr "Répertoire de recherche \"%s\" introuvable."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Recherche interrompue par l'utilisateur."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Recherche en cours..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Chemins"

#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr "Portée de la recherche"

#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr "Sélectionner tous les contrôles enfants avec leur parent."

#: lazarusidestrconsts.dlgselectallnoscroll
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
msgstr "Ne faites pas défiler sur Tout sélectionner/ Paragraphe ou Jusqu'à l'accolade"

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "&Texte sélectionné"

#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
msgid "Set active"
msgstr "Rendre actif"

#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
msgid "Set active"
msgstr "Rendre actif"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Réinitialiser tous les éléments"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Réinitialiser l'élément"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Variable d'affectation"

#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr "Le nom du paramètre pour la procédure \"setter\" par défaut."

#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr "est un préfixe"

#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr "Si coché, \"Set property variable\" est un préfixe. Sinon, il s'agit d'un nom fixe."

#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr "utiliser const"

#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr "Si coché, le paramètre \"setter\" est marqué avec \"const\"."

#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Montrer toutes les unités"

#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of nonvisual components"
msgstr "Afficher les étiquettes des composants non visuels"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Afficher les procédures compilées"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Afficher les numéros de lignes"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Afficher les expressions conditionnelles"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Afficher les informations de débogage"

#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Montrer les conseils du concepteur"

#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr "La bulle d'aide montre la position du contrôle lors de son déplacement ou de son redimensionnement."

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Tout afficher"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Afficher les informations concernant l'exécutable (Win32 seulement)"

#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr "Monter le nom du fichier dans le libellé"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Afficher les informations générales"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Afficher les conseils de gouttière"

#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Afficher les conseils"

#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr "Affichage des fenêtres"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Afficher les numéros de lignes"

#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr "Afficher les icônes de messages"

#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Afficher les notes"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Afficher les fichiers essayés"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Afficher les fichiers utilisés"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Afficher les avertissements"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Afficher un seul bouton dans la barre des tâches"

#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Aller au-delà des déclarations de classes"

#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Barres obliques //"

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Tabulations intelligentes"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Symbole derrière (.pp~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Compteur (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Symbole devant (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Aligner sur les lignes directrices"

#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr "Quand un contrôle est presque aligné avec un autre contrôle, il s'aligne sur sa position."

#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr "Tabulations lignes multiples"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Espace"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Conseils pour les principaux boutons rapides (ouvrir, enregistrer...)"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Origine"

#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Taille de la pile"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Arrêt après ce nombre d'erreurs :"

#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Ajouter au texte pour fermer la chaîne"

#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Préfixer la chaîne sur une nouvelle ligne"

#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "Chaîne ''"

#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Étendre les chaînes sur saut de ligne"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Sous-propriétés"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Options de la syntaxe"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "La tabulation indente les blocs"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Afficher les numéros de tabulations dans l'éditeur"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulations en espaces"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Largeur de tabulation"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Famille de CPU cible"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Système d'exploitation de destination"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Plateforme cible"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Processeur cible"

#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Options spécifiques de la cible"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Répertoire pour la création de projets de test"

#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr "Style de texte"

#: lazarusidestrconsts.dlgtexttofind
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "Search s&tring"
msgstr "Chercher la &chaîne"

#: lazarusidestrconsts.dlgthiselementusescolor
msgid "The element uses (and edits) the schemes:"
msgstr "L'élément utilise (et édite) les schémas :"

#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
msgid "Toggle as debug desktop"
msgstr "Basculer en bureau de débogage"

#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
msgid "Toggle as debug desktop"
msgstr "Basculer en bureau de débogage"

#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Conseil sur Classe/Procédure courante"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Style de suppression des espaces"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Curseur ou Édition"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Ligne éditée"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Quitter la ligne"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Position seulement"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Supprimer les espaces à la fin"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Défaire après enregistrement"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Défaire / Refaire"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Limite pour l'annulation"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Rafraîchir"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Répertoire de sortie pour les unités (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Ligne non enregistrée"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Repliage de code"

#: lazarusidestrconsts.dlguseconsolebuffer
msgid "Set Columns/Rows"
msgstr "Définir les colonnes/lignes"

#: lazarusidestrconsts.dlguseconsolepos
msgid "Set Left/Top"
msgstr "Définir à gauche/en haut"

#: lazarusidestrconsts.dlguseconsolesize
msgid "Set Width/Height"
msgstr "Définir la largeur/hauteur"

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Utiliser un fichier supplémentaire de configuration du compilateur"

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Dessin des séparateurs"

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Utiliser le fichier de configuration standard du compilateur (fpc.cfg)"

#: lazarusidestrconsts.dlgusehighlight
msgid "Use Highlight"
msgstr "Utiliser la surbrillance"

#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr "Icônes dans la boîte de complétion de code"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Utiliser une application de démarrage"

#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr "IME géré par le système"

#: lazarusidestrconsts.dlguserschemeerror
#, object-pascal-format
msgid "Failed to load user-scheme file %s"
msgstr "Échec du chargement du fichier de profil utilisateur %s"

#: lazarusidestrconsts.dlguseschemedefaults
msgid "- Scheme globals -"
msgstr "- Schémas globaux -"

#: lazarusidestrconsts.dlguseschemelocal
msgid "selected language"
msgstr "langage choisi"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Utiliser la coloration syntaxique"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Utiliser l'historique des onglets lors de leur fermeture"

#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Ajouter une unité à la clause uses"

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Valeur"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Messages détaillés pendant la compilation :"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Gouttière visible"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Marge droite visible"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "&Mots entiers seulement"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Largeur :"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Application graphique Win32"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Fenêtre"

#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Exceptions"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Mots"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Aperçu"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "Insérer le logo de FPC"

#: lazarusidestrconsts.drsignoringprojectdebuggersettings
msgid " (Ignoring project settings below)"
msgstr " (Ignorer les paramètres du projet ci-dessous)"

#: lazarusidestrconsts.drsstoreconverterconfiginses
msgid "Store converter config in session"
msgstr "Stocker la configuration du convertisseur"

#: lazarusidestrconsts.drsstoredispformatconfiginses
msgid "Store display formats config in session"
msgstr "Enregistrer la configuration des formats d'affichage dans la session"

#: lazarusidestrconsts.drsstoreformatterconfiginses
msgid "Store formatter config in session"
msgstr "Enregistrer la configuration du formateur dans la session"

#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
msgid "Store project debugger configs in session"
msgstr "Enregistrer la configuration du débogueur de projet dans la session"

#: lazarusidestrconsts.drsthedebuggerbackendselecti
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
msgstr "La sélection \"Backend du débogueur\" dans la liste déroulante (liste des backends du débogueur de l'EDI) est toujours stockée dans la session. Les backends spécifiques au projet (ci-dessous) sont stockés par défaut dans le LPI."

#: lazarusidestrconsts.drsthisonlyaffectsdispformats
msgid "This only affects the display formats below. The settings which formats to use are always stored in the session."
msgstr "Cela n'affecte que les formats d'affichage ci-dessous. Les paramètres relatifs aux formats à utiliser sont toujours enregistrés dans la session."

#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
msgid "This only affects the list of converters below. The settings which list to use are always stored in the session."
msgstr "Cela n'affecte que la liste des convertisseurs ci-dessous. Les paramètres de la liste à utiliser sont toujours stockés dans la session."

#: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter
msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session."
msgstr "Cela n'affecte que la liste des formateurs ci-dessous. Les paramètres relatifs à la liste à utiliser sont toujours stockés dans la session."

#: lazarusidestrconsts.drsuseideglobaldispformats
msgid "Use the IDEs-global display formats"
msgstr "Utiliser les formats d'affichage globaux de l'EDI"

#: lazarusidestrconsts.drsuseprojecfdispformats
msgid "Use the projects display formats"
msgstr "Utiliser les formats d'affichage des projets"

#: lazarusidestrconsts.drsusetheidegloballistofconv
msgid "Use the IDE-Global list of converters"
msgstr "Utiliser la liste des convertisseurs de l'EDI"

#: lazarusidestrconsts.drsusetheidegloballistofformatter
msgid "Use the IDE-Global list of formatters"
msgstr "Utiliser la liste globale des formateurs de l'EDI"

#: lazarusidestrconsts.drsusetheprojectlistofconver
msgid "Use the project list of converters"
msgstr "Utiliser la liste des convertisseurs du projet"

#: lazarusidestrconsts.drsusetheprojectlistofformatter
msgid "Use the project list of formatters"
msgstr "Utiliser la liste des formateurs du projet"

#: lazarusidestrconsts.drsusingidedefaultdebuggerse
msgid "Using IDE default debugger settings"
msgstr "Utilisation des paramètres par défaut du débogueur de l'EDI"

#: lazarusidestrconsts.drsusingselectedidedebuggers
msgid "Using selected IDE debugger settings"
msgstr "Utilisation des paramètres sélectionnés du débogueur de l'EDI"

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Les composants sélectionnés doivent être sur une même fiche."

#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Aligner..."

#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Effacer la sélection"

#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Miroir horizontal"

#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Miroir vertical"

#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "Un vers l'arrière"

#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "Un vers l'avant"

#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Déplacer vers l'arrière"

#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Déplacer vers l'avant"

#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Réinitialiser..."

#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Enregistrer la fiche en tant que XML"

#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Échelle..."

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Ajuster"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Tout sélectionner"

#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Taille..."

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Taille"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Option : aligner sur la grille"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Option : aligner sur les lignes directrices"

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Ordre Z"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Des deux côtés"

#: lazarusidestrconsts.initdlgdebugchangepath
msgid "Change path"
msgstr "Changer de chemin"

#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
msgid "Error: The backend is not configured."
msgstr "Erreur : le backend n'est pas configuré."

#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
msgid "(The configured backend's package is not installed.)"
msgstr "(Le paquet du backend configuré n'est pas installé.)"

#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
msgstr "Erreur : votre configuration actuelle utilise un backend qui n'est pas pris en charge par votre système d'exploitation/architecture."

#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
msgid "Hint: The backend type is OK, but not the recommended type."
msgstr "Remarque : le type de backend est correct, mais pas le type recommandé."

#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
msgid "Create a new recommended backend"
msgstr "Créer un nouveau backend recommandé"

#: lazarusidestrconsts.initdlgdebugcurrent
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
msgid "Current"
msgstr "En cours"

#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
msgid "The selected backend uses the external executable:"
msgstr "Le backend sélectionné utilise l'exécutable externe :"

#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
#, object-pascal-format
msgid "The selected backend requires an external executable: \"%s\""
msgstr "Le backend sélectionné nécessite un exécutable externe : \"%s\""

#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
#, object-pascal-format
msgid "Default for your OS/Arch is: \"%s\"."
msgstr "La valeur par défaut de votre système d'exploitation/architecture est : \"%s\"."

#: lazarusidestrconsts.initdlgdebugignore
msgctxt "lazarusidestrconsts.initdlgdebugignore"
msgid "Ignore"
msgstr "Ignorer"

#: lazarusidestrconsts.initdlgdebugkeepbackend
msgid "Keep backend"
msgstr "Garder le backend"

#: lazarusidestrconsts.initdlgdebugnew
msgctxt "lazarusidestrconsts.initdlgdebugnew"
msgid "New"
msgstr "Nouveau"

#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
msgid "Error: External executable is a directory, not a file."
msgstr "Erreur : l'exécutable externe est un répertoire, pas un fichier."

#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
msgid "Error: External executable not found."
msgstr "Erreur : exécutable externe introuvable."

#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
msgid "Error: External file is not executable."
msgstr "Erreur : le fichier externe n'est pas exécutable."

#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
msgid "Error: No default for external executable found."
msgstr "Erreur : aucune valeur par défaut pour l'exécutable externe n'a été trouvée."

#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
msgid "Error: No external executable specified."
msgstr "Erreur : aucun exécutable externe spécifié."

#: lazarusidestrconsts.initdlgdebugpopupinformation
#, object-pascal-format
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
msgstr "Un backend fournit des implémentations spécifiques au système d'exploitation et à l'architecture pour le débogueur.%0:sLa valeur par défaut pour votre système d'exploitation/architecture est : \"%1:s\".%0:s%0:sD'autres backends sont fournis pour des tâches spéciales (par exemple le débogage croisé sur certaines plateformes) ou comme alternatives génériques.%0:sLe débogueur peut avoir différentes fonctionnalités, selon le backend.%0:s%0:sCertains backends nécessitent un exe externe (tel que gdb ou lldb). Cet exe peut faire partie de votre système d'exploitation (Linux/Mac) ou être fourni par l'installateur de Lazarus (Windows).%0:s%0:sSi vous venez de mettre à jour votre installation, il se peut que vous deviez reconstruire l'EDI avant que votre backend précédemment configuré puisse être utilisé (si vous avez utilisé un backend tiers ou optionnel). Dans ce cas, vous pouvez choisir \"Ignorer\"."

#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
msgid "Select an existing backend"
msgstr "Sélectionner un backend existant"

#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr "Note : Il existe d'autres configurations de backend disponibles, mais leurs paquets (LPK) ne sont pas installés. Vous pouvez vouloir reconstruire l'EDI avec les paquets installés. Après la reconstruction, le backend du débogueur peut être changé dans le menu : Outils -> Options."

#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
#, object-pascal-format
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr "Si vous décidez de reconstruire l'EDI d'abord et d'installer les paquets manquants, sélectionnez \"Ignorer\" pour l'instant.%0:sAprès la reconstruction, le backend du débogueur peut être modifié dans le menu : Outils -> Options."

#: lazarusidestrconsts.initdlgdebugstatemissingpackages
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
msgstr "Il se peut que des paquets (LPK) manquent dans l'installation de votre EDI. Il se peut que vous deviez reconstruire l'EDI et les installer avant d'apporter des modifications à l'installation."

#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
msgstr "Il existe un backend du type recommandé dans la liste des débogueurs existants. Vous pouvez le choisir au lieu de créer un nouveau backend."

#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
msgstr "Il n'y a pas de backend de type recommandé dans la liste des débogueurs existants. Envisagez de créer un nouveau backend."

#: lazarusidestrconsts.initdlgdebugstatesetupok
msgid "Setup is OK."
msgstr "La configuration est correcte."

#: lazarusidestrconsts.initdlgdebugstateupdatebackend
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
msgstr "Vous utilisez un ancien backend. Il se peut que vous n'ayez pas la meilleure expérience de débogage possible. Envisagez une mise à jour vers le backend recommandé."

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = non - 1 = dessine les lignes de séparation pour le niveau supérieur seulement - 2 = pour les deux premiers niveaux..."

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Ajouter des fichiers"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Type d'ancêtre équivoque"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nom de classe équivoque"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nom d'unité équivoque"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor type"
msgstr "Type d'ancêtre"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Dépendances brisées"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Le nom de classe existe déjà"

#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Créer le nouveau composant"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Dépendance"

#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr "Répertoire pour le fichier de l'unité :"

#: lazarusidestrconsts.lisa2pexistingfile2
#, object-pascal-format
msgid "Existing file: \"%s\""
msgstr "Fichier existant : \"%s\""

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Fichier déjà existant"

#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
#, object-pascal-format
msgid "File \"%s\" already exists in the package."
msgstr "Le fichier \"%s\" existe déjà dans le paquet."

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Fichier en cours d'utilisation"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename/URL"
msgstr "Nom de fichier/URL"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Le fichier n'est pas une unité"

#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr "Icon 24x24 :"

#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr "Icon 36x36 :"

#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr "Icon 48x48 :"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Type d'ancêtre incorrect"

#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Dépendance circulaire non autorisée"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Nom de classe incorrect"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Fichier incorrect"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Nom de fichier incorrect"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Nom d'unité incorrect"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, object-pascal-format
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" n'est pas un nom d'unité correct."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Nouveau nom de classe :"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Nouveau fichier"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, object-pascal-format
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Pas de paquet trouvé pour la dépendance \"%s\".%sVeuillez choisir un paquet existant."

#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr "Paquet/Projet"

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Nom de page trop long"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette page:"
msgstr "Page de palette :"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Raccourcir ou développer le nom de fichier"

#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Tout afficher"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, object-pascal-format
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Le type ancêtre \"%s\" a le même nom que%sl'unité \"%s\"."

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, object-pascal-format
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Le type ancêtre \"%s\" n'est pas un identificateur Pascal correct."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, object-pascal-format
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "Le nom de classe \"%s\" et le type ancêtre \"%s\" sont identiques."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, object-pascal-format
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "Le nom de classe \"%s\" existe déjà dans%sPaquet %s%sFichier : \"%s\""

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, object-pascal-format
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Le nom de classe \"%s\" est identique au nom de%sl'unité \"%s\"."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, object-pascal-format
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "Le nom de classe \"%s\" n'est pas un identificateur Pascal correct."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, object-pascal-format
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Le fichier \"%s\" fait partie du projet en cours.%sC'est une mauvaise idée de partager des fichiers entre projets et paquets."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, object-pascal-format
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Le nom de fichier \"%s\" est équivoque parce que le paquet n'a encore aucun répertoire par défaut.%sVeuillez indiquer un nom de fichier avec le chemin complet."

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La version maximale est inférieure à la version minimale."

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, object-pascal-format
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Le paquet a déjà une dépendance au paquet \"%s\"."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, object-pascal-format
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "Le nom de page \"%s\" est trop long (maximum 100 caractères)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "Le nom d'unité \"%s\" existe déjà dans le paquet :%s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in this package."
msgstr "Le nom d'unité \"%s\" existe déjà dans ce paquet."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, object-pascal-format
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "Le nom d'unité \"%s\"%set le nom de fichier \"%s\" diffèrent."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, object-pascal-format
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Le nom de l'unité \"%s\" est le même qu'un composant installé.%sUtiliser ce nom peut causer d'étranges messages d'erreurs."

#: lazarusidestrconsts.lisa2punitname
msgid "Unit name:"
msgstr "Nom d'unité :"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Nom d'unité déjà existant"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Voulez-vous annuler les changements ?"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Arrêter tous les chargements"

#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Arrêté"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Abandonner le chargement du projet"

#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "À propos"

#: lazarusidestrconsts.lisabout2
#, object-pascal-format
msgid "About %s"
msgstr "À propos de %s"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Documentation :"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "À propos de l'EDI"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "À propos de Lazarus"

#: lazarusidestrconsts.lisaboutlazarusmsg
#, object-pascal-format
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
msgstr "Licence : GPL/LGPL. Voir les sources Lazarus et Free Pascal pour les détails de la licence.%sLazarus est un Environnement de Développement Intégré (EDI) qui permet de créer des applications graphiques ou en mode console avec Free Pascal. Ce dernier est un compilateur Pascal et Pascal Objet fonctionnant sous Windows, Linux, macOS X, FreeBSD....%sLazarus est le chaînon manquant pour le développement d'applications multiplateformes dans un environnement proche de celui de Delphi. À l'image de Delphi, cet EDI est un outil de Développement Rapide d'Applications (ou \"RAD\" en anglais) doté d'un concepteur de fiches.%sComme le projet Lazarus est en pleine expansion, les nouveaux développeurs sont les bienvenus."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "La liste des contributeurs est introuvable."

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Site officiel :"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, object-pascal-format
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "Un %s ne peut contenir de TControls.%sVous pouvez seulement y placer des composants non visuels."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Remerciements"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Action :"

#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Activer"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Activer la syntaxe d'expression régulière pour le texte et les remplacements (assez semblable à PERL)"

#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Activer le sélectionné"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Actif"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Filtre actif"

#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr "Ajouter un nouveau séparateur au-dessus de l'élément choisi"

#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr "Ajouter un nouveau séparateur au-dessous de l'élément choisi"

#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Ajouter les définitions pour simuler Delphi7"

#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Utile lorsque le code effectue des vérifications pour les versions supportées du compilateur"

#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
#, object-pascal-format
msgid "Added missing object \"%s\" to pascal source."
msgstr "Objet manquant \"%s\" ajouté au code source Pascal."

#: lazarusidestrconsts.lisaddedpropertysfors
#, object-pascal-format
msgid "Added property \"%s\" for %s."
msgstr "Propriété \"%s\" ajoutée pour %s."

#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr "Ajouter -FcUTF8"

#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr "Peut être nécessaire si les fichiers source contiennent des littéraux non Ansi."

#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Ajouter un filtre..."

#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr "L'ajout n'est pas adapté au message en cours"

#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr "L'ajout est adapté au message en cours"

#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr "Ajouts"

#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "Ajouter le mot-clé \"do\""

#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr "Ajouter le modificateur \"overload\""

#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr "Ajouter le modificateur \"override\""

#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr "Ajouter le modificateur \"reintroduce\""

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
#, object-pascal-format
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Ajouter un nouveau mode de création en copiant les paramètres de \"%s\""

#: lazarusidestrconsts.lisaddnewdiskfiles
msgid "Add new disk files?"
msgstr "Ajouter de nouveaux fichiers sur le disque ?"

#: lazarusidestrconsts.lisaddnewfilesfromfilesystem
msgid "Add New Files from File System"
msgstr "Ajouter de nouveaux fichiers à partir du système de fichiers"

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Ajouter une nouvelle macro"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Ajouter un nouvel ensemble"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Voulez-vous ajouter l'exigence de paquet ?"

#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "Ajouter le(s) paquet(s) à la liste des paquets installés (combiner avec --build-ide pour reconstruire l'EDI)."

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Ajouter un paquet au projet"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Ajouter un paramètre entre parenthèses"

#: lazarusidestrconsts.lisaddthefollowingfiles
msgid "Add the following files:"
msgstr "Ajoutez les fichiers suivants :"

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Ajouter au chemin de recherche des fichiers inclus ?"

#: lazarusidestrconsts.lisaddtoproject
#, object-pascal-format
msgid "Add %s to project?"
msgstr "Voulez-vous ajouter %s au projet?"

#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr "A ajouter aux composants de démarrage ?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Ajouter au chemin de recherche des unités ?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Ajouter les interfaces d'unités"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Ajouter une unité (non recommandé)"

#: lazarusidestrconsts.lisaddvaluetomacro
#, object-pascal-format
msgid "Add value to macro %s"
msgstr "Ajouter une valeur à la macro %s"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Ajouter un fichier au paquet"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Paquet de destination"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Type de fichier"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Paquet incorrect"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, object-pascal-format
msgid "Invalid package ID: \"%s\""
msgstr "ID de paquet incorrect : \"%s\""

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Le paquet est en lecture seule"

#: lazarusidestrconsts.lisaf2ppackagenotfound
#, object-pascal-format
msgid "Package \"%s\" not found."
msgstr "Paquet \"%s\" non trouvé."

#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Tout afficher"

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
#, object-pascal-format
msgid "The package %s is read only."
msgstr "Le paquet %s est en lecture seule."

#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
#, object-pascal-format
msgid "A filter with the name \"%s\" already exists."
msgstr "Un filtre dont le nom est \"%s\" existe déjà."

#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Après nettoyage (nettoyer tous les fichiers ou les fichiers communs), passer à nettoyer automatiquement"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Alignement"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Tous les blocs semblent corrects."

#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Tous les mode de création>"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Toutes les options héritées"

#: lazarusidestrconsts.lisalloptions
#, object-pascal-format
msgid "All options of FPC%s (\"%s\")"
msgstr "Toutes les options de FPC%s (\"%s\")"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Autoriser la recherche de lignes multiples"

#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Tous les paramètres de cette fonction sont déjà définis à cet appel. Rien à ajouter."

#: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp
msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package."
msgstr "Tous les .pas, .pp, .p, .inc dans le chemin unit/include sont déjà dans un projet/paquet."

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, object-pascal-format
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "Toutes vos modifications concernant \"%s\"%s seront perdues et le fichier sera rouvert."

#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Alpha"

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Touche alternative"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Touche alternative (ou une séquence de deux touches)"

#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Toujours convertir en minuscules les noms de fichiers proposés par défaut"

#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "Toujours dessiner les éléments sélectionnés comme focalisés"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Toujours ignorer"

#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Une macro portant ce nom existe déjà."

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Fichier équivoque trouvé"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, object-pascal-format
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Fichier équivoque trouvé : \"%s\"%sCe fichier peut être confondu avec \"%s\"%sVoulez-vous supprimer le fichier équivoque ?"

#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ancrer le bas au bas du frère. Utilisez la propriété BorderSpacing pour définir la distance. Le BorderSpacing du frère est ignoré."

#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ancrer le bas au haut du frère. La distance conservée tient compte des propriétés BorderSpacing des deux frères."

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Éditeur d'ancre - aucun contrôle choisi"

#: lazarusidestrconsts.lisanchorenabledhint
#, object-pascal-format
msgid "Enabled = Include %s in Anchors"
msgstr "Activé = Inclure %s dans les ancres"

#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ancrer la gauche à la gauche du frère. Utilisez la propriété BorderSpacing pour définir la distance. Le BorderSpacing du frère est ignoré."

#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ancrer la gauche à la droite du frère. La distance conservée tient compte des propriétés BorderSpacing des deux frères."

#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ancrer la droite à la gauche du frère. La distance conservée tient compte des propriétés BorderSpacing des deux frères."

#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ancrer la droite à la droite du frère. Utilisez la propriété BorderSpacing pour définir la distance. Le BorderSpacing du frère est ignoré."

#: lazarusidestrconsts.lisanchorsof
#, object-pascal-format
msgid "Anchors of %s"
msgstr "Ancres de %s"

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Ancres des contrôles sélectionnés"

#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Ancrer le haut au bas du frère. La distance conservée tient compte des propriétés BorderSpacing des deux frères."

#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Ancrer le haut au haut du frère. Utilisez la propriété BorderSpacing pour définir la distance. Le BorderSpacing du frère est ignoré."

#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
#, object-pascal-format
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "Une erreur est survenue durant le démarrage précédent pendant le chargement de \"%s\" !%sVoulez-vous charger ce projet à nouveau ?"

#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr "Apparence"

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "Nom de classe de l'&Application"

#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Une application graphique Free Pascal utilisant la bibliothèque LCL multiplateforme comme interface graphique."

#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Appliquer"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "Apply build flags (-B) to dependencies too."
msgstr "Appliquer aussi les indicateurs de création (-B) aux dépendances."

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Appliquer les conventions"

#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr "Adapter l'extension de nom et la casse de caractères pour la plateforme et le type de fichier."

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Une unité du projet ne peut pas être utilisée par d'autres paquets/projets"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "L'espace de bordure autour du contrôle. Les quatre autres espaces de bordure sont ajoutés à cette valeur."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Demander avant de remplacer chaque texte trouvé"

#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Demander avant d'enregistrer une session de projet"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr "Demander le nom du composant après l'avoir déposé sur le concepteur de fiche."

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Demander le nom de fichier pour les nouveaux fichiers"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Demander le nom lors de  la création"

#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr "Ajuster automatiquement la hauteur de la fenêtre principale de l'EDI"

#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr "Montrer la totalité de la palette des composants"

#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr "Si la palette de composants s'étend sur plus de lignes, tous les montrer et non pas un seul."

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Complétion automatique inactive"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Complétion automatique active"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Balisage et correspondances"

#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automatique"

#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Automatiquement"

#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr "Convertir automatiquement les fichiers .lfm en fichiers de ressources .lrs"

#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "ne pas terminer la sélection"

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Invoquer automatiquement après le point"

#: lazarusidestrconsts.lisautomaticallyinvokeontype
msgid "Automatically invoke on typing"
msgstr "Invoquer automatiquement lors de la frappe"

#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
msgid "Only complete if word is longer or equal"
msgstr "Compléter seulement si la longueur du mot est égale ou supérieure"

#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
msgid "Only complete when at end of word"
msgstr "Compléter seulement si à la fin du mot"

#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
msgid "Use completion box delay"
msgstr "Utiliser le délai de la boîte de complétion"

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "saut de ligne"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "espace"

#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "tabulation"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "fin de mot"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "ne pas ajouter de caractère"

#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr "Utiliser automatiquement un identificateur possible unique"

#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Complétion et conseils"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Afficher automatiquement l'inspecteur d'objets"

#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Disponibles pour l'installation"

#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes"
msgstr "Modes de construction du projet disponibles"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Faire la sauvegarde des fichiers modifiés"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "La sauvegarde du fichier a échoué"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Crée un répertoire de sauvegarde sous le répertoire du projet"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
#, object-pascal-format
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Le changement du nom ou de la version d'un paquet brise les dépendances. Est-ce que ces dépendances doivent être changées aussi ?%sChoisissez \"Oui\" pour modifier toutes les dépendances listées. %sChoisissez \"Ignorer\" pour briser les dépendances et continuer."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "commence"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Derrière les apparentés"

#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "Be less verbose. Can be given multiple times."
msgstr "Moins verbeux ; peut être indiqué plusieurs fois."

#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "Be more verbose. Can be given multiple times."
msgstr "Plus verbeux ; peut être indiqué plusieurs fois."

#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "Meilleur affichage en installant un contrôleur HTML comme turbopoweriprodsgn"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Toujours lancer la création avant l'exécution"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Commande de création"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "À la création du projet, lancer la commande de création de fichier à la place"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "À l'exécution du projet, lancer la commande d'exécution du fichier à la place"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Exécuter une commande"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Quand ce fichier est en cours d'utilisation dans l'éditeur de source"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Répertoire de travail (laisser vide pour le chemin de fichier)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Valeurs modifiées en gras"

#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Espace de bordure"

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Bas"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "L'espace inférieur de bordure. Cette valeur est ajoutée à l'espace de bas de bordure et employée pour l'espace au-dessous de la commande."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Ancrage au bas de page"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Bas"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Il s'agit du contrôle frère auquel le côté inférieur est ancré. Le laisser vide pour l'ancrer au parent comme le ferait Delphi (\"BorderSpacing\" et \"ReferenceSide\" n'importent pas)."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Espacement égal en bas"

#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr "Chercher et choisir un compilateur (ex. ppcx64"

#: lazarusidestrconsts.lisbtnapply
msgid "&Apply"
msgstr "&Appliquer"

#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Fermer"

#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Remplacer..."

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Rechercher"

#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "&Quitter"

#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Retirer"

#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr "&Renommer"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Remplacer"

#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Créer"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "Build all files of project/package/IDE."
msgstr "Créer tous les fichiers du projet/paquet/EDI."

#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Création"

#: lazarusidestrconsts.lisbuilddate
msgid "Build Date"
msgstr "Date de construction"

#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "Création de l'EDI"

#: lazarusidestrconsts.lisbuildidewithpackages
msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option."
msgstr "Créez un EDI avec des paquets. Les options facultatives du compilateur seront transmises après les options du mode de construction utilisé et peuvent être spécifiées ici ou avec l'option --opt."

#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr "Création"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "La création de Lazarus a échoué"

#: lazarusidestrconsts.lisbuildmode
#, object-pascal-format
msgid "Build Mode: %s"
msgstr "Mode de construction : %s"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Différences entre les modes de création"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Différences avec d'autres modes de création"

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Mode :"

#: lazarusidestrconsts.lisbuildmodes
msgid "Build mode"
msgstr "Mode de création"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Créer un nouveau projet"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Construction"

#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Création"

#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Occupé"

#: lazarusidestrconsts.lisbyte
#, object-pascal-format
msgid "%s byte"
msgstr "%s octet"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Annuler le chargement de ce composant"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Abandonner le chargement d'unité"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Abandonner le renommage"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Impossible de compiler le projet"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Impossible de copier le composant de niveau supérieur."

#: lazarusidestrconsts.liscannotcreatefile
#, object-pascal-format
msgid "Cannot create file \"%s\""
msgstr "Impossible de créer le fichier \"%s\""

#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr "Impossible de supprimer le dernier mode."

#: lazarusidestrconsts.liscannotexecute
#, object-pascal-format
msgid "cannot execute \"%s\""
msgstr "impossible d'exécuter \"%s\""

#: lazarusidestrconsts.liscannotfind
#, object-pascal-format
msgid "Cannot find %s"
msgstr "Impossible de trouver %s"

#: lazarusidestrconsts.liscannotfindexecutable
#, object-pascal-format
msgid "cannot find executable \"%s\""
msgstr "impossible de trouver l'exécutable \"%s\""

#: lazarusidestrconsts.liscannotfindlazarusstarter
#, object-pascal-format
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Lanceur de Lazarus introuvable :%s%s"

#: lazarusidestrconsts.liscannotopenform
#, object-pascal-format
msgid "Cannot open form \"%s\"."
msgstr "Impossible d'ouvrir la fiche \"%s\"."

#: lazarusidestrconsts.liscannotsaveform
#, object-pascal-format
msgid "Cannot save form \"%s\"."
msgstr "Impossible de sauvegarder la fiche \"%s\"."

#: lazarusidestrconsts.liscannotsubstitutemacros
#, object-pascal-format
msgid "Cannot substitute macro \"%s\"."
msgstr "Impossible de remplacer la macro \"%s\"."

#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "Vous ne pouvez pas tester le compilateur lors du débogage ou de la compilation."

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Vous pouvez seulement changer la classe des \"TComponent\"."

#: lazarusidestrconsts.liscantfindavalidppu
#, object-pascal-format
msgid "Can't find a valid %s.ppu"
msgstr "Impossible de trouver un \"%s.ppu\" correct"

#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "Comparer les fichiers (pas pour créer des patches)"

#: lazarusidestrconsts.liscaptionofactivebuildmode
msgid "Caption of active build mode"
msgstr "Légende du mode de construction actif"

#: lazarusidestrconsts.liscbpfiles
#, object-pascal-format
msgid "%s (%s files)"
msgstr "%s (%s fichiers)"

#: lazarusidestrconsts.liscbpreallydeletesourcefiles
#, object-pascal-format
msgid "Really delete %s source files%s%s"
msgstr "Vraiment supprimer %s sources%s%s"

#: lazarusidestrconsts.lisccdchangeclassof
#, object-pascal-format
msgid "Change Class of %s"
msgstr "Changer la classe de %s"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "aucune classe"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Compilateur équivoque"

#: lazarusidestrconsts.lisccochecktestdir
#, object-pascal-format
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Veuillez vérifier le répertoire de test dans %sOutils -> Options... -> Fichiers -> Répertoire pour la création de projets de tests"

#: lazarusidestrconsts.lisccocompilernotanexe
#, object-pascal-format
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Le compilateur \"%s\" n'est pas un fichier exécutable. %s Détails : %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "contient "

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Copier la sortie vers le presse-papiers"

#: lazarusidestrconsts.lisccodatesdiffer
#, object-pascal-format
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Les dates des fichiers .ppu de FPC diffèrent de plus d'une heure. %s Cela peut signifier qu'elles proviennent de deux installations différentes. %s Fichier1 : %s%s Fichier2 : %s"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ERREUR : "

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "Le chemin des unités FPC contient un code source : "

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "symboles de retour à la ligne"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "CONSEIL : "

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Compilateur incorrect"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Chemin de recherche incorrect"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Répertoire de test incorrect"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Unité manquante"

#: lazarusidestrconsts.lisccomsgrtlunitnotfound
#, object-pascal-format
msgid "RTL unit not found: %s"
msgstr "Unité RTL %s introuvable"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "multiples configurations du compilateur trouvées : "

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "aucun fpc.cfg trouvé"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "non ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
#, object-pascal-format
msgid "ppu exists twice: %s, %s"
msgstr "ppu existe deux fois : %s, %s"

#: lazarusidestrconsts.lisccoppuolderthancompiler
#, object-pascal-format
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Il y a un fichier .ppu plus ancien que le compilateur lui-même : %s%s"

#: lazarusidestrconsts.lisccortlunitnotfounddetailed
#, object-pascal-format
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr "L'unité RTL %s est introuvable.%s Cela signifie en général que votre %s contient des chemins d'unités erronés ou que votre installation est mauvaise."

#: lazarusidestrconsts.lisccoseveralcompilers
#, object-pascal-format
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Il y a plusieurs compilateurs FreePascal dans votre chemin. %s%s%s Peut-être avez-vous oublié de supprimer un ancien compilateur ?"

#: lazarusidestrconsts.lisccoskip
msgctxt "lazarusidestrconsts.lisccoskip"
msgid "Skip"
msgstr "Ignorer"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "caractères spéciaux"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Tous les tests ont réussi."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Impossible de créer le fichier de test"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, object-pascal-format
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Impossible de créer le fichier temporaire Pascal \"%s\"."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "caractères insolites"

#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Avertissement"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ATTENTION : "

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "mauvais délimiteur de chemin"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Catégories"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Complexité"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Constantes"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Blocs vides"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Sections de classe vide"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Constructions vides"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Procédures vides"

#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(filtre)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Suivre le curseur"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Est un contrôle racine"

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "Nombre de paramètres qualifié de \"beaucoup\""

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Procédures longues"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "Nombre de lignes d'une procédure qualifiée de \"longue\""

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Nombreuses procédures imbriquées"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Nombreux paramètres"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Afficher les catégories"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Afficher les nœuds des codes sources"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "Nombre de procédures imbriquées qualifié de \"beaucoup\""

#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Centrer une fenêtre perdue"

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Centrer le contrôle horizontalement par rapport au frère indiqué. La propriété BorderSpacing est ignorée."

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Centrer le contrôle verticalement par rapport au frère indiqué. La propriété BorderSpacing est ignorée."

#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Centrer la fiche"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Centrer dans la fenêtre"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Centre"

#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Mode d'exposition préféré"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Catégorie"

#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Code source"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Jamais, seulement manuellement"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Seulement utilisé dans le mode catégorie"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Quand inoccupé"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Rafraîchir automatiquement"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Autre"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Mise à jour"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Lors du changement du fichier dans l'éditeur de source"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Procédures"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Propriétés"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Propriétés publiées sans valeur par défaut"

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Montrer les observations à propos de"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Style"

#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Entourage"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "À faire"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Types"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Constantes sans nom"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Membres non triés"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Visibilité non triée"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Variables"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Mauvaise indentation"

#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
#, object-pascal-format
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "Une exception s'est produite lors de la suppression de%s\"%s :%s\"%s%s"

#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Impossible de copier cette sélection de la fiche"

#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Impossible de couper cette sélection de la fiche"

#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Impossible d'effacer cette sélection de la fiche"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Erreur de création du composant"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
#, object-pascal-format
msgid "Error creating component: %s%s%s"
msgstr "Erreur de création du composant : %s%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Erreur de destruction du composant"

#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
#, object-pascal-format
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Erreur de destruction du composant de type %s de l'unité %s :%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Erreur lors de la destruction de l'intermédiaire"

#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
#, object-pascal-format
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Erreur lors de la destruction de l'intermédiaire %s de l'unité %s :%s%s"

#: lazarusidestrconsts.liscfeinfile
#, object-pascal-format
msgid "In file %s"
msgstr "Dans le fichier %s"

#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Composant propriétaire incorrect"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm existe déjà"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
#, object-pascal-format
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm : type inconnu %s"

#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
#, object-pascal-format
msgid "TCustomFormEditor.DeleteComponent  Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent : où est le TCustomNonFormDesignerForm ? %s"

#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
#, object-pascal-format
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator déjà enregistré : %s"

#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "L'éditeur de composant de la classe \"%s\"a généré l'erreur :%s\"%s\""

#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
#, object-pascal-format
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "Le composant de type %s n'a pas réussi à établir son propriétaire à %s:%s"

#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, object-pascal-format
msgid "Unable to clear the form editing selection%s%s"
msgstr "Impossible d'effacer la sélection d'édition de fiche %s%s"

#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Changer"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Modifier le mode  de création"

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Modifier la classe"

#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
#, object-pascal-format
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "%s coordonnées %s de \"%d\" changées en \"%d\" dans %s."

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Changer l'encodage"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Changer de fichier"

#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Changer le parent"

#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Les changements n'ont pas été enregistrés"

#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Changer pour  / (Unix)"

#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Changer pour  \\ (Windows)"

#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Tout cocher"

#: lazarusidestrconsts.lischeckcompilerpath
msgid "Please make sure that the path to the compiler in the IDE options is correct."
msgstr "Assurez-vous que le chemin d'accès au compilateur dans les options de l'EDI est correct."

#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Vérifier les modifications des fichiers sur le disque selon le contenu plutôt que par l'horodatage"

#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
#, object-pascal-format
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ". Vérifiez si le paquet %s crée le fichier %s.ppu ; vérifiez que rien ne supprime ce fichier et qu'il n'y ait pas d'autres paquets accédant au code source de l'unité."

#: lazarusidestrconsts.lischeckifpackageisinthedependencies
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ". Vérifier que le paquet %s est dans les dépendances"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "Vérifier que l'unité lexicale suivante dans le code source est \"end\" et sinon retourne \"LineEnding + end; + LineEnding\"."

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Vérifier les options"

#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ". Vérifier le chemin de recherche du paquet %s ; essayer une reconstruction propre ; vérifier la clause uses de la section implementation."

#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr "Vérifier l'élément suivant dans le code source et ajouter un point-virgule si nécessaire."

#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, object-pascal-format
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Vérifiez la cible (système d'exploitation, processeur, ensemble graphique LCL). Peut-être devrez-vous recompiler le paquet pour cette cible ou définir une autre cible pour le projet."

#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr "Tout cocher/décocher"

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Choisir un nom différent"

#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "Choisir un fichier avec des modèles d'outils de code"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Choisir un lien FPDoc"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Choisir une touche..."

#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr "Choisir un nom pour le composant"

#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Choisir un fichier d'exemple"

#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Choisir un fichier de messages FPC"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Choisir un fichier Pascal pour des exemples d'indentation"

#: lazarusidestrconsts.lischoosecompilerexecutable
#, object-pascal-format
msgid "Choose compiler executable (%s)"
msgstr "Choisir l'exécutable du compilateur (%s)"

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Choisir le fichier des messages de compilation"

#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Choisir l'exécutable du débogueur"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Choisir le paquet Delphi (*.dpk)"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Choisir le projet Delphi (*.dpr)"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Choisir l'unité Delphi (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Choisir le répertoire"

#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr "Choisir un exécutable"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Choisir le répertoire des codes sources de FPC"

#: lazarusidestrconsts.lischoosefppkgconfigurationfile
msgid "Choose the fppkg configuration file"
msgstr "Choisir le fichier de configuration fppkg"

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Choisir le répertoire de Lazarus"

#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "Choisir l'exécutable de Make"

#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr "Choisir le nom et le texte"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Choisir un de ces éléments pour créer un nouveau fichier"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Choisir un de ces éléments pour créer un nouveau paquet"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Choisir un de ces éléments pour créer un nouveau projet"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Choisir un de ces éléments pour hériter d'un élément existant"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Choisir le code source du programme (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Choisir la structure pour entourer la sélection"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Choisir le répertoire de test"

#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Une référence circulaire a été détectée"

#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr "&Classe"

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Complétion de classe"

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Les classes et les propriétés existent. Les valeurs n'ont pas été vérifiées."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, object-pascal-format
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "La classe \"%s\" n'est pas une classe de composants répertoriée. %sImpossible de coller."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Classe introuvable"

#: lazarusidestrconsts.lisclassnotfoundat
#, object-pascal-format
msgid "Class %s not found at %s(%s,%s)"
msgstr "Classe %s non trouvée en %s(%s,%s)"

#: lazarusidestrconsts.lisclassofmethodnotfound
#, object-pascal-format
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "Classe \"%s\" de la méthode \"%s\" introuvable."

#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Nettoyer"

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Nettoyer un répertoire"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Nettoyer les sous-répertoires"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Préserver tous les fichiers textes"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Préserver les fichiers correspondant au filtre"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Retirer les fichiers correspondant au filtre"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Syntaxe simplifiée (par exemple * au lieu de .*)"

#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Tout nettoyer"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Nettoyer les codes sources de Lazarus"

#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Remettre à automatique  après la construction"

#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Nettoyer"

#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Nettoyer et construire"

#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Nettoyer et construire le projet"

#: lazarusidestrconsts.liscleanuplazbuild
msgid "Clean up + lazbuild"
msgstr "Nettoyage + lazbuild"

#: lazarusidestrconsts.liscleanuppackage
#, object-pascal-format
msgid "Clean up package \"%s\"."
msgstr "Nettoyer le paquet \"%s\"."

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Voulez-vous nettoyer le chemin des unités ?"

#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Nettoyer"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Voulez-vous nettoyer le répertoire ?"

#: lazarusidestrconsts.lisclearfilter
msgid "Clear filter"
msgstr "Remettre à zéro le filtre"

#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Vider le filtre pour les options"

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Cliquez ici pour parcourir le fichier"

#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr "Cliquez pour voir les choix"

#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr "Cliquez pour choisir la page de palette"

#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Dupliquer"

#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Fermer"

#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Fermer les éditeurs cochés"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Fermer les fichiers"

#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Cacher la fenêtre"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Fermeture d'une fenêtre de l'éditeur de source. Voulez-vous fermer tous les fichiers ou masquer la fenêtre ?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Fermer la fenêtre d'édition de source"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Options spécifiques à l'interface LCL :"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Paramètre"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Composants"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Héritage"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Liste"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Palette"

#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Pages"

#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr "La palette est &visible"

#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "&Valeurs par défaut"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Fichier litigieux de configuration additionnel du compilateur"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Appel sur :"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, object-pascal-format
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sCliquez sur OK si vous êtes sûr de ce que vous faites."

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Commande :"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Code"

#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Navigateur de code"

#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr "Options de création de code"

#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr "Section de classe"

#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Emplacement"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Options de génération de code"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Ajouter le chemin"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Parcourir"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Confirmer le remplacement"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Créer un élément d'aide"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Supprimer le chemin"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Description"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Erreurs"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Exemple"

#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "Paramètres FPDoc"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Insérer une balise de formatage gras"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Insérer une balise de formatage code"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Insérer une balise de formatage italique"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Insérer une balise de formatage remarque"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Insérer une balise de formatage souligner"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Insérer une balise de formatage variable"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Hérité"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Insérer un lien..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Insérer une balise de formatage paragraphe"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Éditeur FPDoc"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(pas de description héritée trouvée)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<AUCUN>"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Voir aussi"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Courte description de"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Court"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Ignorer les constantes dans les fonctions suivantes"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Recherche des constantes de type caractère sans nom"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Observateur de code"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "Ignorer les prochaines constantes sans nom"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Ajouter un modèle"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Ajouter un modèle de code"

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Complétion automatique active"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Commentaire :"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Éditer les modèles de code"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Erreur"

#: lazarusidestrconsts.liscodetemplerroralreadyexists
msgid "A token already exists."
msgstr "Une unité lexicale existe déjà."

#: lazarusidestrconsts.liscodetemplerroremptyname
msgid "The token cannot be empty."
msgstr "L'unité lexicale ne peut être vide."

#: lazarusidestrconsts.liscodetemplerrorinvalidname
msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number."
msgstr "L'unité lexicale ne peut contenir que des lettres latines, des chiffres et des traits de soulignement, et ne peut pas commencer par un chiffre."

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Unité lexicale :"

#: lazarusidestrconsts.liscodetoolsdefsaction
#, object-pascal-format
msgid "Action: %s"
msgstr "Action : %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, object-pascal-format
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Les nœuds créés automatiquement ne peuvent être modifiés,%set ne peuvent pas avoir de sous-nœuds non automatiques."

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, object-pascal-format
msgid "%s, auto generated"
msgstr "%s, généré automatiquement"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "Les nœuds générés automatiquement ne peuvent pas être édités."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Bloc"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Éditeur des définitions des outils de code"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Chemin du compilateur"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Convertir un nœud"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, object-pascal-format
msgid "Create Defines for %s Directory"
msgstr "Créer les définitions pour le répertoire %s"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Créer les définitions pour le compilateur Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal Git Sources"
msgstr "Créer les définitions pour les sources GIT de Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, object-pascal-format
msgid "Create Defines for %s Project"
msgstr "Créer les définitions pour le projet %s"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Créer les macros et chemins FPC pour un répertoire projet FPC"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Définir"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Définir de manière récursive"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Supprimer le nœud"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Le répertoire principal %s %soù Borland a installé tous les codes sources %s.%sPar exemple : C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Le répertoire principal %s, %soù Borland a installé tous les codes sources %s %squi sont utilisés dans ce projet %s.%sPar exemple : C:/Programme/Borland/Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Description :"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
#, object-pascal-format
msgid "%s directory"
msgstr "répertoire %s"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC Git source directory"
msgstr "Répertoire des sources GIT de FPC"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Répertoire"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Insérer un modèle de compilateur Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Insérer un modèle de répertoire Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Insérer un modèle de projet Delphi 5"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Insérer un modèle de compilateur Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Insérer un modèle de répertoire Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Insérer un modèle de projet Delphi 6"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Insérer un modèle de compilateur Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Insérer un modèle de répertoire Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Insérer un modèle de projet Delphi 7"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Insérer un modèle de compilateur Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Insérer un modèle de projet Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal Git Source Template"
msgstr "Insérer le modèle de source GIT de Free Pascal"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Insérer un modèle de compilateur Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Insérer un modèle de répertoire Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Insérer un modèle de projet Kylix 3"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Insérer un nœud enfant"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Insérer un nœud au-dessous"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Insérer un modèle"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Parent incorrect"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Nœud parent incorrect"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Nœud précédent incorrect"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Le répertoire principal %s %soù Borland a installé tous les codes sources %s.%sPar exemple : /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Le répertoire principal %s, %soù Borland a installé tous les codes sources %s, %squi sont utilisés dans ce projet %s.%sPar exemple : /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Déplacer le nœud vers le bas"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Déplacer le nœud d'un niveau vers le bas"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Déplacer le nœud d'un niveau vers le haut"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Déplacer le nœud vers le haut"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Nom :"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Nouveau nœud"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Nœud en lecture seule"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "aucun sélectionné"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "Le nœud parent ne peut contenir de nœuds d'enfants."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Le nœud précédent ne peut contenir de nœuds enfants."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Répertoire du projet"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, object-pascal-format
msgid "%s project directory"
msgstr "%s répertoire du projet"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Nœud sélectionné :"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
msgstr "Le répertoire des sources de Free Pascal GIT. Non requis. Cela améliorera la recherche des déclarations et le débogage."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Le répertoire du projet Free Pascal."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal Git source directory."
msgstr "Le répertoire des sources de GIT Free Pascal."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, object-pascal-format
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Le chemin du compilateur Free Pascal.%s Par exemple %s/usr/bin/%s -n%s ou %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
msgstr "Le chemin du compilateur de Free Pascal pour ce projet. Seulement requis si vous placez les codes sources de FPC GIT ci-dessous. Utilisé pour la création automatique des macros."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
#, object-pascal-format
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "Le chemin vers le compilateur Free Pascal pour ce code source.%sUtilisé pour la création automatique des macros."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
#, object-pascal-format
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Le répertoire projet %s,%squi contient les fichiers .dpr et .dpk."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Supprimer la définition"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Supprimer toutes les définitions"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Supprimer les définitions récursives"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Valeur en termes de chemins de fichiers"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Valeur en texte"

#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
#, object-pascal-format
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%svaleur \"%s\" est incorrecte."

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Variable :"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Arobase"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Parenthèse"

#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr "Circonflexe (^)"

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Deux-points"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Virgule"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Identificateur"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Mot-clé"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Nouvelle ligne"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Aucun"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Nombre"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Point"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Point-virgule"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Espace"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Constante chaîne"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Symbole"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Exécuter après"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Exécuter avant"

#: lazarusidestrconsts.liscollapse
msgid "Collapse"
msgstr "Replier"

#: lazarusidestrconsts.liscollapseall
msgid "Collapse All [Ctrl+Minus]"
msgstr "Tout replier (Ctrl+Moins)"

#: lazarusidestrconsts.liscollapseall2
msgid "Collapse All"
msgstr "Tour replier"

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Replier toutes les classes"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Replier tous les paquets"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Replier toutes les unités"

#: lazarusidestrconsts.liscomboboxes
msgid "Combo Boxes"
msgstr "Boîtes Combo"

#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Paramètres de ligne de commande"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Paramètres d'exécution du programme"

#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Compiler"

#: lazarusidestrconsts.liscompileanddonotaskagain
msgid "Compile and do not ask again"
msgstr "Compiler et ne plus demander"

#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr "Compiler les modes suivants"

#: lazarusidestrconsts.liscompilenormally
msgid "Compile normally"
msgstr "Compiler normalement"

#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Compilation du projet"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Compilateur"

#: lazarusidestrconsts.liscompilercfgismissing
#, object-pascal-format
msgid "%s is missing."
msgstr "%s est manquant."

#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
#, object-pascal-format
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Le compilateur \"%s\" ne supporte pas la cible %s-%s"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
#, object-pascal-format
msgid "Error: invalid compiler: %s"
msgstr "Erreur : compilateur incorrect : %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Nom de fichier du compilateur"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Conseil : vous pouvez définir le chemin du compilateur dans Outils->Options->Fichiers->Chemin du compilateur"

#: lazarusidestrconsts.liscompilermessagesfilenotfound
#, object-pascal-format
msgid "Compiler messages file not found:%s%s"
msgstr "Fichier des message du compilateur non trouvé :%s%s"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "NOTE : fichier de configuration des outils de code non trouvé. Valeurs par défaut utilisées"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "NOTE : chargement de l'ancien fichier d'options des outils de code : "

#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Compiler"

#: lazarusidestrconsts.liscompilewithprojectsettings
msgid "Compile with project settings"
msgstr "Compiler avec les paramètres du projet"

#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "Compiler avec -vd pour plus de détails. Attention aux duplications."

#: lazarusidestrconsts.liscompiling
#, object-pascal-format
msgid "%s (compiling ...)"
msgstr "%s (compilation...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Voir les conseils sur de longues lignes"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Étendre au loin à gauche"

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Étendre quelque peu à gauche"

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Jamais"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Étendre à droite seulement"

#: lazarusidestrconsts.liscomponentnameiskeyword
#, object-pascal-format
msgid "Component name \"%s\" is keyword"
msgstr "Le nom du composant \"%s\" est un mot-clé"

#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Tout afficher"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Ouvrir le paquet"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Ouvrir l'unité"

#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr "Compresser"

#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr "Le répertoire résultant sera compressé dans un fichier ZIP."

#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Test"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Condition"

#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Expressions conditionnelles"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Répertoire de configuration de Lazarus"

#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr "Fichier de configuration des ajouts :"

#: lazarusidestrconsts.lisconfigurebuild
#, object-pascal-format
msgid "Configure Build %s"
msgstr "Configurer la création %s"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Configurer la \"construction de Lazarus\""

#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr "Configurer la barre d'outils"

#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Configurer l'EDI de Lazarus"

#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Confirmer"

#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Confirmation"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
#, object-pascal-format
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus sera recréé avec les profils suivants :%sVoulez-vous continuer ?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Confirmer les changements"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Confirmer l'effacement"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, object-pascal-format
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Voulez-vous recréer Lazarus avec le profil : %s ?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Confirmer le nouvel ensemble de paquets pour l'EDI"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Action"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Nouveau jeu de paquet"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Ancien jeu de paquet"

#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Conflit"

#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Conflit détecté"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Application console"

#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Un programme Free Pascal en ligne de commande utilisant \"TCustomApplication\" pour vérifier facilement les options de ligne de commande, la gestion des exceptions, etc."

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Code constructeur"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "contient"

#: lazarusidestrconsts.liscontents
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Contenu"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Sensible au contexte"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Continuer et ne plus demander"

#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr "Continuer la construction"

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Continuer sans charger la fiche"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Contributeurs"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Le contrôle nécessite un parent"

#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Ajouter un commentaire après le remplacement"

#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr "Modificateur de syntaxe MODE Delphi ajouté après le nom de l'unité."

#: lazarusidestrconsts.lisconvaddingflagforregister
#, object-pascal-format
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr "Ajout d'un drapeau de procédure \"Register\" dans l'unité %s."

#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
#, object-pascal-format
msgid "\")\" is missing from replacement function: %s"
msgstr "\")\" manque dans la fonction de remplacement : %s"

#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr "Parenthèse introuvable"

#: lazarusidestrconsts.lisconvconvertedfrom
#, object-pascal-format
msgid " { *Converted from %s* }"
msgstr " { *Converti depuis %s* }"

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Un décalage est ajouté à la coordonnée \"Top\" des contrôles à l'intérieur des conteneurs visuels"

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Décalages des coordonnées"

#: lazarusidestrconsts.lisconvdeletedfile
#, object-pascal-format
msgid "Deleted file %s"
msgstr "Fichier %s supprimé"

#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
#, object-pascal-format
msgid "Added defines %s in custom options"
msgstr "Définitions %s ajoutées dans les options personnalisées"

#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
#, object-pascal-format
msgid "Added Package %s as a dependency."
msgstr "Paquet %s ajouté en tant que dépendance."

#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
#, object-pascal-format
msgid "Added unit \"%s\" to uses section."
msgstr "Unité \"%s\" ajoutée à la clause uses."

#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Tous les sous-répertoires seront examinés pour les fichiers d'unités"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "Échec de BeginCodeTools !"

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Catégories :"

#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
#, object-pascal-format
msgid "Changed encoding from %s to UTF-8"
msgstr "Codage modifié de %s en UTF-8"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Conversion abandonnée."

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Conversion prête."

#: lazarusidestrconsts.lisconvdelphiconversiontook
#, object-pascal-format
msgid "Conversion took: %s"
msgstr "La conversion a pris : %s"

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Convertir un paquet Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Convertir un projet Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Convertir une unité Delphi"

#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Conversion des fichiers d'unités trouvés lors de la conversion ***"

#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** Conversion des fichiers unités appartenant au projet/paquet **"

#: lazarusidestrconsts.lisconvdelphierror
#, object-pascal-format
msgid "Error=\"%s\""
msgstr "Erreur = \"%s\""

#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "Une exception s'est produite lors de la conversion de l'unité. Poursuite avec les fichiers fiches des unités déjà converties..."

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Échec de la conversion d'une unité"

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
#, object-pascal-format
msgid "Failed to convert unit \"%s\""
msgstr "Échec de conversion de l'unité \"%s\""

#: lazarusidestrconsts.lisconvdelphifixedunitcase
#, object-pascal-format
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Ajustement de la casse des caractères de l'unité \"%s\" en \"%s\"."

#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Tous les fichiers d'unités ont été trouvés"

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Fonction Delphi"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
#, object-pascal-format
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) fichier d'inclusion manquant"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Nom Delphi"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Le nom du paquet existe"

#: lazarusidestrconsts.lisconvdelphipackagerequired
#, object-pascal-format
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "Le paquet %s est nécessaire, mais pas installé dans Lazarus ! Installez-le plus tard."

#: lazarusidestrconsts.lisconvdelphiprojomittedunit
#, object-pascal-format
msgid "Omitted unit %s from project"
msgstr "Omission de l'unité %s du projet"

#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
#, object-pascal-format
msgid "Removed unit \"%s\" from uses section."
msgstr "Unité \"%s\" retirée de la section uses."

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Ajustement des unités utilisées et réparation des fichiers des fiches ***"

#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Unité \"%s\" remplacée par \"%s\" dans la section uses."

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
#, object-pascal-format
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Il existe déjà un paquet portant le nom \"%s\"%sVeuillez tout d'abord fermer ce paquet."

#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "Le nom d'unité existe dans LCL"

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
#, object-pascal-format
msgid "Units to replace in %s"
msgstr "Unités à remplacer dans %s"

#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
#, object-pascal-format
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "LCL comporte déjà une unité portant le nom %s. Voulez-vous supprimer fichier local %s ?"

#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr "Les fichiers .dproj ne sont pas encore pris en charge. Ces fichiers sont utilisés par Delphi 2007 et les versions suivantes. Veuillez choisir un fichier .dpr pour les projets ou un fichier .dpk pour les paquets."

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Erreur de conversion"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Convertir"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Convertir l'encodage"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Convertir le codage de projets/paquets"

#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr "Autres options affectant la conversion"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Convertir le projet ou le paquet"

#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Cible"

#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Multiplateforme"

#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Multiplateforme ou seulement Windows"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Le convertisseur complète la compilation conditionnelle pour atteindre différentes cibles"

#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Utiliser le même fichier de fiche DFM"

#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Même fichier DFM pour Lazarus et Delphi, au lieu de le copier dans un LFM"

#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Support de Delphi"

#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Utiliser la compilation conditionnelle pour supporter Delphi"

#: lazarusidestrconsts.lisconvfixedunitname
#, object-pascal-format
msgid "Fixed unit name from %s to %s."
msgstr "Nom du fichier corrigé de %s en %s."

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Remplacements de fonction"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Quelques fonctions Delphi peuvent être remplacées par des fonctions LCL"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Fonctions/procédures à remplacer"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Décalage gauche"

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Nouveau Nom"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Conteneur parent"

#: lazarusidestrconsts.lisconvproblemsfindingallunits
#, object-pascal-format
msgid "Problems when trying to find all units from project file %s"
msgstr "Problèmes rencontrés lors de la recherche de toutes les unités du fichier de projet %s"

#: lazarusidestrconsts.lisconvproblemsfixingincludefile
#, object-pascal-format
msgid "Problems when fixing include files in file %s"
msgstr "Problèmes rencontrés lors de la correction des fichiers d'inclusion du fichier %s"

#: lazarusidestrconsts.lisconvproblemsrepairingformfile
#, object-pascal-format
msgid "Problems when repairing form file %s"
msgstr "Problèmes rencontrés lors de la réparation du fichier de la fiche %s"

#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr "Réparation des fichiers d'inclusion : "

#: lazarusidestrconsts.lisconvreplacedcall
#, object-pascal-format
msgid "Replaced call %s with %s"
msgstr "Appel %s remplacé par %s"

#: lazarusidestrconsts.lisconvreplfuncparameternum
#, object-pascal-format
msgid "Replacement function parameter number should be >= 1: %s"
msgstr "Le nombre de paramètres de la fonction de remplacement devrait être >= 1 : %s"

#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
#, object-pascal-format
msgid "\"$\" should be followed by a number: %s"
msgstr "\"$\" devrait être suivi d'un nombre : %s"

#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr "Arrêt parce qu'un paquet portant le même nom existe déjà"

#: lazarusidestrconsts.lisconvthislogwassaved
#, object-pascal-format
msgid "This log was saved to %s"
msgstr "Ce journal a été enregistré dans %s"

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Décalage haut"

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Remplacements de type"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Types inconnus dans le fichier fiche (DFM/LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Types à remplacer"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Remplacements d'unité"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Les noms des unités dans la section uses d'une unité de code source"

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Unités à remplacer"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Propriétés inconnues"

#: lazarusidestrconsts.lisconvuserselectedtoendconversion
#, object-pascal-format
msgid "User selected to end conversion with file %s"
msgstr "Utilisateur choisi pour terminer la conversion avec le fichier %s"

#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr "Ajouter/configurer/supprimer une/des barre(s) d'outils"

#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr "Ajouter un diviseur"

#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr "Ajouter l'élément sélectionné à la barre d'outils"

#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr "Commandes disponibles"

#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr "Style de bordure des barres d'outils"

#: lazarusidestrconsts.liscoolbarborderstyleitem0
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Aucun"

#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Simple"

#: lazarusidestrconsts.liscoolbarcodeexplorer
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Explorateur de code"

#: lazarusidestrconsts.liscoolbarcodetemplates
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Modèles de code"

#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr "&Configurer"

#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr "Voulez-vous vraiment supprimer la barre d'outils sélectionnée ?"

#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr "Il doit y avoir au moins une barre d'outils !"

#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr "Concepteur"

#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr "Paramètres généraux des barres d'outils"

#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr "Style de saisie des barres d'outils"

#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr "Simple"

#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Double"

#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr "Lignes horizontales"

#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr "Lignes verticales"

#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr "Pince"

#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Bouton"

#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr "Largeur de saisie"

#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr "Menu principal de l'EDI"

#: lazarusidestrconsts.liscoolbarmessages
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Messages"

#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr "Déplacer l'élément choisi de la barre d'outils vers le bas"

#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr "Déplacer l'élément choisi de la barre d'outils vers le haut"

#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr "Barre de l'EDI"

#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr "Éditeur de paquet"

#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr "Fichiers de l'éditeur de paquet"

#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr "Retirer l'élément sélectionné de la barre d'outils"

#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr "Valeurs par défaut"

#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr "Veuillez d'abord sélectionner une barre d'outils !"

#: lazarusidestrconsts.liscoolbarsourceeditor
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Éditeur de source"

#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr "Onglet Source"

#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr "Commandes de la barre d'outils"

#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr "La barre est &visible"

#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr "Largeur des barres d'outils"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Copier tous les éléments dans le presse-papiers"

#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Copier les messages (Tous/originaux) dans le presse-papiers"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Copier tous les messages montrés dans le presse-papiers"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Copier la description dans le presse-papiers"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Copier l'erreur"

#: lazarusidestrconsts.liscopyfilename
#, object-pascal-format
msgid "Copy Filename %s"
msgstr "Copier le nom de fichier %s"

#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Copier le nom du fichier dans le presse-papiers"

#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr "La copie des fichiers a échoué."

#: lazarusidestrconsts.liscopyidentifier
#, object-pascal-format
msgid "Copy \"%s\" to clipboard"
msgstr "Copier \"%s\" dans le presse-papiers"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "La copie d'une fiche complète n'est pas encore implémentée."

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Copier l'élément dans le presse-papiers"

#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Copier/Déplacer le fichier vers le répertoire"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Copier les éléments sélectionnés dans le presse-papiers"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Copier les messages sélectionnés dans le presse-papiers"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Examen des messages FPC"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Examen des messages de Make"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Omettre l'appel du compilateur"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Avertissement : le fichier additionnel de configuration du compilateur porte le même nom qu'un des fichiers standard utilisés par le compilateur FreePascal. La conséquence risque d'être que SEUL le fichier additionnel sera utilisé tandis que le fichier standard sera ignoré."

#: lazarusidestrconsts.liscpopenpackage
#, object-pascal-format
msgid "Open Package %s"
msgstr "Ouvrir le paquet %s"

#: lazarusidestrconsts.liscpopenunit
#, object-pascal-format
msgid "Open Unit %s"
msgstr "Ouvrir l'unité %s"

#: lazarusidestrconsts.liscpu
#, object-pascal-format
msgid ", CPU: %s"
msgstr ", CPU : %s"

#: lazarusidestrconsts.liscreateandedit
msgid "Create and edit"
msgstr "Créer et éditer"

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Veuillez d'abord créer un projet !"

#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Créer les modes de débogage et de production finale"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Voulez-vous créer le répertoire ?"

#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Créer un filtre"

#: lazarusidestrconsts.liscreatefppkgconfig
msgid "Restore Fppkg configuration"
msgstr "Restaurer la configuration de Fppkg"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Créer une fonction"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Créer un élément d'aide"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Le créer"

#: lazarusidestrconsts.liscreatelocalvariable
#, object-pascal-format
msgid "Create local variable \"%s\""
msgstr "Créer la variable locale \"%s\""

#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr "Créer un nouvel ajout"

#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Créer un nouveau paquet)"

#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Créer un nouveau composant de paquet"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Créer un projet"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Créer/mettre à jour le fichier .po en enregistrant le fichier lfm"

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
#, object-pascal-format
msgid "Creating file index of FPC sources %s ..."
msgstr "Création du fichier d'index des codes sources de FPC %s..."

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Choisir le répertoire"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Valeurs de répertoire des outils de code"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Définir les modèles"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<aucune variable choisie>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Ouvrir l'aperçu"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Outils"

#: lazarusidestrconsts.lisctdefvariable
#, object-pascal-format
msgid "Variable: %s"
msgstr "Variable : %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Nom de variable"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Modèles"

#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Mettre à jour toutes les signatures des méthode"

#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Mettre à jour plusieurs signatures de procédure"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "veuillez choisir une macro"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Veuillez choisir une macro"

#: lazarusidestrconsts.liscurrentlclwidgetset
#, object-pascal-format
msgid "Current LCL widgetset: \"%s\""
msgstr "Ensemble graphique LCL en cours : \"%s\""

#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "État actuel : "

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Colonne du curseur dans l'éditeur courant"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Ligne du curseur dans l'éditeur courant"

#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Ces options sont passées au compilateur après le remplacement des macros."

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "options personnalisées"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Options personnalisées"

#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr "Options personnalisées"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Programme personnalisé"

#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Un programme personnalisé en Free Pascal."

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Module de données"

#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Évaluation du point d'arrêt"

#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Point d'arrêt atteint"

#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Message du point d'arrêt"

#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Vidage de la pile des points d'arrêt"

#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Couleur par défaut"

#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Exception levée"

#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Chargement de module"

#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Déchargement de module"

#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Sortie de débogueur"

#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Sortie de processus"

#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Début de processus"

#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Sortie de tâche"

#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Début de tâche"

#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Message Windows posté"

#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Message Windows envoyé"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Pas de débogueur spécifié"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Placer le point d'arrêt de toute façon"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, object-pascal-format
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Aucun débogueur n'a été spécifié.%sPlacer des points d'arrêt n'aura aucun effet jusqu'à ce qu'un débogueur soit configuré dans la boîte de dialogue des options du débogueur dans le menu."

#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Déboguer"

#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks
msgid "Confirm to delete all Breakpoints"
msgstr "Confirmer pour supprimer tous les points d'arrêt"

#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile
msgid "Confirm to delete Breakpoints in same file"
msgstr "Confirmer la suppression des points d'arrêt dans le même fichier"

#: lazarusidestrconsts.lisdebugdialogconfirmdelhistory
msgid "Confirm to clear History"
msgstr "Confirmer pour effacer l'historique"

#: lazarusidestrconsts.lisdebugdialogconfirmdelwatches
msgid "Confirm to delete all Watches"
msgstr "Confirmer pour supprimer toutes les points de suivi"

#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Débogueur"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, object-pascal-format
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
msgstr "Erreur interne du débogueur.%0:s%0:sEnregistrez votre travail.%0:sCliquez sur \"Arrêter\" ou remettre à zéro le débogueur pour achever la session de débogage."

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Débogueur incorrect"

#: lazarusidestrconsts.lisdebugging
#, object-pascal-format
msgid "%s (debugging ...)"
msgstr "%s (débogage...)"

#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "Transtypage automatique pour les objets"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Ajouter une exception"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Chemin de recherche additionnel"

#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
msgid "BETA: Allow function calls in watches (if supported by backend)"
msgstr "BETA : Autoriser les appels de fonction dans les suivis (si pris en charge par le backend)"

#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr "Fermer automatiquement la fenêtre de l'assembleur si le code source est introuvable"

#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
msgid "Automatically set \"use instance class type\" for new watches"
msgstr "Définir automatiquement \"utiliser le type de classe d'instance\" pour les nouveaux points de suivi"

#: lazarusidestrconsts.lisdebugoptionsfrmbackend
msgid "Debugger backend"
msgstr "Backend du débogueur"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Point d'arrêt"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Effacer le journal à l'exécution"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Débogueur"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
msgid "Debugger Backend:"
msgstr "Backend du débogueur :"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings
msgid "Debugger dialogs"
msgstr "Boîtes de dialogue du débogueur"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Options générales du débogueur"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Options spécifiques du débogueur (dépendent du type de débogueur)"

#: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront
msgid "Always bring debug-windows (watches, locals) to front when adding items"
msgstr "Toujours mettre en avant les fenêtres de débogage (points de suivi, locales) lors de l'ajout d'éléments"

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Dupliquer le nom de l'exception"

#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
msgid "Change type"
msgstr "Modifier le type"

#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
msgstr "Modification du type du backend du débogueur actuel. Utilisez \"Ajouter\" ou \"Copier\" pour créer un nouveau backend avec un nouveau type."

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Entrer le nom de l'exception"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Journal des événements"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Géré par"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Géré par le débogueur"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Géré par le programme"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Ignorer ces exceptions"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Exceptions de langage"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Limiter le comptage à"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Module"

#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name:"
msgstr "Nom :"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Exceptions"
msgstr "Avertir lors des exceptions"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Exceptions du système d'exploitation"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Sortie"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Processus"

#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Réinitialiser le débogueur après chaque exécution"

#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
msgid "Show message on stop with Error (Exit-code <> 0)"
msgstr "Afficher le message à l'arrêt avec erreur (code de sortie <> 0)"

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Afficher le message à l'arrêt"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Signaux"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Tâche"

#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
#, object-pascal-format
msgid "Unknown Debugger backend \"%s\""
msgstr "Backend du débogueur inconnu : \"%s\""

#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Utiliser les couleurs du journal d'événements"

#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
msgid "-- Use IDE default Debugger --"
msgstr "-- Utiliser le débogueur par défaut de l'EDI --"

#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
msgid "-- Use project Debugger --"
msgstr "-- Utiliser le débogueur de projet --"

#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Fenêtres"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Impossible de charger le fichier"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, object-pascal-format
msgid "Unable to load file \"%s\"."
msgstr "Impossible de charger le fichier \"%s\"."

#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Valeur par défaut"

#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr "Section de visibilité de classe par défaut des nouvelles méthodes. Par exemple, complétion de code pour OnShow:="

#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr "La valeur par défaut est ComboBox avec les sélections à True et False"

#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(par défaut)"

#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr "Section par défaut des méthodes"

#: lazarusidestrconsts.lisdelayforcompletionbox
msgid "Delay for completion box"
msgstr "Délai pour la boîte de complétion"

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Durée pour les conseils sur une longue ligne dans la boîte de complétion"

#: lazarusidestrconsts.lisdelayforhints
msgid "Delay for hints"
msgstr "Délai pour les conseils"

#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "Supprimer ?"

#: lazarusidestrconsts.lisdeleteaddition
#, object-pascal-format
msgid "Delete addition \"%s\"?"
msgstr "Voulez-vous supprimer l'ajout \"%s\" ?"

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "Tout &Supprimer"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Voulez-vous supprimer ces fichiers ?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Voulez-vous supprimer les fichiers équivoques ?"

#: lazarusidestrconsts.lisdeletemacro
#, object-pascal-format
msgid "Delete macro \"%s\"?"
msgstr "Voulez-vous supprimer la macro \"%s\" ?"

#: lazarusidestrconsts.lisdeletemode
#, object-pascal-format
msgid "Delete mode \"%s\""
msgstr "Supprimer le mode \"%s\""

#: lazarusidestrconsts.lisdeleteoldfile
#, object-pascal-format
msgid "Delete old file \"%s\"?"
msgstr "Voulez-vous supprimer l'ancien fichier \"%s\" ?"

#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Voulez-vous supprimer la macro choisie ?"

#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr "Supprimer cet ajout"

#: lazarusidestrconsts.lisdeletevalue
#, object-pascal-format
msgid "Delete value \"%s\"?"
msgstr "Voulez-vous supprimer la valeur \"%s\" ?"

#: lazarusidestrconsts.lisdeletevalue2
#, object-pascal-format
msgid "Delete value %s"
msgstr "Supprimer la valeur %s"

#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr "Le délimiteur est le point-virgule."

#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr "Ressources compatibles avec Delphi. Recommandées."

#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "Les paquets de conception ajoutent des composants et des éléments de menu à l'EDI. Ils peuvent être utilisés par les projets, mais ne sont pas compilés dans le projet. Le compilateur ne trouvera pas les unités de ce paquet lors de la compilation du projet."

#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr "Bureaux..."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Répertoire de destination"

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Code du destructeur"

#: lazarusidestrconsts.lisdfileswererenamedtol
#, object-pascal-format
msgid "%d files were renamed to lowercase."
msgstr "%d fichiers ont été renommés en minuscules."

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Insensible à la casse"

#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "Fichier1"

#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "Fichier2"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Ignorer les lignes vides ajoutées ou supprimées"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Ignorer les différences de fin de ligne (#10 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Ignorer le nombre d'espaces"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Ignorer les espaces (sauf les caractères de saut de ligne)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Ignorer les espaces en fin de ligne"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Ignorer les espaces en début de ligne"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Sélection seulement"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Ouvrir les différences dans l'éditeur"

#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
#, object-pascal-format
msgid "different unit %s found at new position \"%s\""
msgstr "unité %s différente trouvée à la position \"%s\""

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Directives"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Directives pour la nouvelle unité"

#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Répertoires"

#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Répertoire : "

#: lazarusidestrconsts.lisdirectorynotfound
#, object-pascal-format
msgid "Directory \"%s\" not found."
msgstr "Répertoire \"%s\" non trouvé."

#: lazarusidestrconsts.lisdirectorynotfound2
#, object-pascal-format
msgid "directory %s not found"
msgstr "répertoire %s introuvable"

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Répertoire où l'EDI place les fichiers .po"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Désactiver I18N pour LFM"

#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr "Voulez-vous désactiver l'option -Xg ?"

#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr "Désactiver l'option -Xg"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Ignorer les changements"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Ignorer tous les changements"

#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Ignorer les changements et ouvrir le projet"

#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Ignorer les changements et quitter"

#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Ignorer les changements et créer un nouveau projet"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Cliquer sur un des éléments ci-dessous pour voir les différences"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
#, object-pascal-format
msgid "Error reading file: %s"
msgstr "Erreur de lecture du fichier : %s"

#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr "Ignorer tous les changements sur disque"

#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr "Recharger les fichiers cochés depuis le disque"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Certains fichiers ont changé sur le disque :"

#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
msgid "Some files have local changes. Either local or external changes will be overwritten."
msgstr "Certains fichiers ont des modifications locales. Les modifications locales ou externes seront écrasées."

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Différencier majuscules et minuscules (par exemple A et a)"

#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Toutes les options..."

#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Changer la classe..."

#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Définitions..."

#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Éditer..."

#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Exporter..."

#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Importer..."

#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr "Plus..."

#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Ouvrir..."

#: lazarusidestrconsts.lisdoesnotexists
#, object-pascal-format
msgid "%s does not exist: %s"
msgstr "%s n'existe pas : %s"

#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Ne pas modifier"

#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "Do not check if another IDE instance is already running."
msgstr "Ne pas vérifier si une autre instance de l'EDI est en cours d'exécution."

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Ne pas fermer le projet"

#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "Do not compile dependencies."
msgstr "Ne pas compiler les dépendances."

#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen."
msgstr "Ne pas afficher la fenêtre de présentation."

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Ne plus montrer cette boîte de dialogue pour ce projet"

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Ne plus montrer ce message"

#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr "Ne pas écrire le fichier d'information du projet mis à jour après la construction. Sans spécification, le numéro de construction sera incrémenté s'il est configuré."

#: lazarusidestrconsts.lisdonwloadonlinepackages
#, object-pascal-format
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?"
msgstr ""
"Le ou les paquets suivants ne sont pas disponibles localement : %s.\n"
"Pour les installer, vous devez d'abord les télécharger. Voulez-vous le faire maintenant ?"

#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Bas"

#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Rétrograder"

#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Rétrograder la configuration"

#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr "Télécharger"

#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "Voulez-vous toujours créer le nouveau projet ?"

#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Voulez-vous toujours ouvrir un autre projet ?"

#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Voulez-vous toujours arrêter ?"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Dessiner les lignes de la grille"

#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "Dessiner la sélection comme focalisée même si la fenêtre des messages ne l'est pas. Utilisez ceci si votre thème rend le dessin des éléments non focalisés à peine visibles."

#: lazarusidestrconsts.lisdropdowncount
msgid "Drop Down Count"
msgstr "Nombre d'éléments de liste déroulante"

#: lazarusidestrconsts.lisdropdowncounthint
msgid "Used for all ComboBoxes in IDE dialogs"
msgstr "Utilisé pour toutes les listes déroulantes dans les dialogues de l'EDI"

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Copier les composants sélectionnés vers le presse-papiers"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Couper les composants sélectionnés vers le presse-papiers"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Déplacer le composant vers l'arrière d'un niveau"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Déplacer le composant vers l'avant d'un niveau"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Déplacer le composant vers l'arrière"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Déplacer le composant vers l'avant"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Coller les composants sélectionnés depuis le presse-papiers"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Sélectionner le composant parent"

#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr "Montrer les composants non visuels"

#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr "Inverser la visibilité des composants non visuels"

#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Doublon"

#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Entrée dupliquée"

#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Nom de fichier dupliqué"

#: lazarusidestrconsts.lisduplicatefoundofvalue
#, object-pascal-format
msgid "Duplicate found of value \"%s\"."
msgstr "Doublon trouvé pour la valeur \"%s\"."

#: lazarusidestrconsts.lisduplicatemodename
#, object-pascal-format
msgid "Mode \"%s\" is already present in the list."
msgstr "Le mode \"%s\" est déjà présent dans la liste."

#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Nom dupliqué"

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, object-pascal-format
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Nom  dupliqué. Un composant appelé \"%s\" existe déjà dans le composant hérité %s"

#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Fichiers ppu dupliqués. Supprimez-en un ou assurez-vous que les chemins de recherche sont dans le bon ordre (Astuce : FPC utilise tout d'abord le dernier chemin)."

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Chemins de recherche dupliqués"

#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Codes sources dupliqués. Supprimez-en un ou assurez-vous que les chemins de recherche sont dans le bon ordre (Astuce : FPC utilise tout d'abord le dernier chemin)."

#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Dupliquer l'unité"

#: lazarusidestrconsts.lisduplicateunitin
#, object-pascal-format
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr "Dupliquer l'unité \"%s\" dans \"%s\""

#: lazarusidestrconsts.lisdynpkgamounttoscrollin
msgid "Amount to scroll in"
msgstr "Quantité à faire défiler"

#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
msgid "Amount to scroll in (%)"
msgstr "Quantité à faire défiler (%)"

#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
msgid "Amount to scroll in (Max)"
msgstr "Quantité à faire défiler (Max)"

#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
msgid "Auto Scroll on delete past left border"
msgstr "Défilement automatique lors de la suppression au-delà de la bordure gauche"

#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
msgid "Auto Scroll on type past right border"
msgstr "Défilement automatique lors de la suppression au-delà de la bordure droite"

#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
msgid "Trigger on min chars (% of width)"
msgstr "Déclenchement sur les caractères min (% de la largeur)"

#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
msgid "Trigger on min chars visible"
msgstr "Déclenchement sur les caractères min visibles"

#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Éditer"

#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr "Éditer l'aide supplémentaire pour les messages"

#: lazarusidestrconsts.liseditbuildmodes
msgid "Edit build modes"
msgstr "Modifier les modes de construction"

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Éditer le contexte d'aide"

#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Éditer l'aide"

#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Touche d'édition"

#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Couleurs de l'éditeur"

#: lazarusidestrconsts.liseditormacros
msgctxt "lazarusidestrconsts.liseditormacros"
msgid "Editor Macros"
msgstr "Macros de l'éditeur"

#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr "Éditeur de barres d'outils"

#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr "Paramètres de l'éditeur des barres d'outils"

#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr "L'éditeur des barres d'outils est &visible"

#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Charger un schéma"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Projet en cours"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Un outil a besoin au minimum d'un titre et d'un nom de fichier."

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Éditer les outils"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Touche"

#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Macros"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Paramètres :"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Nom du programme :"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for FPC messages"
msgstr "Rechercher les messages de sortie de FPC"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for \"make\" messages"
msgstr "Rechercher les messages Make de sortie"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Titre et nom de fichier requis"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Répertoire de travail :"

#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr "Augmenter la priorité du message afin de toujours le montrer (par défaut, sa priorité est basse)"

#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Tout"

#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Méthodes vides"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Méthodes vides trouvées :"

#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Pas de classe"

#: lazarusidestrconsts.lisemdnoclassat
#, object-pascal-format
msgid "No class at %s(%s,%s)"
msgstr "Pas de classe en %s(%s,%s)"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Publié seulement"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Publique"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Publiée"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Supprimer les méthodes"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Rechercher dans ces sections de classe :"

#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
#, object-pascal-format
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Impossible d'afficher des méthodes vides de la classe actuelle. Cause : %s%s"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Vide"

#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr "Le répertoire de destination pour la publication est soit un chemin relatif soit vide."

#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr "Permis seulement pour les paquets."

#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
#, object-pascal-format
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ". Activer le drapeau \"Utiliser l'unité\" de l'unité %s dans le paquet %s"

#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "Activer I18N pour LFM"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Activer l'internationalisation et le support de la traduction"

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Activer les macros"

#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr "Activer Dwarf 2 (-gw)"

#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr "Activer Dwarf 2 avec les ensembles"

#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr "Activer Dwarf 3 (-gw3)"

#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr "Voulez-vous activer l'option -Xg ?"

#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr "Actif = la touche Entrée remplace tout l'identifiant alors que Maj-Entrée remplace le préfixe ; Inactif = la touche Entrée remplace le préfixe alors que Maj-Entrée remplace tout l'identifiant"

#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Entourer d'un $IFDEF"

#: lazarusidestrconsts.lisencodingnumberoffilesfailed
#, object-pascal-format
msgid "Number of files failed to convert: %d"
msgstr "Nombre d'échecs de conversions de fichiers : %d"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "L'encodage du fichier \"%s\"%s sur le disque est %s. Le nouvel encodage est %s."

#: lazarusidestrconsts.lisenternewnameformacros
#, object-pascal-format
msgid "Enter new name for Macro \"%s\""
msgstr "Entrer un nouveau nom pour la macro \"%s\""

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Variable d'environnement, nom comme paramètre"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Nom de fichier du débogueur incorrect"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, object-pascal-format
msgid "The debugger file \"%s\" is not an executable."
msgstr "Le fichier du débogueur \"%s\" n'est pas un exécutable."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
#, object-pascal-format
msgid "Test directory \"%s\" not found."
msgstr "Répertoire de test \"%s\" introuvable."

#: lazarusidestrconsts.liserrinvalidoption
#, object-pascal-format
msgid "Invalid option at position %d: \"%s\""
msgstr "Option incorrecte à la position %d : \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
#, object-pascal-format
msgid "Option at position %d does not allow an argument: %s"
msgstr "L'option à la position %d ne permet pas un argument : %s"

#: lazarusidestrconsts.liserroptionneeded
#, object-pascal-format
msgid "Option at position %d needs an argument : %s"
msgstr "L'option à la position %d a besoin d'un argument : %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Erreur : "

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Erreur à la création du fichier"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Erreur à la suppression du fichier"

#: lazarusidestrconsts.liserrorin
#, object-pascal-format
msgid "Error in %s"
msgstr "Erreur dans %s"

#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Erreur dans le nom de fichier du compilateur :"

#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Erreur dans les options personnalisées de compilation (Autre) :"

#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Erreur dans les options personnalisées de l'éditeur de liens (Compilation et édition de liens / Passage des options à l'éditeur de liens) :"

#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Erreur dans \"Ajout du chemin du débogueur\" :"

#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Erreur dans le chemin de recherche des \"Fichiers d'inclusion\" :"

#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Erreur dans le chemin de recherche des \"Bibliothèques\" :"

#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Erreur dans le chemin de recherche des \"Fichiers compilés\" :"

#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Erreur dans le chemin de recherche des \"Autres sources\" :"

#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Erreur dans le chemin de recherche des \"Autres fichiers unités\" :"

#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Erreur dans le \"répertoire de sortie de l'unité\" :"

#: lazarusidestrconsts.liserrorinvalidbuildmode
#, object-pascal-format
msgid "Error: invalid build mode \"%s\""
msgstr "Erreur : mode de construction \"%s\" incorrect"

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Erreur lors du chargement du fichier"

#: lazarusidestrconsts.liserrorloadingfile2
#, object-pascal-format
msgid "Error loading file \"%s\":"
msgstr "Erreur de chargement du fichier \"%s\" :"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Erreur en déplaçant le composant"

#: lazarusidestrconsts.liserrormovingcomponent2
#, object-pascal-format
msgid "Error moving component %s:%s"
msgstr "Erreur en déplaçant le composant %s :%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Erreur en nommant le composant"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Erreur d'ouverture du composant"

#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr "Erreur à l'ouverture de la fiche"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Erreur d'analyse du flux de composants lfm."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, object-pascal-format
msgid "Error reading package list from file%s%s%s%s"
msgstr "Erreur en lisant la liste des paquets du fichier %s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Erreur de lecture du XML"

#: lazarusidestrconsts.liserrorreadingxmlfile
#, object-pascal-format
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Erreur de lecture du fichier XML \"%s\"%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Erreur en renommant le fichier"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Erreurs"

#: lazarusidestrconsts.liserrors2
#, object-pascal-format
msgid ", Errors: %s"
msgstr ", Erreurs : %s"

#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr "Erreur de sauvegarde de la fiche"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, object-pascal-format
msgid "Error setting the name of a component %s to %s"
msgstr "Erreur d'attribution du nom de composant %s en %s"

#: lazarusidestrconsts.liserrorwritingfile
#, object-pascal-format
msgid "Error writing file \"%s\""
msgstr "Erreur d'écriture du fichier \"%s\""

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, object-pascal-format
msgid "Error writing package list to file%s%s%s%s"
msgstr "Erreur lors de l'écriture de la liste des paquets dans le fichier%s%s%s%s"

#: lazarusidestrconsts.liseverynthlinenumber
msgid "Show every n-th line number"
msgstr "Montrer chaque énième numéro de ligne"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Fichier exemple :"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
#, object-pascal-format
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Exemples :%sIdentificateur%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"

#: lazarusidestrconsts.lisexclude
msgid "Exclude"
msgstr "Exclure"

#: lazarusidestrconsts.lisexcludedatruntime
#, object-pascal-format
msgid "%s excluded at run time"
msgstr "%s exclu à l'exécution"

#: lazarusidestrconsts.lisexcludesforstars
msgid "Excludes for * and ** in unit and include search paths"
msgstr "Exclusion des * et ** dans les chemins de recherche des unités et des fichiers inclus"

#: lazarusidestrconsts.lisexecutableisadirectory
#, object-pascal-format
msgid "executable \"%s\" is a directory"
msgstr "l'exécutable \"%s\" est un répertoire"

#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
#, object-pascal-format
msgid "executable \"%s\" lacks the permission to run"
msgstr "l'exécutable \"%s\" n'a pas la permission de se lancer"

#: lazarusidestrconsts.lisexecuteafter
msgid "Execute After"
msgstr "Exécuter après"

#: lazarusidestrconsts.lisexecutebefore
msgid "Execute Before"
msgstr "Exécuter avant"

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Exécution interrompue"

#: lazarusidestrconsts.lisexecutionstoppedexitcode
#, object-pascal-format
msgid "Execution stopped with exit-code %1:d ($%2:s)"
msgstr "Exécution arrêtée avec le code de sortie %1:d ($%2:s)"

#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Quitter"

#: lazarusidestrconsts.lisexitcode
#, object-pascal-format
msgid "Exit code %s"
msgstr "Code de sortie %s"

#: lazarusidestrconsts.lisexpand
msgid "Expand"
msgstr "Développer"

#: lazarusidestrconsts.lisexpandall
msgid "Expand All [Ctrl+Plus]"
msgstr "Tout développer (Ctrl+Plus)"

#: lazarusidestrconsts.lisexpandall2
msgid "Expand All"
msgstr "Tout développer"

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Développer toutes les classes"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Développer tous les paquets"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Développer toutes les unités"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Nom étendu du fichier de l'éditeur courant"

#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Exporter"

#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr "Tout exporter"

#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Exporter tous les éléments vers le fichier"

#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr "Exporter les options d'environnement"

#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Exporter en HTML"

#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr "Exporter / Importer"

#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list"
msgstr "Exporter la liste des paquets"

#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr "Exporter le sélectionné"

#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr "Exporter >>"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Extraire"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Extraire la procédure"

#: lazarusidestrconsts.lisextraopts
msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them."
msgstr "Passe des options supplémentaires au compilateur. Peut être fourni plusieurs fois. Si des options de compilation sont également spécifiées avec --build-ide, alors les options de --opt seront ajoutées après elles."

#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Très verbeux"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Outils externes"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Nombre maximum d'outils atteint"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
#, object-pascal-format
msgid "There is a maximum of %s tools."
msgstr "Le nombre d'outils est limité à %s."

#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
#, object-pascal-format
msgid "Failed to add %d not unique resource(s)"
msgstr "Impossible d'ajouter %d ressource(s) non unique(s)"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
#, object-pascal-format
msgid "Failed to create Application Bundle for \"%s\""
msgstr "La création du paquet d'application pour \"%s\" a échoué"

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Le chargement de l'état de pliage a échoué"

#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "la résolution des macros a échoué"

#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "L'enregistrement de fichier a échoué."

#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr "Fatal"

#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Fichier"

#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Fichier : "

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Extension de fichier des programmes"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Filtre de fichier"

#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Filtres de fichiers"

#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Ajouter une ligne"

#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Supprimer une ligne"

#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Insérer une ligne"

#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Masque de fichier"

#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Définir les valeurs par défaut"

#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Ce sont les filtres de fichiers qui apparaîtront dans toutes les boîtes de dialogue d'ouverture de fichiers"

#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr "Fichier trouvé"

#: lazarusidestrconsts.lisfilehaschangedsave
#, object-pascal-format
msgid "File \"%s\" has changed. Save?"
msgstr "Le fichier \"%s\" a été modifié. Faut-il l'enregistrer ?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Le fichier n'a pas de projet"

#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Le fichier est un répertoire"

#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Le fichier n'est pas un exécutable"

#: lazarusidestrconsts.lisfileisvirtual
#, object-pascal-format
msgid "File \"%s\" is virtual."
msgstr "Le fichier \"%s\" est virtuel."

#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr "Style de nom de fichier"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Fichier non trouvé"

#: lazarusidestrconsts.lisfilenotfound3
#, object-pascal-format
msgid "file %s not found"
msgstr "fichier \"%s\" non trouvé"

#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "fichier non trouvé"

#: lazarusidestrconsts.lisfilenotfound5
#, object-pascal-format
msgid "File not found:%s%s"
msgstr "Fichier non trouvé :%s%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, object-pascal-format
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "Fichier \"%s\" non trouvé.%sSouhaitez-vous le créer ?"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Fichier pas en minuscules"

#: lazarusidestrconsts.lisfilescountconvertedtotextformat
#, object-pascal-format
msgid "%d files were converted to text format."
msgstr "%d fichiers ont été convertis au format texte."

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Paramètres du fichier"

#: lazarusidestrconsts.lisfileshasincorrectsyntax
#, object-pascal-format
msgid "File %s has incorrect syntax."
msgstr "Le fichier %s a une syntaxe incorrecte."

#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
#, object-pascal-format
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Fichiers : %s - avec procédure Register : %s - dans la section uses du paquet : %s"

#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Tous les fichiers trouvés ont déjà le bon encodage ***"

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Fichiers encodés ASCII ou UTF-8"

#: lazarusidestrconsts.lisfilesisconvertedtotextformat
#, object-pascal-format
msgid "File %s was converted to text format."
msgstr "Le fichier %s a été converti au format texte."

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Fichiers non encodés ASCII ou UTF-8"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "File where debug output is written to. Default is write to the console."
msgstr "Fichier où est envoyée la sortie de débogage. Par défaut, la sortie de débogage est envoyée vers la console."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Filtre"

#: lazarusidestrconsts.lisfilter3
#, object-pascal-format
msgid "Filter: %s"
msgstr "Filtre : %s"

#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr "Filtrer tous les messages d'un certain type"

#: lazarusidestrconsts.lisfilterallmessagesoftype
#, object-pascal-format
msgid "Filter all messages of type %s"
msgstr "Filtrer tous les messages de type %s"

#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "Le filtre existe déjà"

#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Filtrer les messages de débogage et inférieurs"

#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Filtrer les conseils et inférieurs"

#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Filtrer les conseils sans position dans le code source"

#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "Aucun filtre ; ne pas filtrer par urgence"

#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Filtrer les messages non urgents"

#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "Filtrer les notes et inférieurs"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Jeux de filtres"

#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Filtrer la liste des options disponibles"

#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Filtrer les messages verbeux et inférieurs"

#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Filtrer les avertissements et inférieurs"

#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Chercher..."

#: lazarusidestrconsts.lisfinddeclarationof
#, object-pascal-format
msgid "Find Declaration of %s"
msgstr "Chercher la déclaration de %s"

#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "Réperto&ires"

#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "Masque de &fichier"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Inclure les &sous-répertoires"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "&Structure en lignes multiples"

#: lazarusidestrconsts.lisfindfilereplacementisnotpossible
msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:"
msgstr "Ce fichier contient des caractères qui ont des longueurs différentes en majuscules et en minuscules. L'implémentation actuelle ne permet pas un remplacement correct dans ce cas (mais vous pouvez utiliser un remplacement sensible à la casse). Ce fichier devra être ignoré :"

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "all files in &project"
msgstr "tous les fichiers du &projet"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "all &open files"
msgstr "tous les fichiers &ouverts"

#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "&active file"
msgstr "fichier &actif"

#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "&directories"
msgstr "&répertoires"

#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
msgid "project &group"
msgstr "&groupe de projets"

#: lazarusidestrconsts.lisfindfilewhere
msgid "Search location"
msgstr "Emplacement de la recherche"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Trouver la combinaison de touches"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Trouver l'unité manquante"

#: lazarusidestrconsts.lisfindoption
msgid "Find option"
msgstr "Trouver une option"

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "En premier"

#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr "&Premier essai"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Corriger le fichier LFM"

#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Bulle d'aide de focus"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Forcer le renommage"

#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr "Le tri par portée affichera tout d'abord les variables locales, puis les membres de la classe en cours, puis ceux des ancêtres, puis ceux de l'unité en cours, puis ceux des unités utilisées"

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Fiche"

#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr "Pour macOS (Darwin)"

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Erreur de format"

#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr "Pour Windows"

#: lazarusidestrconsts.lisfoundversionexpected
#, object-pascal-format
msgid "Found version %s, expected %s"
msgstr "Version %s trouvée et %s attendue"

#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr "Version FPC en nombre (par exemple : 20701)"

#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr "Fichier de messages FPC :"

#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr "Messages FPC : Appendice"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr "Ressources FPC (.res)"

#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Codes sources de FPC"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "FPC trop ancien"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Version FPC : "

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Version FPC (par exemple : 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Éditeur FPDoc"

#: lazarusidestrconsts.lisfpdocerrorwriting
#, object-pascal-format
msgid "Error writing \"%s\"%s%s"
msgstr "Erreur en écriture \"%s\"%s%s"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Erreur de syntaxe de FPDoc"

#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "Nom du paquet \"FPDoc\" :"

#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "Nom du paquet FPDoc. Par défaut, il s'agit du nom du fichier de projet."

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
#, object-pascal-format
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Il y a une erreur de syntaxe dans l'élément FPDoc \"%s\":%s%s"

#: lazarusidestrconsts.lisfppkgcompilerproblem
msgid "there is a problem with the Free Pascal compiler executable, "
msgstr "il y a un problème avec l'exécutable du compilateur Free Pascal, "

#: lazarusidestrconsts.lisfppkgconfgenproblems
msgid "Warnings have to be resolved first"
msgstr "Les avertissements doivent d'abord être résolus"

#: lazarusidestrconsts.lisfppkgconfiguration
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
msgstr "Le fichier de configuration porte généralement le nom \"fppkg.cfg\". En cas d'erreur, il peut être impossible de résoudre les dépendances des paquets Free Pascal. Laissez vide pour utiliser la valeur par défaut."

#: lazarusidestrconsts.lisfppkgconfigurationfilenotfound
#, object-pascal-format
msgid "Fppkg configuration file not found:%s%s"
msgstr "Fichier de configuration Fppkg introuvable :%s%s"

#: lazarusidestrconsts.lisfppkgcreatefilefailed
#, object-pascal-format
msgid "Failed to generate the configuration file \"%s\": %s"
msgstr "Échec de la génération du fichier de configuration \"%s\" : %s"

#: lazarusidestrconsts.lisfppkgfilestobewritten
msgid "Files to be written:"
msgstr "Fichiers à écrire :"

#: lazarusidestrconsts.lisfppkgfixconfiguration
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
msgstr "Vous pourriez essayer de restaurer automatiquement les fichiers de configuration ou adapter manuellement le fichier de configuration."

#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
msgstr "Impossible de retrouver la version de l'outil de configuration fpcmkcfg."

#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
msgstr "Impossible de trouver l'outil de configuration fpcmkcfg, qui est nécessaire pour créer les fichiers de configuration."

#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
msgid "An up-to-date version is needed to create the configuration files."
msgstr "Une version à jour est nécessaire pour créer les fichiers de configuration."

#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
msgid "It is probably too old to create the configuration files."
msgstr "Probablement trop ancien pour créer les fichiers de configuration."

#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
#, object-pascal-format
msgid "The fpcmkcfg configuration tool it too old [%s]."
msgstr "L'outil de configuration de fpcmkcfg est trop ancien [%s]."

#: lazarusidestrconsts.lisfppkginstallationpath
#, object-pascal-format
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
msgstr "Le préfixe de l'installation du compilateur Free Pascal est requis. Par exemple, il a les unités \"%s\" et/ou \" %s\""

#: lazarusidestrconsts.lisfppkglibprefix
#, object-pascal-format
msgid "Fpc library prefix: %s"
msgstr "Préfixe de bibliothèque Fpc : %s"

#: lazarusidestrconsts.lisfppkgprefix
#, object-pascal-format
msgid "Fpc prefix: %s"
msgstr "Préfixe FPC : %s"

#: lazarusidestrconsts.lisfppkgproblem
msgid "Problem with Fppkg configuration"
msgstr "Problème avec la configuration de Fppkg"

#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
msgstr "Assurez-vous qu'une version récente est installée et disponible dans le chemin ou auprès de l'exécutable du compilateur."

#: lazarusidestrconsts.lisfppkgwriteconfexception
#, object-pascal-format
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
msgstr "Un problème s'est produit lors de la tentative de création d'une nouvelle configuration Fppkg : %s"

#: lazarusidestrconsts.lisfppkgwriteconffailed
#, object-pascal-format
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
msgstr "Impossible de créer une nouvelle configuration Fppkg (%s). Vous devrez corriger la configuration manuellement ou réinstaller Free Pascal."

#: lazarusidestrconsts.lisfppkgwriteconfigfile
msgid "Write new configuration files"
msgstr "Écrire les nouveaux fichiers de configuration"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Cadre"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Recherche en arrière"

#: lazarusidestrconsts.lisfreeingbufferlines
#, object-pascal-format
msgid "freeing buffer lines: %s"
msgstr "libération des lignes de tampon : %s"

#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Message du compilateur Free Pascal"

#: lazarusidestrconsts.lisfreepascalprefix
msgid "Free Pascal compiler prefix"
msgstr "Préfixe du compilateur Free Pascal"

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Répertoire des codes sources de Free Pascal"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Recherche vers l'&avant"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Fichiers additionnels à chercher (par exemple : /chemin/*.pas;/chemin2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Chercher ou renommer l'identificateur"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Chercher les références"

#: lazarusidestrconsts.lisfriidentifier
#, object-pascal-format
msgid "Identifier: %s"
msgstr "Identificateur : %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "dans tous les paquets et projets ouverts"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "dans l'unité courante"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "dans le projet principal"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "dans le projet/paquet possédant l'unité courante"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Identificateur incorrect"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Renommer toutes les références"

#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr "Renommage en cours"

#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr "Recherche"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Chercher aussi dans les commentaires"

#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Complet"

#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Fonction"

#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Général"

#: lazarusidestrconsts.lisgeneratefppkgcfg
#, object-pascal-format
msgid "Fppkg configuration: %s"
msgstr "Configuration de Fppkg : %s"

#: lazarusidestrconsts.lisgeneratefppkgcompcfg
#, object-pascal-format
msgid "Fppkg compiler configuration: %s"
msgstr "Configuration du compilateur de Fppkg : %s"

#: lazarusidestrconsts.lisgeneratefppkgconfiguration
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
msgstr "Utiliser cet écran pour générer les nouveaux fichiers de configuration Fppkg avec l'outil fpcmkcfg."

#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
msgid "Generate new Fppkg configuration files"
msgstr "Générer de nouveaux fichiers de configuration Fppkg"

#: lazarusidestrconsts.lisgetbuildmodes
msgid "Print a list of build modes in the project. Active mode is listed first."
msgstr "Donner une liste des modes de construction du projet. Le mode actif est listé en premier."

#: lazarusidestrconsts.lisgetexpandtext
msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode."
msgstr "Imprime le résultat de la substitution des macros dans le texte. L'absence de macros fournit le nom de la macro. En cas d'erreur, renvoie uniquement le texte avec les macros partiellement développées et indique le code d'erreur (également pour une chaîne vide). Prend en compte le mode de construction actif (ou spécifié avec l'option --bm)."

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "obtenir le mot à la position courante du curseur"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr "Obtenir le mot à la position courante du curseur."

#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr "Paramètres globaux"

#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Aller à la ligne"

#: lazarusidestrconsts.lisgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"[Seule la version anglaise est valable.]\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPE.  See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Groupe"

#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr "Regrouper automatiquement les variables locales définies"

#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or disable groups of debug output. Valid options are:"
msgstr "Activer ou désactiver des groupes de sortie de débogage. Les options correctes sont :"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Agrandir au plus grand"

#: lazarusidestrconsts.lisgutterpartmargin
msgid "Margin"
msgstr "Marge"

#: lazarusidestrconsts.lisgutterpartvisible
msgid "Visible"
msgstr "Visible"

#: lazarusidestrconsts.lisgutterpartwidth
msgid "Width"
msgstr "Largeur"

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Comprend une aide"

#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr "Couleurs des en-têtes"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Commentaire d'en-tête pour la classe"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Entrée de l'aide"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Sélecteur d'aide"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Aide pour les messages du compilateur FreePascal"

#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "Cacher tous les conseils et avertissements en insérant la directive de l'EDI {%H-}"

#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "Cacher le message à %s en insérant la directive de l'EDI {%H-}"

#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "Cacher le message en insérant la directive de l'EDI {%H-}"

#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
#, object-pascal-format
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr "Cacher le message en insérant {$warn %s off} dans l'unité \"%s\""

#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Cacher la recherche"

#: lazarusidestrconsts.lishidewindow
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Cacher la fenêtre"

#: lazarusidestrconsts.lishidewithpackageoptionvm
#, object-pascal-format
msgid "Hide with package option (-vm%s)"
msgstr "Cacher avec l'option de paquet (-vm%s)"

#: lazarusidestrconsts.lishidewithprojectoptionvm
#, object-pascal-format
msgid "Hide with project option (-vm%s)"
msgstr "Cacher avec l'option du projet (-vm%s)"

#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "Conseil"

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Astuce : une valeur par défaut peut être définie dans les expressions conditionnelles."

#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr "Une bulle d'aide près du nom de la propriété la décrit."

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Suggestion : vérifiez si deux paquets contiennent une unité du même nom."

#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr "Astuce : cliquer sur \"Montrer les options\" pour voir d'où viennent les chemins hérités."

#: lazarusidestrconsts.lishints
#, object-pascal-format
msgid ", Hints: %s"
msgstr ", Conseils : %s"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, object-pascal-format
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Conseil : la fonction \"Make Ressourcestring\" s'attend à une constante chaîne.%sVeuillez choisir l'expression et réessayer."

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Afficher les fiches"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Afficher les unités"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Bases de données"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Options de l'aide"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Propriétés :"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Visualiseurs"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Chemin HTML de la doc de FPC"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Horizontal"

#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr "Lignes horizontales entre les propriétés."

#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr "Ajout"

#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr "Ouverture en cours"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "EDI"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Options de création de l'EDI"

#: lazarusidestrconsts.lisidecaptioncustomhint
msgid "Additional info to display in the IDE title"
msgstr ""

#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "L'EDI devra être recompilé et redémarré après l'installation et la désinstallation de paquets."

#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
#, object-pascal-format
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Bienvenue dans Lazarus.%0:sLa configuration trouvée de l’EDI a déjà été utilisée par une autre installation de Lazarus.%0:sSi vous avez plusieurs installations distinctes de Lazarus, elles ne doivent pas partager la même configuration. Cette situation peut conduire à des conflits et vos installations Lazarus peuvent en devenir inutilisables.%0:s%0:sSi vous n'avez qu'une seule installation et que vous avez copié ou déplacé l'exécutable de Lazarus, vous pouvez mettre à jour cette configuration.%0:s%1:s%0:s%0:sChoisissez :%0:s%0:s* Mettre à jour : utiliser cette configuration et la mettre à jour pour être utilisée avec Lazarus à l'avenir. L'ancienne installation ne l’utilisera plus.%0:s* Ignorer : utiliser cette configuration, mais garder l'avertissement. Cela peut conduire à des conflits avec l'autre installation.%0:s* Abandon : quitter maintenant. Vous pouvez alors régler le problème en démarrant Lazarus avec la configuration correcte.%0:s%0:sInformations complémentaires :%0:scette configuration se trouve dans %2:s%0:sElle appartient à l'installation Lazarus qui se trouve dans %3:s%0:sL'EDI actuel a démarré depuis : %4:s%0:s"

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Informations à propos de l'EDI"

#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "Macros de l'EDI"

#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr "L'EDI s'occupe de Application.Scaled (Hi-DPI) dans l'unité principale."

#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "L'EDI s'occupe du titre de la fiche principale."

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "identificateur"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "L'identificateur commence par..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "L'identificateur contient..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Options de l'EDI :"

#: lazarusidestrconsts.lisidetitlecustom
#, fuzzy
#| msgid "Custom IDE window title"
msgid "Custom IDE title"
msgstr "Titre personnalisé de la fenêtre de l'EDI"

#: lazarusidestrconsts.lisidetitleoptions
msgid "IDE main window and taskbar title"
msgstr ""

#: lazarusidestrconsts.lisidetitlestartswithprojectname
#, fuzzy
#| msgid "IDE title starts with project name"
msgid "Show custom IDE title before built-in IDE title or info"
msgstr "Le titre de l'EDI débute avec le nom du projet"

#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Tous les modes de construction"

#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Options du compilateur de"

#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Mode de construction courant"

#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "Erreur à l'ouverture du fichier XML"

#: lazarusidestrconsts.lisiecoerroropeningxmlfile
#, object-pascal-format
msgid "Error opening XML file \"%s\":%s%s"
msgstr "Erreur à l'ouverture du fichier XML \"%s\" :%s%s"

#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Exporter les options du compilateur"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Le fichier d'exportation existe"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, object-pascal-format
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Le fichier d'exportation \"%s\" existe.%sFaut-il ouvrir le fichier et remplacer seulement les options du compilateur ?%s(Les autres paramètres seront conservés.)"

#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Importer les options du compilateur"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Charger depuis un fichier"

#: lazarusidestrconsts.lisieconocompileroptionsinfile
#, object-pascal-format
msgid "File \"%s\" does not contain compiler options."
msgstr "Le fichier \"%s\" ne contient pas les options du compilateur."

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Enregistrer dans un fichier"

#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "Si non coché  :"

#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr "Demander une sauvegarde si seules les informations de la session ont changé."

#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, object-pascal-format
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "Si vous souhaitez utiliser deux versions différentes de Lazarus, vous devez démarrer le second Lazarus avec le paramètre de ligne de commande primary-config-path ou pcp.%sPar exemple :"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Tout ignorer"

#: lazarusidestrconsts.lisignoreuseasancestor
#, object-pascal-format
msgid "Ignore, use %s as ancestor"
msgstr "Ignorer et utiliser %s comme ancêtre"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Imiter l'indentation de l'unité, du projet ou du paquet en cours"

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Commentaire d'implémentation pour la classe"

#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Importer"

#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr "Important"

#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr "Importer les options d'environnement"

#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Importer depuis le fichier"

#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr "L'importation des modes de construction n'est pas autorisée pour les paquets."

#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list"
msgstr "Importer la liste de paquets"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Impossible"

#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
#, object-pascal-format
msgid "In a source directory of the package \"%s\"."
msgstr "Dans un répertoire de sources du paquet \"%s\"."

#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "Dans un répertoire de codes sources du projet. Vérifiez les doublons."

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "chemin d'inclusion"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Inclure les chemins"

#: lazarusidestrconsts.lisincluderecursive
msgid "Include, recursive"
msgstr "Inclure récursivement"

#: lazarusidestrconsts.lisincompatibleppu
#, object-pascal-format
msgid ", incompatible ppu=%s"
msgstr ", ppu=%s incompatible"

#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Le répertoire de configuration trouvé est incorrect"

#: lazarusidestrconsts.lisincorrectfppkgconfiguration
#, object-pascal-format
msgid "there is a problem with the Fppkg configuration. (%s)"
msgstr "la configuration de Fppkg est corrompue. (%s)"

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Indentation des codes sources en Pascal"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Informations"

#: lazarusidestrconsts.lisinformationaboutunit
#, object-pascal-format
msgid "Information about %s"
msgstr "Informations sur %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Informations sur le FPC utilisé"

#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "Dans le chemin de recherche des unités FPC. Probablement installé par le paquet FPC. Vérifiez si le compilateur et le fichier ppu appartiennent à la même installation."

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "En tête des apparentés"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Élément hérité"

#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Paramètres hérités"

#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Composant du projet hérité"

#: lazarusidestrconsts.lisinitialchecks
msgid "Initial Checks"
msgstr "Vérifications initiales"

#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr "Initialiser la variable locale"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, object-pascal-format
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Afin de créer une copie propre du projet/paquet, tous les fichiers du répertoire suivant seront supprimés et tout son contenu sera perdu.%sVoulez-vous supprimer tous les fichiers de \"%s\" ?"

#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Insérer"

#: lazarusidestrconsts.lisinsertassignment
#, object-pascal-format
msgid "Insert Assignment %s := ..."
msgstr "Insérer l'affectation %s :=..."

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "isérer la date"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "insérer la date et l'heure"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string."
msgstr "Insérer la date et l'heure. Facultatif : formater la chaîne de caractères."

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string."
msgstr "Insérer la date. Facultatif : formater la chaîne de caractères."

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "insérer end si nécessaire"

#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart,          // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName,       // extract/add ClassName.\n"
"WithoutClassName,   // skip classname\n"
"WithoutName,        // skip function name\n"
"WithoutParamList,   // skip param list\n"
"WithVarModifiers,   // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes,  // skip colon, param types and default values\n"
"WithDefaultValues,  // extract default values\n"
"WithResultType,     // extract colon + result type\n"
"WithOfObject,       // extract 'of object'\n"
"WithCallingSpecs,   // extract cdecl; inline;\n"
"WithProcModifiers,  // extract forward; alias; external;\n"
"WithComments,       // extract comments and spaces\n"
"InUpperCase,        // turn to uppercase\n"
"CommentsToSpace,    // replace comments with a single space\n"
"                      //  (default is to skip unnecessary space,\n"
"                      //    e.g 'Do   ;' normally becomes 'Do;'\n"
"                      //    with this option you get 'Do ;')\n"
"WithoutBrackets,    // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon,   // skip semicolon at end\n"
msgstr ""
"Insérer l'en-tête de la procédure en cours.\n"
"\n"
"Paramètres optionnels (séparés par des virgules) :\n"
"WithStart,          // mot-clé procédure. Par exemple : \"function\", \"class procedure\"\n"
"WithoutClassKeyword,// sans le mot-clé de procédure \"class\"\n"
"AddClassName,       // extraction/ajout du nom de la classe\n"
"WithoutClassName,   // ignorer le nom de la classe\n"
"WithoutName,        // ignorer le nom de la fonction\n"
"WithoutParamList,   // ignorer la liste de paramètres\n"
"WithVarModifiers,   // extraction de \"var\", \"out\", \"const\"\n"
"WithParameterNames, // extraction des noms des paramètres\n"
"WithoutParamTypes,  // ignorer les deux-points, les types de paramètres et les valeurs par défaut\n"
"WithDefaultValues,  // extraction des valeurs par défaut\n"
"WithResultType,     // extraction des deux-points et du type de résultat\n"
"WithOfObject,       // extraction de \"of object\"\n"
"WithCallingSpecs,   // extraction de \"cdecl;\", \"inline;\"\n"
"WithProcModifiers,  // extraction de  \"forward;\",  \"alias;\",  \"external;\"\n"
"WithComments,       // extraction des commentaires et des espaces\n"
"InUpperCase,        // mise en majuscules\n"
"CommentsToSpace,    // remplacer les commentaires par un espace simple\n"
"                      //  (par défaut, on ignore les espaces non nécessaires ;\n"
"                      //    par exemple : \"Do   ;\" devient normalement \"Do;\" ;\n"
"                      //    avec cette option, on obtient \"Do ;\")\n"
"WithoutBrackets,    // ignorer les parenthèses de début et de fin de la liste de paramètres\n"
"WithoutSemicolon,   // ignorer le point-virgule de fin\n"

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Insérer une macro"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure."
msgstr "Insérer le nom de la procédure courante."

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Insérer la balise printshort"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "insérer un en-tête de procédure"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "isérer un nom de procédure"

#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr "Insérer un point-virgule si nécessaire"

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "insérer l'heure"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string."
msgstr "Insérer la date. Facultatif :  formater la chaîne de caractères."

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Insérer une balise URL"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "Dans la session"

#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "installé"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Installer malgré tout"

#: lazarusidestrconsts.lisinstallpackagesmsg
#, object-pascal-format
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?"
msgstr ""
"Les paquets suivants ne sont pas installés, mais présents dans le répertoire principal : %s.\n"
"Voulez-vous installer les paquets manquants ?"

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Installer la sélection"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Installer/désinstaller des paquets"

#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compiling a package create a simple Makefile."
msgstr "Au lieu de compiler le paquet, créer un Makefile simple."

#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr "Encodage insuffisant"

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interactif"

#: lazarusidestrconsts.lisinternalerror
#, object-pascal-format
msgid "internal error: %s"
msgstr "erreur interne : %s"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Effacement incorrect"

#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr "Exécutable incorrect"

#: lazarusidestrconsts.lisinvalidexecutablemessagetext
#, object-pascal-format
msgid "The file \"%s\" is not executable."
msgstr "Le fichier \"%s\" n'est pas exécutable."

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, object-pascal-format
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Expression incorrecte.%sConseil : la fonction \"Make Resourcestring\" s'attend à une constante de type chaîne dans un fichier unique. Veuillez choisir l'expression avant de réessayer."

#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr "Nom de fichier incorrect"

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Filtre incorrect"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
#, object-pascal-format
msgid "Invalid line, column in message%s%s"
msgstr "Ligne incorrecte, colonne dans le message%s%s"

#: lazarusidestrconsts.lisinvalidmacrosin
#, object-pascal-format
msgid "Invalid macros in \"%s\""
msgstr "Macros incorrectes dans \"%s\""

#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
#, object-pascal-format
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Macros \"%s\" incorrectes dans l'outil externe \"%s\""

#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
#, object-pascal-format
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "Macros \"%s\" incorrecte. Le nom de macro doit être un identificateur Pascal."

#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
#, object-pascal-format
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Macro \"%s\" incorrecte. Le nom est un mot-clé."

#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Masque incorrect"

#: lazarusidestrconsts.lisinvalidmode
#, object-pascal-format
msgid "Invalid mode %s"
msgstr "Mode %s incorrect"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Sélection multiple incorrecte"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Identificateur Pascal incorrect"

#: lazarusidestrconsts.lisinvalidpascalidentifiername
#, object-pascal-format
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr "Le nom \"%s\" n'est pas un identifiant Pascal correct.%sVoulez-vous l'utiliser quand même ?"

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Nom de procédure incorrect"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Nom de fichier projet incorrect"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Répertoire de publication incorrect"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Sélection incorrecte"

#: lazarusidestrconsts.lisinvalidversionin
#, object-pascal-format
msgid "invalid version in %s"
msgstr "version incorrecte dans %s"

#: lazarusidestrconsts.lisisalreadypartoftheproject
#, object-pascal-format
msgid "%s is already part of the Project."
msgstr "%s fait déjà partie du projet."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, object-pascal-format
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"%s\" n'est pas un nom de projet correct.%sVeuillez en choisir un autre (par exemple : project1.lpi)"

#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
#, object-pascal-format
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s est un %s.%sCette dépendance circulaire n'est pas autorisée."

#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "répertoire non trouvé"

#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Problèmes"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
#, object-pascal-format
msgid "I wonder how you did that. Error in the %s:"
msgstr "Je me demande comment vous avez fait cela. Erreur dans le %s :"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Je me demande comment vous avez fait cela : Erreur dans le répertoire de base :"

#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Historique des sauts"

#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr "Aller à l'erreur"

#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr "Quand une erreur dans les sources se trouve à la complétion d'un identificateur, sauter à elle."

#: lazarusidestrconsts.lisjumptoprocedure
#, object-pascal-format
msgid "Jump to procedure %s"
msgstr "Aller à la procédure %s"

#: lazarusidestrconsts.liskb
#, object-pascal-format
msgid "%s KB"
msgstr "%s KB"

#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Garder"

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Conserver les fichiers convertis ouverts dans l'éditeur"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Tous les fichiers du projet seront ouverts dans l'éditeur après la conversion"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Préserver le nom"

#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr "Maintenir ouvert"

#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep absolute indentation, regardless of the current cursor indentation in the text."
msgstr "Conserver l'indentation absolue sans tenir compte de l'indentation du curseur en cours dans le texte."

#: lazarusidestrconsts.liskeepsubindentation
msgid "Absolute indentation"
msgstr "Indentation absolue"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Préserver et continuer"

#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Clé"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Commandes personnalisées"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Commandes du concepteur"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Commandes de l'inspecteur d'objets"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Touche (ou séquence de deux touches)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Arrêter la création"

#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Ajouter point d'arrêt sur adresse"

#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Ajouter un point d'arrêt code source"

#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Ajouter point de donnée/suivi"

#: lazarusidestrconsts.liskmaddwatch
msgctxt "lazarusidestrconsts.liskmaddwatch"
msgid "Add watch"
msgstr "Ajouter un point de suivi"

#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Construire plusieurs modes"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Créer le programme/projet"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Choisir l'arrangement du clavier"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Classique"

#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Nettoyer et construire"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Fermer le projet"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Éditeur des directives des outils de code"

#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Compiler le projet/programme"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "Configuration \"Build File\""

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Configurer les composants personnalisés"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Aide contextuelle"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Convertir un paquet Delphi en paquet Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Convertir un projet Delphi en projet Lazarus"

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Convertir une unité Delphi en unité Lazarus"

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "Convertir un fichier DFM en LFM"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected components"
msgstr "Copier les composants choisis"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected components"
msgstr "Couper les composants choisis"

#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr "Par défaut adapté à macOS"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Effacer le dernier caractère"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "Fichiers de l'éditeur des différences"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Éditer les modèles de code"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Éditer l'aide contextuelle"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Entourer la sélection"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Évaluer/modifier"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Configuration des outils externes"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Recherche incrémentale"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to bookmark 0"
msgstr "Aller au signet 0"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to bookmark 1"
msgstr "Aller au signet 1"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to bookmark 2"
msgstr "Aller au signet 2"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to bookmark 3"
msgstr "Aller au signet 3"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to bookmark 4"
msgstr "Aller au signet 4"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to bookmark 5"
msgstr "Aller au signet 5"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to bookmark 6"
msgstr "Aller au signet 6"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to bookmark 7"
msgstr "Aller au signet 7"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to bookmark 8"
msgstr "Aller au signet 8"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to bookmark 9"
msgstr "Aller au signet 9"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Aller à l'éditeur de source 1"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Aller à l'éditeur de source 10"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Aller à l'éditeur de source 2"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Aller à l'éditeur de source 3"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Aller à l'éditeur de source 4"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Aller à l'éditeur de source 5"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Aller à l'éditeur de source 6"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Aller à l'éditeur de source 7"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Aller à l'éditeur de source 8"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Aller à l'éditeur de source 9"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Insérer la date et l'heure"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Insérer le nom d'utilisateur"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Inspecter"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Arrangement du clavier"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus default"
msgstr "Lazarus par défaut"

#: lazarusidestrconsts.liskmmacosxapple
msgid "macOS, Apple style"
msgstr "macOS, style Apple"

#: lazarusidestrconsts.liskmmacosxlaz
msgid "macOS, Lazarus style"
msgstr "macOS, style Lazarus"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Nouveau paquet"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Nouveau projet"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Nouveau projet depuis le fichier"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Nouvelle unité"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Note : toutes les touches seront définies avec les valeurs de l'arrangement choisi."

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Ouvrir un fichier paquet"

#: lazarusidestrconsts.liskmopenrecent
msgctxt "lazarusidestrconsts.liskmopenrecent"
msgid "Open Recent"
msgstr "Ouvrir les plus récents"

#: lazarusidestrconsts.liskmopenrecentpackage
msgid "Open recent package"
msgstr "Ouvrir un paquet récent"

#: lazarusidestrconsts.liskmopenrecentproject
msgid "Open recent project"
msgstr "Ouvrir un projet récent"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components"
msgstr "Coller les composants"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Suspendre le programme"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Publier le projet"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Compilation rapide sans édition des liens"

#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Retirer le fichier actif du projet"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Exécuter un programme"

#: lazarusidestrconsts.liskmsaveall
#, fuzzy
#| msgid "SaveAll"
msgctxt "lazarusidestrconsts.liskmsaveall"
msgid "Save All"
msgstr "Tout enregistrer"

#: lazarusidestrconsts.liskmsaveas
#, fuzzy
#| msgid "SaveAs"
msgid "Save As"
msgstr "Enregistrer sous"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Enregistrer le projet"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Enregistrer le projet sous"

#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Sélectionner la fin de la ligne"

#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Sélectionner le début de la ligne"

#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Sélectionner le bas de la page"

#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Sélectionner le haut de la page"

#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Sélectionner le mot à gauche"

#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Sélectionner le mot à droite"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Placer un signet libre"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set bookmark 0"
msgstr "Placer le signet 0"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set bookmark 1"
msgstr "Placer le signet 1"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set bookmark 2"
msgstr "Placer le signet 2"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set bookmark 3"
msgstr "Placer le signet 3"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set bookmark 4"
msgstr "Placer le signet 4"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set bookmark 5"
msgstr "Placer le signet 5"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set bookmark 6"
msgstr "Placer le signet 6"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set bookmark 7"
msgstr "Placer le signet 7"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set bookmark 8"
msgstr "Placer le signet 8"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set bookmark 9"
msgstr "Placer le signet 9"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Arrêter le programme"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Commuter entre l'unité et la fiche"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle bookmark 0"
msgstr "Activer et désactiver le signet 0"

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle bookmark 1"
msgstr "Activer et désactiver le signet 1"

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle bookmark 2"
msgstr "Activer et désactiver le signet 2"

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle bookmark 3"
msgstr "Activer et désactiver lle signet 3"

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle bookmark 4"
msgstr "Activer et désactiver lle signet 4"

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle bookmark 5"
msgstr "Activer et désactiver lle signet 5"

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle bookmark 6"
msgstr "Activer et désactiver lle signet 6"

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle bookmark 7"
msgstr "Activer et désactiver lle signet 7"

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle bookmark 8"
msgstr "Activer et désactiver lle signet 8"

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle bookmark 9"
msgstr "Activer et désactiver lle signet 9"

#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Afficher l'assembleur"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Afficher les points d'arrêt"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Afficher la pile d'appels"

#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Commuter la vue du navigateur de code"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Commuter la vue de l'explorateur de code"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Commuter la vue de la palette des composants"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Afficher le journal d'événements du débogueur"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Afficher la sortie du débogueur"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Commuter la vue de l'éditeur de documentation"

#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Voir l'historique"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Commuter la vue des boutons rapides de l'EDI"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Afficher les variables locales"

#: lazarusidestrconsts.liskmtoggleviewmemviewer
msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer"
msgid "View Mem viewer"
msgstr "Afficher le visualiseur de mémoire"

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Commuter la vue des messages"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Commuter la vue de l'inspecteur d'objets"

#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr "Afficher l'entrée et la sortie de la console"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Afficher les registres"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Commuter la vue des résultats de recherche"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Commuter la vue de l'éditeur de source"

#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Voir les tâches (threads)"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Afficher les points de suivi"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Voir l'historique des sauts"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Afficher les options du projet"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Afficher les codes sources du projet"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Afficher les informations d'unité"

#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr "Dernier ouvert"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Lancement de l'application incorrecte"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Lancement de la ligne de commande de la cible"

#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Lazarus par défaut"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Répertoire de Lazarus"

#: lazarusidestrconsts.lislazarusdirhint
#, object-pascal-format
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
msgstr "Sources de Lazarus. Ce chemin est relatif au répertoire de configuration primaire (%s)."

#: lazarusidestrconsts.lislazarusdiroverride
msgid "Directory to be used as a basedirectory."
msgstr "Répertoire à utiliser comme un répertoire de base."

#: lazarusidestrconsts.lislazaruseditorv
#, object-pascal-format
msgid "Lazarus IDE v%s"
msgstr "EDI Lazarus v%s"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "EDI Lazarus"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Identificateur de langue de Lazarus (par exemple : fr, en, de)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Nom de langue de Lazarus (par exemple : anglais, allemand)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [options] <ficher-projet>"

#: lazarusidestrconsts.lislazbuild
msgid "lazbuild"
msgstr "lazbuild"

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Choisir le répertoire de sortie pour l'exécutable de l'EDI "

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Êtes-vous sûr de vouloir supprimer ce profil de construction ?"

#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Créer plusieurs modes"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Paramètres communs"

#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Confirmer avant la création"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Confirmer la suppression"

#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "Débogage de l'EDI"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Définitions"

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Définitions sans -d"

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Éditer les définitions"

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Modifier la liste des définitions qui peuvent être utilisées par n'importe quel profil"

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Erreur d'écriture de fichier"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
#, object-pascal-format
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild n'est pas interactif, abandon immédiat."

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Gérer le profils de création"

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Gérer les profils"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Nom du profil actif"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Ajouter un nouveau profil"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Les options courantes de création seront associées à :"

#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "EDI normal"

#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "EDI optimisé"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Options :"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Options passées au compilateur"

#: lazarusidestrconsts.lislazbuildoptionssyntax
msgid "lazbuild [options] <project/package filename or package name>"
msgstr "lazbuild [options] <nom de fichier du projet/paquet ou nom du paquet>"

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Profil à créer"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Renommer le profil"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Nouveau nom du profil :"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Redémarrer après la création de l'EDI"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Redémarrer Lazarus automatiquement après la création de L'EDI (n'a aucun effet quand on crée d'autres parties)"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Sélectionner les profils à créer"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Afficher une boîte de dialogue de confirmation quand la création est lancée directement depuis le menu Outils"

#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Afficher les options et les définitions pour la ligne de commande"

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Processeur cible :"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Répertoire cible :"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Système d'exploitation cible :"

#: lazarusidestrconsts.lislazbuildunabletowritefile
#, object-pascal-format
msgid "Unable to write file \"%s\":%s"
msgstr "Impossible d'écrire le fichier \"%s\" : %s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Mise à jour de revision.inc"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Mettre à jour les informations de révision dans le dialogue \"À propos de Lazarus\""

#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Nettoyer + Tout créer"

#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Version de Lazarus (par exemple : 1.2.4)"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "Type de composant graphique LCL"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Ajouter un lien à hérité"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Copier depuis hérité"

#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
#, object-pascal-format
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s n'a pas de chemin de FPDoc correct.%sLa création du fichier FPDoc pour %s est impossible"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Déplacer les entrées vers hérité"

#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Pas de chemin correct vers FPDoc"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, object-pascal-format
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "L'unité %s n'appartient à aucun paquet ou projet. %sVeuillez ajouter l'unité à un paquet ou à un projet. %s Impossible de créer le fichier \"fpdoc\"."

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Gauche"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "L'espace de bordure gauche. Cette valeur est ajoutée à la base de l'espace de bordure et employée pour l'espace à gauche du contrôle."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Ancrage à gauche"

#: lazarusidestrconsts.lisleftgutter
msgctxt "lazarusidestrconsts.lisleftgutter"
msgid "Left"
msgstr "Gauche"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Il s'agit du contrôle frère auquel le côté gauche est ancré. Le laisser vide pour l'ancrer au parent comme le ferait Delphi (BorderSpacing et ReferenceSide n'importent pas)."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Côtés gauches"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Espacement gauche égal"

#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Moins"

#: lazarusidestrconsts.lislevels
msgctxt "lazarusidestrconsts.lislevels"
msgid "Levels"
msgstr "Niveaux"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "Fichier LFM"

#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "Le fichier LFM contient des propriétés/classes inconnues qui n'existent pas dans la LCL. Elles peuvent être remplacées ou supprimées."

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Fichier LFM corrompu"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "Fichier LFM correct"

#: lazarusidestrconsts.lislgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"[Seule la version anglaise est valable.]\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "chemin des bibliothèques"

#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
msgstr "Une bibliothèque partagée Free Pascal (.dll sous Windows, .so sous Linux, .dylib sous macOS)."

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Lien :"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "options de l'éditeur de liens"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Lier la cible"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "liste de toutes les valeurs de cas"

#: lazarusidestrconsts.lisloadingfailed
#, object-pascal-format
msgid "Loading %s failed."
msgstr "Le chargement de%s a échoué."

#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Charger la macro depuis"

#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr "&Local"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "chaîne en minuscules"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter."
msgstr "Chaîne de caractères en minuscules donnée en paramètre."

#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
msgid "Maximize compatibility of project files (LPI and LPS)"
msgstr "Maximiser la compatibilité des fichiers de projet (LPI et LPS)"

#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
msgstr "Vérifiez ceci si vous souhaitez ouvrir votre projet avec les versions Lazarus (2.0 et plus) héritées."

#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
msgid "Maximize compatibility of package file (LPK)"
msgstr "Maximiser la compatibilité du fichier de paquet (LPK)"

#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
msgstr "Vérifiez ceci si vous souhaitez ouvrir votre paquet avec les versions Lazarus (2.0 et plus) héritées."

#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
#, object-pascal-format
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "lpk a disparu du disque. Utilisation de %s comme alternative"

#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "lpk est absent"

#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr "Fichiers d'inclusion des ressources Lazarus (.lrs)"

#: lazarusidestrconsts.lismacpreferences
msgid "Preferences..."
msgstr "Préférences..."

#: lazarusidestrconsts.lismacro
#, object-pascal-format
msgid "Macro %s"
msgstr "Macro %s"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Entrer les données"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Entrer les paramètres d'exécution"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "L'unité principale a une clause uses contenant toutes les unités du projet"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "L'unité principale est un code source Pascal"

#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr "Supposer du code Pascal même si le fichier ne finit pas par .pas ou .pp."

#: lazarusidestrconsts.lismajorchangesdetected
msgid "Major changes detected"
msgstr "Changements majeurs détectés"

#: lazarusidestrconsts.lismakecurrent
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "En cours"

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Créer un exécutable"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make introuvable"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Construire une chaîne ressource"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Ajouter à la section"

#: lazarusidestrconsts.lismakeresstrchooseanothername
#, object-pascal-format
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "La chaîne ressource \"%s\" existe déjà %sVeuillez choisir un autre nom.%sUtilisez Ignorer pour l'ajouter quand même."

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Options de conversion"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Identificateur personnalisé"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Identificateur"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Longueur d'identificateur :"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Préfixe d'identificateur :"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Insérer par ordre alphabétique"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Insérer en tenant compte du contexte"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Section resourcestring incorrecte"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Veuillez choisir une section resourcestring dans la liste."

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "La chaîne ressource existe déjà"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Section resourcestring :"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Prévisualisation du code source"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Constante chaîne dans le code source"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Chaînes avec la même valeur :"

#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr "Vérifiez que tous les fichiers ppu du paquet soient présents dans le répertoire de sortie."

#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Gérer les éditeurs de source..."

#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr "Nombre maximum de tâches à compiler en parallèle. Le nombre par défaut est 0, ce qui correspond à la recherche du nombre de cœurs du système."

#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
#, object-pascal-format
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr "Nombre maximum de processus parallèles - 0 signifie \"par défaut\" (%s)"

#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
#, object-pascal-format
msgid "%s Maybe you have to recompile the package."
msgstr "%s Peut-être devrez-vous recompiler le paquet."

#: lazarusidestrconsts.lismb
#, object-pascal-format
msgid "%s MB"
msgstr "%s MB"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Arrêter la création"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "À propos de FPC"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Ajouter un point d'&arrêt"

#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Ajouter le fichier actif au paquet..."

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Ajouter un point de saut à l'historique"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Ajouter le fichier de l'éditeur au projet"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Ajouter un point de &suivi..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Couper les lignes dans la sélection"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Créer le fichier"

#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Créer Lazarus avec le profil en cours"

#: lazarusidestrconsts.lismenubuildlazarusprof
#, object-pascal-format
msgid "Build Lazarus with Profile: %s"
msgstr "Créer Lazarus avec le profil : %s"

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "Vérifier le fichier LFM dans l'éditeur"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Nettoyer un répertoire..."

#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Nettoyer et construire..."

#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "&Fermer le fichier édité"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Fermer le projet"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "Éditeur des définitions des outils de code..."

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Commenter la sélection"

#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Comparer les fichiers..."

#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr "Compiler plusieurs modes..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Compléter le code"

#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr "Compléter le code (avec dialogue)"

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Configurer Créer+Exécuter le fichier..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Configurer les composants personnalisés..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Configurer les outils externes..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Configurer la construction de Lazarus..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Aide contextuelle"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Convertir un paquet Delphi en paquet Lazarus..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Convertir un projet Delphi en projet Lazarus..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Convertir une unité Delphi en unité Lazarus..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to LFM ..."
msgstr "Convertir un fichier binaire DFM en texte LFM..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Convertir le codage de projets/paquets..."

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Fenêtres de débogage"

#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Conversion Delphi"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Éditer"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Modèles de code..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Éditer l'aide contextuelle"

#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Installer/désinstaller des paquets..."

#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
#, object-pascal-format
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr "La touche d'accélération (&&) \"%s\" doit être changée"

#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr "Ajouter un nouvel élément au-dessus de l'élément choisi"

#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr "Ajouter un nouvel élément après l'élément choisi"

#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr "Ajouter un nouvel élément avant l'élément choisi"

#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr "Ajouter un nouvel élément sous l'élément choisi"

#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr "Ajouter un sous-menu à droite de l'élément sélectionné"

#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr "Ajouter un sous-menu sous l'élément sélectionné"

#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr "Ajouter depuis un modèle..."

#: lazarusidestrconsts.lismenueditoraddiconfroms
#, object-pascal-format
msgid "Add icon from %s"
msgstr "Ajout d'une icône depuis %s"

#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr "Ajouter une &icône de liste d'images"

#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr "Ajouter un élément au menu"

#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr "&Ajouter un nouvel élément au-dessus"

#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr "Ajouter un nouv&el élément après"

#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr "&Ajouter un nouvel élément avant"

#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr "Ajouter un nouv&el élément dessous"

#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr "Ajouter un gestionnaire &OnClick"

#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr "Faire &suivre d'un séparateur"

#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr "Faire &précéder d'un séparateur"

#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr "Ajouter un sous-menu"

#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr "Ajouter un &sous-menu au-dessous"

#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr "Ajouter un &sous-menu à droite"

#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
#, object-pascal-format
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr "Un nouveau modèle de menu décrit comme \"%s\" a été enregistré sur la base de %s, avec %d sous-éléments"

#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr "É&diter,Menu d'édition de base,Dé&faire,Ctrl+Z,&Répéter,,-,,&Tout sélectionner,Ctrl+A,Co&uper,Ctrl+X,C&opier,Ctrl+C,Co&ller,Ctrl+V,Collage &spécial,,-,,C&hercher,,R&emplacer,,&Aller  à...,,"

#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr "&Fichier,Menu fichier de base,&Nouveau,,&Ouvrir...,,&Enregistrer,,Enregistrer &sous...,,-,,&Imprimer,,Pa&ramètres de l'impression...,,-,,&Quitter,,"

#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr "&Aide,Menu d'aide de base,&Contenu de l'aide,F1,&Index de l'aide,,Aide en li&gne,,-,,Information sur la &licence,,Re&cherche d'une mise à jour,,-,,&À propos,,"

#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr "&Fenêtre,Menu de base des fenêtres,&Nouvelle fenêtre,,&Tuiles,,&Cascade,,Tout &arranger,,-,,Cac&her,,&Montrer,,"

#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr "Légende"

#: lazarusidestrconsts.lismenueditorcaptioneditemss
#, object-pascal-format
msgid "Captioned items: %s"
msgstr "Éléments avec légende : %s"

#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr "La légende ne doit pas être en blanc"

#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
#, object-pascal-format
msgid "Change conflicting accelerator \"%s\""
msgstr "Modifier l'accélérateur \"%s\" en conflit"

#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr "Modifier l'&icône de liste d'images"

#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
#, object-pascal-format
msgid "Change %s for %s"
msgstr "Changer %s en %s"

#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
#, object-pascal-format
msgid "Change shortcut conflict \"%s\""
msgstr "Modifier le raccourci \"%s\" en conflit"

#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
#, object-pascal-format
msgid "Change the shortCut for %s"
msgstr "Modifier le raccourci pour %s"

#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
#, object-pascal-format
msgid "Change the shortCutKey2 for %s"
msgstr "Modifier le raccourci n°2 pour %s"

#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr "Choisir le modèle à supprimer"

#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr "Choisir le modèle à insérer"

#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr "Cliquez sur un élément non grisé pour éditer ce raccourci ou sur l'en-tête pour trier cette colonne"

#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr "Le composant est d'une espèce inattendue"

#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr "Le composant ne porte pas de nom"

#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr "<résolution de conflit effectuée>"

#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
#, object-pascal-format
msgid "Conflicts found initially: %d"
msgstr "Conflits trouvés initialement :%d"

#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
#, object-pascal-format
msgid "Deepest nested menu level: %s"
msgstr "Niveau de profondeur de menu maximum : %s"

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "&Delete item"
msgstr "Supprimer l'élément"

#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr "&Supprimer le modèle de menu..."

#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr "Supprimer le modèle de menu sauvegardé"

#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr "Supprimer le modèle de menu choisi"

#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr "Voulez-vous supprimer cet élément et ses sous-éléments ?"

#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr "Afficher l'aperçu en tant que &menu surgissant"

#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr "Éditer la &légende"

#: lazarusidestrconsts.lismenueditoreditingcaptionofs
#, object-pascal-format
msgid "Editing Caption of %s"
msgstr "Édition de la légende de %s"

#: lazarusidestrconsts.lismenueditoreditingsdots
#, object-pascal-format
msgid "To resolve conflict edit %s.%s"
msgstr "Pour résoudre le conflit, éditer %s.%s"

#: lazarusidestrconsts.lismenueditoreditingsfors
#, object-pascal-format
msgid "Editing %s for %s"
msgstr "Édition de %s pour %s"

#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
#, object-pascal-format
msgid "Editing %s.%s - no menuitem selected"
msgstr "Édition de %s.%s - pas d'élément de menu choisi"

#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr "Entrez un &description de menu :"

#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
#, object-pascal-format
msgid "Enter a new ShortCut for %s"
msgstr "Entrez un nouveau raccourci pour %s"

#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
#, object-pascal-format
msgid "Enter a new ShortCutKey2 for %s"
msgstr "Entrez un nouveau raccourci n°2 pour %s"

#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr "Modèles sauvegardés"

#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr "Conflit de raccourci ultérieur"

#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr "Obtenir de l'aide pour cet éditeur"

#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr "&Touche d'accroche"

#: lazarusidestrconsts.lismenueditorgroupindexd
#, object-pascal-format
msgid "GroupIndex: %d"
msgstr "Index de groupe : %d"

#: lazarusidestrconsts.lismenueditorgroupindexvaluess
#, object-pascal-format
msgid "Values in use: %s"
msgstr "Valeur(s) utilisées : %s"

#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr "Description inadéquate"

#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
#, object-pascal-format
msgid "Insert menu template into root of %s"
msgstr "Insérez le modèle de menu dans la racine de %s"

#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr "Insérer le modèle de menu choisi"

#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr "n'est pas assigné"

#: lazarusidestrconsts.lismenueditoritemswithicons
#, object-pascal-format
msgid "Items with icon: %s"
msgstr "Éléments avec icône : %s"

#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
#, object-pascal-format
msgid "List shortcuts and &accelerators for %s ..."
msgstr "Lister les raccourcis et les accélérateurs pour %s..."

#: lazarusidestrconsts.lismenueditorlistshortcutsfors
#, object-pascal-format
msgid "List shortcuts for %s ..."
msgstr "Lister les raccourcis pour %s..."

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Éditeur de menu"

#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr "Actions d'éléments de menu"

#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
#, object-pascal-format
msgid "Menuitem shortcut conflicts in %s"
msgstr "Conflits de raccourcis d'éléments de menu dans %s"

#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr "Déplacer l'élément &vers le bas"

#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr "Déplacer l'élément vers la &gauche"

#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr "Déplacer l'élément vers la &droite"

#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr "Déplacer l'élément vers le &haut"

#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Déplacer l'élément choisi vers le bas"

#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr "Déplacer l'élément choisi vers la gauche"

#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr "Déplacer l'élément choisi vers la droite"

#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Déplacer l'élément choisi vers le haut"

#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr "n/a"

#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr "(aucun menu choisi)"

#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr "<aucun>"

#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr "< aucun >, <aucun>"

#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr "<aucun conflit de raccourcis>"

#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr "Pas de modèles utilisateurs sauvegardés"

#: lazarusidestrconsts.lismenueditorpickaniconfroms
#, object-pascal-format
msgid "Pick an icon from %s"
msgstr "Ajout d'une icône depuis %s"

#: lazarusidestrconsts.lismenueditorpopupassignmentss
#, object-pascal-format
msgid "Popup assignments: %s"
msgstr "Affectations de menus surgissants : %s"

#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr "Élément de bouton radio"

#: lazarusidestrconsts.lismenueditorremainingconflictss
#, object-pascal-format
msgid "Remaining conflicts: %s"
msgstr "Conflits non résolus : %s"

#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr "Supp&rimer tous les séparateurs"

#: lazarusidestrconsts.lismenueditorresolvedconflictss
#, object-pascal-format
msgid "Resolved conflicts: %s"
msgstr "Conflits résolus : %s"

#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr "Résoudre le conflit sélectionné"

#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr "&Résoudre les conflits de raccourcis..."

#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr "Modèles sauvegardés"

#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr "&Enregistrer le menu comme modèle..."

#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr "Sauvegarder le menu en tant que modèle"

#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr "Sauvegarder le menu en tant que modèle pour une utilisation ultérieure"

#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr "Sauvegarder le menu montré en tant que nouveau modèle"

#: lazarusidestrconsts.lismenueditorsconflictswiths
#, object-pascal-format
msgid "%s conflicts with %s"
msgstr "%s est en conflit avec %s"

#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr "Sé&parateurs"

#: lazarusidestrconsts.lismenueditorshortcutitemss
#, object-pascal-format
msgid "Shortcut items: %s"
msgstr "Éléments de raccourcis : %s"

#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr "Raccourci non encore modifié"

#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr "Raccourcis"

#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr "Ra&ccourcis"

#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr "Raccourcis et touches d'accélération"

#: lazarusidestrconsts.lismenueditorshortcutsd
#, object-pascal-format
msgid "Shortcuts (%d)"
msgstr "Raccourcis (%d)"

#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
#, object-pascal-format
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr "Raccourcis (%d) et touches d'accélération (%d)"

#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr "Raccourci,Propriété source"

#: lazarusidestrconsts.lismenueditorshortcutsusedins
#, object-pascal-format
msgid "Shortcuts used in %s"
msgstr "Raccourcis utilisés dans %s"

#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
#, object-pascal-format
msgid "Shortcuts used in %s (%d)"
msgstr "Raccourcis utilisés dans %s (%d)"

#: lazarusidestrconsts.lismenueditorsins
#, object-pascal-format
msgid "\"%s\" in %s"
msgstr "\"%s\" dans %s"

#: lazarusidestrconsts.lismenueditorsisalreadyinuse
#, object-pascal-format
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut."
msgstr ""
"\"%s\" est déjà utilisé dans %s comme raccourci.\n"
"Veuillez essayer un raccourci différent."

#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
#, object-pascal-format
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr "Veuillez développer : \"%s\" n'est pas une description suffisante"

#: lazarusidestrconsts.lismenueditorsshortcuts
#, object-pascal-format
msgid "%s: Shortcuts"
msgstr "%s : Raccourcis"

#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
#, object-pascal-format
msgid "%s: Shortcuts and accelerator keys"
msgstr "%s : Raccourcis et touches d'accélération"

#: lazarusidestrconsts.lismenueditorsssonclicks
#, object-pascal-format
msgid "%s.%s.%s - OnClick: %s"
msgstr "%s.%s.%s - OnClick : %s"

#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr "Modèles standard"

#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr "Description de modèle :"

#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr "&Modèles"

#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr "Modèle enregistré"

#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available."
msgstr ""
"Il n'y a pas de modèles de menu sauvegardés par l'utilisateur.\n"
"\n"
"Seuls les modèles standard sont disponibles."

#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
#, object-pascal-format
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr "TSCList.GetScanListCompName : index %d incorrect pour FScanList"

#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
#, object-pascal-format
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict"
msgstr ""
"Vous devez modifier le raccourci depuis %s\n"
"afin d'éviter un conflit"

#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr "Vous devez saisir du texte pour la légende"

#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Entourer d'un $IFDEF..."

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Entourer la sélection..."

#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "É&valuer/Modifier..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Extraire la procédure..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Fichier"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Chercher"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Chercher..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Chercher l'autre extrémité du bloc de code"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Chercher le début du bloc de code"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Rechercher la déclaration sous le curseur"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Chercher les références à l'identificateur..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Chercher dans les &fichiers..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Chercher l'occurrence &suivante"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Chercher l'occurrence &précédente"

#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Chercher les références de l'unité utilisée"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Options..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Aller à la directive Include"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Aller à la ligne..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Deviner les IFDEF/ENDIF mal placés"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Deviner les blocs non terminés"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Aide"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "Cœur de l'EDI"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Recherche incrémentale"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Indenter la sélection"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Entrée ChangeLog"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Insérer depuis la table de caractères..."

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "Insérer un mot-clé CVS"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Date et heure courantes"

#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Insérer le nom de fichier complet..."

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Général"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "Notice GPL"

#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "Notice GPL (traduite)"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "Notice LGPL"

#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "Notice LGPL (traduite)"

#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "Notice MIT"

#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "Notice MIT (traduite)"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Notice modifiée LGPL"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Notice LGPL modifiée (traduite)"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Utilisateur en cours"

#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "&Inspecter..."

#: lazarusidestrconsts.lismenujumpback
msgctxt "lazarusidestrconsts.lismenujumpback"
msgid "Jump Back"
msgstr "Saut vers l'arrière"

#: lazarusidestrconsts.lismenujumpforward
msgctxt "lazarusidestrconsts.lismenujumpforward"
msgid "Jump Forward"
msgstr "Saut vers l'avant"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Aller à"

#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Aller à l'implémentation"

#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr "Aller à la clause uses de l'implémentation"

#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr "Allez à Initialization"

#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr "Aller à Interface"

#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr "Aller à la clause uses de l'interface"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Aller au signet suivant"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Aller à l'erreur suivante"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Aller au signet précédent"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Aller à l'erreur précédente"

#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr "Aller au début de la procédure"

#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr "Aller à l'entête de la procédure"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Sélection en minuscules"

#: lazarusidestrconsts.lismenumacrolistview
msgctxt "lazarusidestrconsts.lismenumacrolistview"
msgid "Editor Macros"
msgstr "Macros de l'éditeur"

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Construire une chaîne ressource..."

#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr "Collage multiple..."

#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Nouveau composant"

#: lazarusidestrconsts.lismenunewcustom
#, object-pascal-format
msgid "New %s"
msgstr "Nouveau %s"

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Nouvelle fiche"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Nouveau..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Nouveau paquet..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Nouveau projet..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Nouveau projet depuis le fichier..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Nouvelle unité"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Aide en ligne"

#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Ouvrir..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "Ouvrir le fichier sous le curseur"

#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr "Ouvrir le dossier..."

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Ouvrir un paquet chargé..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Ouvrir un fichier de paquet (.lpk)..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Ouvrir le paquet de l'unité courante"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Ouvrir un projet..."

#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "&Récemment ouverts"

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Ouvrir un paquet récent"

#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Ouvrir un projet récent"

#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr "Ouvrir l'unité..."

#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "Pa&quet"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Graphe des paquets"

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Liens de paquet..."

#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Coller depuis le presse-papiers"

#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Nouveau composant paquet"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Liste des routines..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projet"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Inspecteur de projet"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Options du projet..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "&Exécuter"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Publier le projet..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Compilation rapide"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Vérification rapide de la syntaxe"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Vérification rapide de la syntaxe OK"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Retirer du projet..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Renommer l'identificateur..."

#: lazarusidestrconsts.lismenurenamelowercase
msgid "Rename Unit Files to LowerCase ..."
msgstr "Renommer les fichiers d'unité en minuscules..."

#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Signaler un bogue"

#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr "Réenregistrement des fiches avec i18n activé"

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Reparcourir le répertoire des codes sources de FPC"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Réinitialiser le débogueur"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Restaurer"

#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "E&xécuter"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Exécuter le fichier"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "&Paramètres d'exécution..."

#: lazarusidestrconsts.lismenuruntocursor
msgctxt "lazarusidestrconsts.lismenuruntocursor"
msgid "Run to Cursor"
msgstr "Exécuter jusqu'au curseur"

#: lazarusidestrconsts.lismenurunwithdebugging
msgid "Run with Debugging"
msgstr "Exécuter avec débogage"

#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr "Exécuter sans débogage"

#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Enregistrer"

#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Enregistrer &sous..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Enregistrer le projet"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Enregistrer le projet sous..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Chercher"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Sélectionner"

#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Tout sélectionner"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Sélectionner le bloc de code"

#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Sélectionner la ligne"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Sélectionner le paragraphe"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Sélection jusqu'à l'accolade"

#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Sélectionner un mot"

#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Placer un signet libre"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "Montrer le &point d'exécution"

#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr "Astuce intelligente sensible au contexte"

#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Trier la sélection..."

#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "S&ource"

#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Inverser la casse dans la sélection"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Remplacer les tabulations par des espaces dans la sélection"

#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "À propos"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Commuter les commentaires de la sélection"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "&Outils"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Décommenter la sélection"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Désindenter la sélection"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Sélection en majuscules"

#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Ajouter une unité à la clause uses..."

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Voir"

#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Éditeur d'ancres"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Navigateur de code"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Explorateur de code"

#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Palette des composants"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Composants"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Journal des événements"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Sortie du débogueur"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Fiches..."

#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Historique"

#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Historique des déplacements"

#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Variables locales"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Messages"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Inspecteur d'objets"

#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "&Voir le code source du projet"

#: lazarusidestrconsts.lismenuviewpseudoterminal
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr "Entrée et sortie de la console"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Registres"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Navigateur de restrictions"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Résultats de la recherche"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Éditeur de source"

#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Ordre de tabulation"

#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Tâches"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Commuter Fiche/Unité"

#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Dépendances de l'unité"

#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Informations sur l'unité..."

#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Unités..."

#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Points de suivi"

#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Ce qu'il faut construire"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "Fe&nêtre"

#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Autres onglets"

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Éditeur des messages"

#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Fenêtre des messages"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Classe de la méthode introuvable"

#: lazarusidestrconsts.lismissingdirectory
#, object-pascal-format
msgid "missing directory \"%s\""
msgstr "répertoire manquant \"%s\""

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Événements manquants"

#: lazarusidestrconsts.lismissingexecutable
#, object-pascal-format
msgid "missing executable \"%s\""
msgstr "exécutable manquant \"%s\""

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Identificateurs manquants"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Paquets manquants"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Vous devez choisir :"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Mettre en commentaires"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Pour Delphi seulement"

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Mettre en commentaires les unités sélectionnées."

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Utiliser les unités uniquement pour Delphi."

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Rechercher les unités. Les chemins trouvés sont ajoutés aux paramètres du projet."

#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Leave these units in uses sections as they are."
msgstr "3) Laisser ces unités telles quelles dans les sections uses."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Recherche du chemin de l'unité"

#: lazarusidestrconsts.lismissingunitsskip
msgctxt "lazarusidestrconsts.lismissingunitsskip"
msgid "Skip"
msgstr "Ignorer"

#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
"<description>\n"
"\n"
"Copyright (c) <année> <détenteurs du copyright>\n"
"\n"
"[La version anglaise a seule une valeur légale.]\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."

#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Ajouts et remplacements"

#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Ajoute des options personnalisées :"

#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Ajouter des options FPC arbitraires, par exemple : -O1 -ghtl -dFlag"

#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Appliquer à tous les paquets."

#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Appliquer à tous les paquets et projets."

#: lazarusidestrconsts.lismmapplytoallpackagesmatching
#, object-pascal-format
msgid "Apply to all packages matching name \"%s\""
msgstr "Appliquer à tous les paquets dont le nom correspond à \"%s\""

#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Appliquer au projet."

#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Créer un nouveau groupe d'options"

#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Option personnalisée"

#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "Supprimer l'option ou la cible choisie"

#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "N'ajoute pas les options de l'utilisateur :"

#: lazarusidestrconsts.lismmdoesnothaveidemacro
#, object-pascal-format
msgid "Does not have IDE Macro %s:=%s"
msgstr "Ne contient pas de macro EDI %s:=%s"

#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "Ne redéfinit pas le répertoire de sortie (-FU)"

#: lazarusidestrconsts.lismmexcludeallpackagesmatching
#, object-pascal-format
msgid "Exclude all packages matching name \"%s\""
msgstr "Exclure tous les paquets dont le nom correspond à \"%s\""

#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
#, object-pascal-format
msgid "expected \":=\" after macro name but found \"%s\""
msgstr "\":=\" attendu après le nom de la macro, mais \"%s\" trouvé"

#: lazarusidestrconsts.lismmexpectedmacronamebutfound
#, object-pascal-format
msgid "expected macro name but found \"%s\""
msgstr "nom de macro attendu, mais \"%s\" trouvé"

#: lazarusidestrconsts.lismmfromto
#, object-pascal-format
msgid "From %s to %s"
msgstr "De %s à %s"

#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "Macro EDI"

#: lazarusidestrconsts.lismmidemacro2
#, object-pascal-format
msgid "IDE Macro %s:=%s"
msgstr "Macro EDI %s:=%s"

#: lazarusidestrconsts.lismminvalidcharacterat
#, object-pascal-format
msgid "invalid character \"%s\" at %s"
msgstr "caractère \"%s\" incorrect en %s"

#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
#, object-pascal-format
msgid "invalid character in macro value \"%s\""
msgstr "caractère incorrect dans la valeur de macro \"%s\""

#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "nom de macro manquant"

#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Déplacer l'élément choisi vers le bas"

#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Déplacer l'élément choisi vers le haut"

#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Nouvelle cible"

#: lazarusidestrconsts.lismmoverrideoutdirfu
#, object-pascal-format
msgid "Override OutDir (-FU): %s"
msgstr "Redéfinir le répertoire de sortie (-FU) : %s"

#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Redéfinir le répertoire de sortie (-FU)"

#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "Redéfinir le répertoire de sortie -FU de la cible"

#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Refaire la dernière correction pour cette grille"

#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Définir une macro EDI (par exemple : LCLWidgetType:=win32)"

#: lazarusidestrconsts.lismmsets
#, object-pascal-format
msgid "Set \"%s\""
msgstr "Définir \"%s\""

#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Stocké dans l'EDI (environmentoptions.xml)"

#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Stocké dans le projet (.lpi)"

#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Stocké dans la session du projet (.lps)"

#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Cibles : "

#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Annuler le dernier changement dans cette grille"

#: lazarusidestrconsts.lismmvalues
#, object-pascal-format
msgid "Value \"%s\""
msgstr "Valeur \"%s\""

#: lazarusidestrconsts.lismmwas
#, object-pascal-format
msgid "(was \"%s\")"
msgstr "(valait \"%s\")"

#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr "Le changement d'ensemble graphique (WidgetSet) n'est possible qu'avec les projets LCL"

#: lazarusidestrconsts.lismode
#, object-pascal-format
msgid ", Mode: %s"
msgstr ", Mode : %s"

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"[Seule la version anglaise est valable.]\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."

#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Plus"

#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Plus"

#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Déplacer"

#: lazarusidestrconsts.lismovedown
msgid "Move Down"
msgstr "Déplacer vers le bas"

#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Déplacer les fichiers"

#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "Faut-il déplacer les fichiers ?"

#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, object-pascal-format
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Voulez-vous déplacer %s fichier(s) de %s vers le répertoire%s%s%sde %s ?"

#: lazarusidestrconsts.lismoveonepositiondown
#, object-pascal-format
msgid "Move \"%s\" one position down"
msgstr "Déplacer \"%s\" une position plus bas"

#: lazarusidestrconsts.lismoveonepositionup
#, object-pascal-format
msgid "Move \"%s\" one position up"
msgstr "Déplacer \"%s\" une position plus haut"

#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "Faut-il déplacer ou copier les fichiers ?"

#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
#, object-pascal-format
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Voulez-vous déplacer ou copier %s fichier(s) de %s vers le répertoire%s%s%sde %s ?"

#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Déplacer la page"

#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Déplacer l'élément choisi vers le bas (Ctrl+Bas)"

#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Déplacer l'élément choisi vers le haut (Ctrl+Haut)"

#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Déplacer vers : "

#: lazarusidestrconsts.lismoveup
msgid "Move Up"
msgstr "Déplacer vers le haut"

#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Déplacer ces unités brisera la logique des sections uses. Consultez la fenêtre des messages pour les détails."

#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr "Style C : \" => \\\""

#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr "Échappement des &guillemets"

#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr "Collage multiple"

#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr "Style Pascal : ' => ''"

#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr "&Options de collage"

#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr "A&perçu"

#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr "Texte &après chaque ligne"

#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr "Texte a&vant chaque ligne"

#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr "&Réduire le contenu du presse-papiers"

#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr "Couleurs des messages"

#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr "Les différents répertoires sont séparés par des points-virgules"

#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ", paquets multiples : "

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Enregistrer les messages dans le fichier (*.txt)"

#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Nom"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Conflit de nom"

#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Nom du mode de construction actif"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Nom de la nouvelle procédure"

#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Nouveau"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Nouvelle classe"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Nouvelle application console"

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
#, object-pascal-format
msgid "Create a new editor file.%sChoose a type."
msgstr "Créer un nouveau fichier dans l'éditeur.%sChoisir un type."

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Créer un nouveau fichier texte vide."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
#, object-pascal-format
msgid "Create a new project.%sChoose a type."
msgstr "Créer un nouveau projet.%sChoisir un type."

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
#, object-pascal-format
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Créer un nouveau paquet standard.%sUn paquet est une collection d'unités et de composants."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Créer une nouvelle unité avec un module de données."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Créer une nouvelle unité avec un cadre."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Créer une nouvelle unité avec une fiche LCL."

#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Hériter d'une fiche de projet ou d'un composant"

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Pas d'élément sélectionné"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Veuillez d'abord sélectionner un élément."

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Nouvel encodage :"

#: lazarusidestrconsts.lisnewmacroname
#, object-pascal-format
msgid "Macro %d"
msgstr "Macro %d"

#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Nouveau nom de macro"

#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr "Les implémentations des nouvelles méthodes sont insérées entre les méthodes existantes de cette classe, soit par ordre alphabétique, soit à la fin, ou encore par ordre des déclarations."

#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr "Les nouvelles méthodes et déclarations de membres dans les section class...end sont insérées par ordre alphabétique ou à la fin."

#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Nouvelle page"

#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(nouveau projet)"

#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Nouvelles macros enregistrées. A ne pas sauvegarder"

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "De nouvelles unités sont ajoutées aux clauses uses"

#: lazarusidestrconsts.lisnoautosaveactivedesktop
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
msgstr "L'option 'Sauvegarde automatique du bureau actif' est désactivée, vous devrez enregistrer le bureau actuel manuellement."

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Pas de fichiers de sauvegarde"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Aucun profil n'est sélectionné pour la création."

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Pas de changements"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Aucun code sélectionné"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Aucune option de compilateur héritée."

#: lazarusidestrconsts.lisnofppkgprefix
msgid "empty Free Pascal compiler prefix."
msgstr "préfixe du compilateur Free Pascal vide."

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "pas de conseils"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Pas de fenêtre EDI sélectionnée"

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Pas de fichier LFM"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Aucune macro sélectionnée"

#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr "(pas de message sélectionné)"

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "sans_nom"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "aucun, cliquez pour en choisir un"

#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr "(Aucun sélectionné)"

#: lazarusidestrconsts.lisnonewfilefound
msgid "No new file found"
msgstr "Pas de nouveau fichier trouvé"

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "aucun nœud sélectionné"

#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "Pas de fichier Pascal"

#: lazarusidestrconsts.lisnoprogramfilesfound
#, object-pascal-format
msgid "No program file \"%s\" found."
msgstr "Fichier programme \"%s\" non trouvé."

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Section \"resourcestring\" non trouvée"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Normalement, le filtre est une expression régulière. En syntaxe simple un . est un caractère normal, un * vaut pour toute suite de caractères , un ? vaut pour tout caractère, et la virgule et le point-virgule séparent les solutions de rechange . Par exemple : en syntaxe simple *.pas;*.pp correspond à ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Constante chaîne non trouvée"

#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "N'est pas un paquet de conception"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "N'est pas un paquet d'installation"

#: lazarusidestrconsts.lisnotavalidfppkgprefix
msgid "Free Pascal compiler not found at the given prefix."
msgstr "Compilateur Free Pascal introuvable au préfixe donné."

#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr "Note"

#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Bas"

#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Gauche"

#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Droite"

#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Haut"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "NOTE : Impossible de créer le modèle Define pour les codes sources Free Pascal"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "NOTE : Impossible de créer le modèle Define pour les codes sources Lazarus"

#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "pas de modèle sélectionné"

#: lazarusidestrconsts.lisnothingtodo
msgid "Nothing to do"
msgstr "Rien à faire"

#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "non installé"

#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr "Paquets non installés"

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Pas maintenant"

#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Chargé à présent : "

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Créer un nouveau projet"

#: lazarusidestrconsts.lisnumberoffilestoconvert
#, object-pascal-format
msgid "Number of files to convert: %s"
msgstr "Nombre de fichiers à convertir : %s"

#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr "L'inspecteur d'objets est rendu visible quand des composants sont sélectionnés dans le concepteur de fiche."

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Pascal Objet - par défaut"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "chemin du code objet"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Basculer vers l'onglet des favoris de l'inspecteur d'objets"

#: lazarusidestrconsts.lisofpackage
#, object-pascal-format
msgid " of package %s"
msgstr " du paquet %s"

#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr " de l'inspecteur de projet"

#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Ajouter aux propriétés préférées"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
#, object-pascal-format
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Choisir une classe de base pour la propriété préférée \"%s\"."

#: lazarusidestrconsts.lisoifclassnotfound
#, object-pascal-format
msgid "Class \"%s\" not found."
msgstr "Classe \"%s\" non trouvée."

#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Retirer des propriétés préférées"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "installation auto-dynamique"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "installation auto-statique"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Description : "

#: lazarusidestrconsts.lisoipdescriptiondescription
#, object-pascal-format
msgid "%sDescription:  %s"
msgstr "%sDescription : %s"

#: lazarusidestrconsts.lisoipfilename
#, object-pascal-format
msgid "Filename:  %s"
msgstr "Nom de fichier : %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "installé dynamiquement"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "installé statiquement"

#: lazarusidestrconsts.lisoiplicenselicense
#, object-pascal-format
msgid "%sLicense:  %s"
msgstr "%sLicence :  %s"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "manquant"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "modifié"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Ouvrir le paquet chargé"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Nom du paquet"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Veuillez sélectionner un paquet"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "lecture seule"

#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "État"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, object-pascal-format
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%s Ce paquet est installé, mais le fichier lpk associé est introuvable"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Ancienne classe"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "En cas de saut de ligne (à savoir la touche Entrée)"

#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr "disponible dans le répertoire principal"

#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr "seulement 32 bits"

#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr "Disponible uniquement sur Windows. Exécutez l’outil caché."

#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr "Disponible uniquement sur Windows. Exécutez l’outil dans une nouvelle console."

#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr "Uniquement les messages répondant à cette expression régulière :"

#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr "Uniquement  les messages avec ces ID FPC (séparés par des virgules) :"

#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr "Seulement inscrire les fichiers de paquets Lazarus (.lpk). Ne pas construire."

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Chercher les mots entiers seulement"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Lors du collage depuis le presse-papiers"

#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Ouvrir"

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Ouvrir en tant que fichier XML"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Ouvrir le concepteur de fiche avec l'unité ouverte"

#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr "La fiche est toujours chargée dans le concepteur de fiche quand l'unité de code source est ouverte."

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Ouvrir un fichier existant"

#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Ouvrir un fichier"

#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Ouvrir un fichier"

#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr "Ouvrir le fichier sous le curseur"

#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr "Ouvrir dans le gestionnaire de fichiers"

#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr "Ouvrir le répertoire de destination dans le gestionnaire de fichiers"

#: lazarusidestrconsts.lisopenlfm
#, object-pascal-format
msgid "Open %s"
msgstr "Ouvrir %s"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Voulez-vous ouvrir le paquet ?"

#: lazarusidestrconsts.lisopenpackage2
#, object-pascal-format
msgid "Open package %s"
msgstr "Ouvrir le paquet %s"

#: lazarusidestrconsts.lisopenpackage3
msgid "Open Package"
msgstr "Ouvrir le paquet"

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Ouvrir un fichier paquet"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Voulez-vous ouvrir le projet ?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Ouvrir le projet"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Rouvrir le projet"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Ouvrir un fichier projet"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Ouvrir le fichier en tant que code source normal"

#: lazarusidestrconsts.lisopenthepackage
#, object-pascal-format
msgid "Open the package %s?"
msgstr "Voulez-vous ouvrir le paquet %s ?"

#: lazarusidestrconsts.lisopentheproject
#, object-pascal-format
msgid "Open the project %s?"
msgstr "Voulez-vous ouvrir le projet %s ?"

#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr "Options de l'outil ouvert"

#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr "Ouvrir l'unité"

#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr "Ouvrir URL"

#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Ouvrir XML"

#: lazarusidestrconsts.lisoptions
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Options"

#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr "ignoré"

#: lazarusidestrconsts.lisos
#, object-pascal-format
msgid ", OS: %s"
msgstr ",  : %s"

#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
#, object-pascal-format
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr "un autre chemin des sources du paquet \"%s\" contient le répertoire \"%s\" qui est déjà dans le chemin de recherche de l'unité."

#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
#, object-pascal-format
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr "le répertoire de sortie de %s contient l'unité Pascal \"%s\""

#: lazarusidestrconsts.lisoutputfilenameofproject
msgid "Output filename of project"
msgstr "Fichier de sortie du projet"

#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"."
msgstr "Redéfinir la langue. Pour connaître les valeurs possibles, consultez les fichiers dans le répertoire \"languages\". Exemple : \"--language=fr\"."

#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr "Remplacer les types chaînes des résultats d'une fonction par le premier type d'expression de paramètre"

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml."
msgstr "Redéfinir le compilateur par défaut. Par exemple, ppc386, ppcx64, ppcppc, etc. La valeur par défaut est enregistrée dans environmentoptions.xml."

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "Override the project or IDE build mode."
msgstr "Redéfinir le projet ou le mode de création de l'EDI."

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, object-pascal-format
msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s."
msgstr "Redéfinir le processeur du projet. Par exemple : i386, x86_64, PowerPC, powerpc_64, etc. Par défaut : %s."

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, object-pascal-format
msgid "Override the project operating system. For example: win32 linux. Default: %s."
msgstr "Redéfinit l' du projet. Par exemple : win32, linux. Par défaut : %s."

#: lazarusidestrconsts.lisoverridetheprojectsubtarg
msgid "Override the project subtarget."
msgstr "Remplacer la sous-cible du projet."

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
#, object-pascal-format
msgid "Override the project widgetset. For example: gtk gtk2 qt win32 carbon. Default: %s."
msgstr "Redéfinir l'ensemble graphique du projet. Par exemple : gtk, gtk2, qt, win32, carbon. Par défaut : %s."

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "\"Owner\" est déjà utilisé par TReader/TWrite. Veuillez choisir un autre nom."

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Paquet"

#: lazarusidestrconsts.lispackage2
#, object-pascal-format
msgid "package %s"
msgstr "paquet %s"

#: lazarusidestrconsts.lispackage3
#, object-pascal-format
msgid ", package %s"
msgstr ", paquet %s"

#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Informations concernant le paquet"

#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
#, object-pascal-format
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
msgstr "Le paquet \"%s\" est en conception seulement. Il doit seulement être compilé dans l'EDI et non pas avec les paramètres du projet.%sVeuillez utiliser \"Installer\" ou \"Outils / Construire Lazarus\" pour construire les paquets de l'EDI."

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Le nom du paquet commence par..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Le nom du paquet contient..."

#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr "Le paquet requiert un répertoire de sortie."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Le paquet doit être installé"

#: lazarusidestrconsts.lispackageoption
#, object-pascal-format
msgid "Package \"%s\" Option"
msgstr "Option du paquet \"%s\""

#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Dossiers de sortie du paquet"

#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Dossiers des codes sources du paquet"

#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
#, object-pascal-format
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr "paquets=%s/%s unités=%s/%s identificateurs=%s/%s lignes=%s octets=%s"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "unité du paquet"

#: lazarusidestrconsts.lispage
msgctxt "lazarusidestrconsts.lispage"
msgid "Page"
msgstr "Page"

#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr "Nom de la page"

#: lazarusidestrconsts.lispagenamealreadyexists
#, object-pascal-format
msgid "Page name \"%s\" already exists. Not added."
msgstr "Le nom de page \"%s\" existe déjà. Non ajouté."

#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr "Panique"

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", analysé "

#: lazarusidestrconsts.lisparser
#, object-pascal-format
msgid "parser \"%s\": %s"
msgstr "analyseur \"%s\" : %s"

#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr "Analyseurs :"

#: lazarusidestrconsts.lispassingquiettwotimeswillp
msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler."
msgstr "Passer --quiet deux fois passera -vw-n-h-i-l-d-u-t-p-c-x- au compilateur."

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "coller le contenu du presse-papiers"

#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Coller depuis le presse-papiers."

#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr "Couleurs pastel"

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Chemin"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Parcourir"

#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Supprimer les chemins incorrects"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Descendre le chemin (Ctrl+Bas)"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Monter le chemin (Ctrl+Haut)"

#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Ajouter un nouveau chemin à la liste"

#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Supprimer le chemin sélectionné"

#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Retirer les chemins inexistants (grisés) de la liste"

#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Remplacer le chemin sélectionné par un nouveau chemin"

#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Ajouter le modèle à la liste"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Chemin des modèles"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Chemins de recherche :"

#: lazarusidestrconsts.lispathisnodirectory
msgid "is not a directory"
msgstr "n'est pas un répertoire"

#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "chemin du cache de instantfpc"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Chemin de l'utilitaire Make"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Chemin de l'instance qui a échoué :"

#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Pause"

#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Nettoyer pour utiliser le nom du paquet"

#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Désactiver I18N du LFM"

#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr "Ajouter des fichiers depuis le système"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Ajouter au projet"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Appliquer les changements"

#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr "(disponible en ligne)"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
#, object-pascal-format
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Appeler la procédure %sRegister%s de l'unité sélectionnée"

#: lazarusidestrconsts.lispckeditcheckavailabilityonline
msgid "Check availability online"
msgstr "Vérifier la disponibilité en ligne"

#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Nettoyer les dépendances..."

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Effacer le nom de fichier de dépendance par défaut/préféré"

#: lazarusidestrconsts.lispckeditcommonoptions
msgid "Common"
msgstr "Commun"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Faut-il tout compiler ?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Compiler le paquet"

#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "Créer fpmake.pp"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Créer Makefile"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Propriétés de dépendance"

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit general options"
msgstr "Éditer les options générales"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Propriétés du fichier"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Installer"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Version maximale incorrecte"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Version minimale incorrecte"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Version maximale :"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Version minimale :"

#: lazarusidestrconsts.lispckeditmodified
#, object-pascal-format
msgid "Modified: %s"
msgstr "Modifié : %s"

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Déplacer la dépendance vers le bas"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Déplacer la dépendance vers le haut"

#: lazarusidestrconsts.lispckeditoptionsforpackage
#, object-pascal-format
msgid "Options for Package %s"
msgstr "Options pour le paquet %s"

#: lazarusidestrconsts.lispckeditpackage
#, object-pascal-format
msgid "Package %s"
msgstr "Paquet %s"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, object-pascal-format
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Le paquet \"%s\" a changé.%sVoulez-vous l'enregistrer ?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
#, object-pascal-format
msgid "package %s not saved"
msgstr "paquet %s non enregistré"

#: lazarusidestrconsts.lispckeditpage
#, object-pascal-format
msgid "%s, Page: %s"
msgstr "%s - Page : %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Rajouter la dépendance"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Rajouter le fichier"

#: lazarusidestrconsts.lispckeditreadonly
#, object-pascal-format
msgid "Read Only: %s"
msgstr "Lecture seule : %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Recompiler tout ce qui est requis"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Nettoyer et recompiler"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Faut-il recompiler ceci et tous les paquets requis ?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Plugins référencés"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Référencer l'unité"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Supprimer la dépendance"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, object-pascal-format
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Faut-il retirer la dépendance \"%s\"%sdu paquet \"%s\" ?"

#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Fichiers supprimés"

#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Paquets requis retirés"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Retirer le fichier"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Faut-il retirer le fichier ?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, object-pascal-format
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Faut-il retirer le fichier \"%s\"%sdu paquet \"%s\" ?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Retirer l'élément sélectionné"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Paquets requis"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Enregistrer le paquet"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Enregistrer le nom de fichier comme par défaut pour cette dépendance"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Enregistrer le nom de fichier comme favori pour cette dépendance"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La version maximale \"%s\" n'est pas une version de paquet correcte.%s(exemple correct : 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "La version minimale \"%s\" n'est pas une version de paquet correcte.%s(exemple correct : 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Désinstaller"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Afficher le code source du paquet"

#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "Fondamental : ne peut être désinstallé"

#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Installé(s)"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Installer au prochain démarrage"

#: lazarusidestrconsts.lispckexplstate
#, object-pascal-format
msgid "%sState: "
msgstr "%sÉtat : "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Désinstaller au prochain démarrage (sauf si requis par un paquet installé)"

#: lazarusidestrconsts.lispckexpluninstallpackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Désinstaller le paquet %s"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Ajouter les options aux paquets et projets dépendants"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Ajouter les chemins aux paquets/projets dépendants"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Auteur"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Recréer automatiquement si besoin"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Reconstruction automatique quand on recrée tout"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Personnalisé"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Description/Résumé"

#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Conception"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Conception et exécution"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Intégration à l'EDI"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Inclure"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Type de paquet incorrect"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Bibliothèque"

#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Licence"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Éditeur de liens"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Majeure"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Compilation manuelle (jamais automatiquement)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Mineure"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objet"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Type de paquet"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Services fournis"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Version finale"

#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Exécution"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, object-pascal-format
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Le paquet \"%s\" est marqué pour installation automatique.%sCeci implique qu'il sera installé dans l'EDI. Les paquets d'installation%sdoivent être des paquets de conception."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Ce paquet fournit les mêmes services que les paquets suivants :"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Mettre à jour / reconstruire"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Utilisation"

#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Paquet :"

#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Chemins de recherche pour les fichiers XML FPDoc. Les chemins doivent être séparés par des points-virgules."

#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Afficher les dépendances inutiles"

#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Lorsque la fiche est enregistrée, l'EDI peut stocker toutes les propriétés TTranslateString dans le fichier .po du paquet . Pour cela, vous devez activer I18N pour ce paquet, fournir un répertoire de sortie pour les fichiers po et laisser cette option désactivée."

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Abandon"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Progression"

#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Réduire le répertoire"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Conflit détecté"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Éditer l'unité virtuelle"

#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Développer le répertoire"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Nom de fichier :"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Corriger la casse des fichiers"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Nom de fichier d'unité incorrect"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Nom d'unité incorrect"

#: lazarusidestrconsts.lispemissingfilesofpackage
#, object-pascal-format
msgid "Missing files of package %s"
msgstr "Fichiers manquants du paquet %s"

#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Nouveau fichier absent du chemin d'inclusion"

#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Aucun fichier manquant. Tous les fichiers existent."

#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Supprimer les fichiers"

#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Restaurer le paquet"

#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Enregistrer le paquet sous..."

#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Montrer la hiérarchie des répertoires"

#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Montrer les fichiers manquants"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Trier les fichiers de manière permanente"

#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Trier les fichiers par ordre alphabétique"

#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, object-pascal-format
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "Le fichier \"%s\" n'est pas dans le chemin d'inclusion du paquet. %sVoulez-vous ajouter \"%s\" au chemin d'inclusion ?"

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Nom d'unité :"

#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Utiliser toutes les unités du répertoire"

#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "N'utiliser aucune unité du répertoire"

#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Nettoyer les dépendances du paquet"

#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Mettre à zéro la sélection"

#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Supprimer les dépendances"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, object-pascal-format
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Voulez-vous réellement abandonner les changements concernant le paquet %s et le recharger à partir du fichier ?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Nouvelle unité hors du chemin des unités"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Publier le paquet"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Voulez-vous restaurer le paquet ?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, object-pascal-format
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "Le fichier \"%s\"%s n'est pas actuellement dans le chemin des unités du paquet.%sVoulez-vous ajouter \"%s\" au chemin d'unités ?"

#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr "Davantage de fonctions pour le paquet"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, object-pascal-format
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sAjout d'une nouvelle dépendance pour le paquet %s : paquet %s"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, object-pascal-format
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sAjout d'une nouvelle dépendance pour le projet %s : paquet %s"

#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr "Ajouter l'unité à la clause uses du fichier principal du paquet. Ne désactiver ce comportement que pour les unités qui ne doivent pas être recompilées dans tous les cas."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Unités ambiguës trouvées"

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Paquets installés automatiquement"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
#, object-pascal-format
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sLes deux paquets sont connectés. Soit l'un des paquets utilise l'autre, soit les deux sont utilisés par un troisième."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Dépendance brisée"

#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Références circulaires trouvées"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Faut-il supprimer l'ancien fichier paquet ?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, object-pascal-format
msgid "Delete old package file \"%s\"?"
msgstr "Faut-il supprimer l'ancien fichier paquet \"%s\" ?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
#, object-pascal-format
msgid "Dependency without Owner: %s"
msgstr "Dépendance sans propriétaire : %s"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Erreur de lecture du paquet"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Erreur d'écriture du paquet"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Le fichier est déjà dans le paquet"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Le fichier est dans le projet"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Nom de fichier différent du nom de paquet"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Nom de fichier utilisé par un autre paquet"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Nom de fichier utilisé par un projet"

#: lazarusidestrconsts.lispkgmangfilenotfound
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "Fichier \"%s\" non trouvé."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Fichier non enregistré"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
#, object-pascal-format
msgid "Installing the package %s will automatically install the package:"
msgstr "Installer le paquet %s installera automatiquement le paquet :"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
#, object-pascal-format
msgid "Installing the package %s will automatically install the packages:"
msgstr "Installer le paquet %s installera automatiquement les paquets :"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Extension de fichier incorrecte"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Extension de fichier paquet incorrecte"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Nom de fichier paquet incorrect"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Nom de paquet incorrect"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Nom de paquet incorrect"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, object-pascal-format
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Le chargement du paquet %s remplacera le paquet %s%sdu fichier %s.%sL'ancien paquet est modifié.%sFaut-il enregistrer l'ancien paquet %s ?"

#: lazarusidestrconsts.lispkgmangpackage
#, object-pascal-format
msgid "Package: %s"
msgstr "Paquet : %s"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Conflits entre paquets"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "Le paquet n'est pas un paquet de conception"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Le paquet est requis"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Le nom de paquet existe déjà"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Les paquets doivent avoir l'extension .lpk"

#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Veuillez tout d'abord compiler le paquet."

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Veuillez enregistrer le fichier avant de l'ajouter à un paquet."

#: lazarusidestrconsts.lispkgmangproject
#, object-pascal-format
msgid "Project: %s"
msgstr "Projet : %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Voulez-vous recréer Lazarus ?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Voulez-vous renommer le fichier en minuscules ?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, object-pascal-format
msgid "Replace existing file \"%s\"?"
msgstr "Voulez-vous remplacer le fichier existant \"%s\" ?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Remplacer le fichier"

#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Un ou plusieurs paquets sont introuvables. Voir le graphe des paquets pour les détails."

#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
#, object-pascal-format
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name."
msgstr ""
"Le paquet %s est déjà ouvert dans l'EDI.\n"
"Vous ne pouvez pas sauvegarder un paquet portant le même nom."

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Voulez-vous enregistrer le paquet ?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
#, object-pascal-format
msgid "Save Package %s (*.lpk)"
msgstr "Enregistrer le paquet %s (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, object-pascal-format
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Souhaitez-vous renommer le fichier en minuscules  comme ceci : \"%s\"%s ?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Ignorer ce paquet"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "Le fichier \"%s\"%s est déjà dans le paquet %s."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus package."
msgstr "Le fichier \"%s\" n'est pas un paquet Lazarus."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, object-pascal-format
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "Le nom de fichier \"%s\" ne correspond pas au paquet nommé \"%s\" dans le fichier.%sVoulez-vous changer le nom du paquet en \"%s\"?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, object-pascal-format
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "Le fichier nommé \"%s\" fait partie du projet en cours.%sLes projets et les paquets ne devraient pas partager de fichiers."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, object-pascal-format
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "Le nom de fichier \"%s\" est utilisé par%sle paquet \"%s\"%sdans le fichier \"%s\"."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Le paquet suivant n'a pas pu être chargé :"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Les paquets suivants n'ont pas pu être chargés :"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, object-pascal-format
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sLes unités suivantes seront ajoutées à la clause uses de%s%s:%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, object-pascal-format
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "Le nom de paquet \"%s\" dans\"%s\"%s n'est pas un nom de paquet Lazarus correct."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, object-pascal-format
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Le paquet %s est un paquet d'exécution.%sLes paquets d'exécution ne peuvent pas être installés dans l'EDI."

#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, object-pascal-format
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "Le paquet \"%s\" est compilé automatiquement et son répertoire de sortie est \"%s\" qui est sur le chemin de recherche par défaut des unités du compilateur . Le paquet utilise d'autres paquets qui utilisent eux aussi le même chemin. Cela crée une boucle sans fin.%sVous pouvez corriger ce problème en supprimant ce chemin de la configuration du compilateur (par exemple : \"fpc.cfg\")%sou en désactivant la mise à jour automatique de ce paquet, ou encore en supprimant les dépendances."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, object-pascal-format
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Le paquet \"%s\" est marqué pour l'installation, mais est introuvable.%sFaut-il retirer la dépendance de la liste d'installation des paquets?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, object-pascal-format
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "Le paquet %s est requis par %s, qui est marqué pour l'installation.%sVoir le graphe des paquets."

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, object-pascal-format
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Le nom de paquet \"%s\" n'est pas un nom de paquet correct.%sVeuillez choisir un autre nom (par exemple : \"package1.lpk\")."

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, object-pascal-format
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "Le nom de paquet \"%s\" du%sfichier \"%s\" est incorrect."

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Le paquet \"%s\" a été marqué.%sActuellement, Lazarus ne prend en charge que les paquets liés statiquement. La désinstallation nécessite de reconstruire et de redémarrer Lazarus.%sVoulez-vous recréer Lazarus maintenant ?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Le paquet \"%s\" a été marqué pour l'installation.%sActuellement, Lazarus ne prend en charge que les paquets liés statiquement. L'installation nécessite de reconstruire et de redémarrer Lazarus.%sVoulez-vous recréer Lazarus maintenant ?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, object-pascal-format
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Le projet nécessite le paquet \"%s\".%sMais il est introuvable. Voir Projet->Inspecteur de projet."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, object-pascal-format
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Deux unités portent le même nom :%s1. \"%s\" de %s%s2. \"%s\" de %s"

#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "Il existe une dépendance circulaire dans les paquets. Voir le graphe des paquets."

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, object-pascal-format
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Une unité de FPC porte le même nom que le paquet :%s\"%s\""

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, object-pascal-format
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Une unité de FPC porte le même nom que :%s\"%s\" de %s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, object-pascal-format
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Un autre paquet porte déjà le nom \"%s\".%sPaquet en conflit : \"%s\"%sFichier : \"%s\""

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, object-pascal-format
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Il y a déjà un paquet \"%s\" chargé%sdepuis le fichier \"%s\".%sVoir Paquet -> Graphe des paquets.%sLe remplacement est impossible."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Il existe un paquet non enregistré dans les paquets requis. Voir le graphe des paquets."

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, object-pascal-format
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Une unité porte le même nom qu'un paquet :%s1. \"%s\" de %s%s2. \"%s\""

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Il s'agit d'un paquet virtuel. Il n'a pas encore de code source. Veuillez sauvegarder le paquet d'abord."

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, object-pascal-format
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Impossible de créer le répertoire cible pour Lazarus :%s\"%s\".%sCe répertoire est nécessaire pour le nouvel EDI modifié avec vos paquets personnalisés."

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, object-pascal-format
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Impossible d'écrire le paquet \"%s\"%sdans le fichier \"%s\".%sErreur : %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Voulez-vous désinstaller le paquet ?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
#, object-pascal-format
msgid "Uninstall package %s?"
msgstr "Voulez-vous désinstaller le paquet %s ?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Paquet non enregistré"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Utiliser l'unité"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, object-pascal-format
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Avertissement : le fichier \"%s\"%sappartient au projet actuel."

#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "garder"

#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "nouveau"

#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "supprimer"

#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Choisir un paquet"

#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr "Les dépendances suivantes ne sont pas nécessaires à cause de la transitivité automatique entre les dépendances de paquets."

#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, object-pascal-format
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "Le projet redéfinit le répertoire de sortie des paquets suivants. %sVoir Projet / Options de projet (section des options du compilateur)/ Ajouts et redéfinitions%s%s"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Ce fichier n'est dans aucun des paquets chargés."

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
#, object-pascal-format
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Impossible de lire le fichier du paquet \"%s\".%sErreur : %s"

#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Exécuter"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Global"

#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr "En ligne"

#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr "Les paquets en ligne ne peuvent pas être supprimés"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Liens de paquet"

#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr "Afficher les liens globaux dans "

#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr "Montrer les liens en ligne"

#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr "Afficher les liens de l'utilisateur dans "

#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr "Certains paquets ne peuvent pas être supprimés"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Utilisateur"

#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr "Veuillez corriger l'erreur indiquée dans la fenêtre des messages qui se trouve normalement sous l'éditeur."

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Veuillez ouvrir une unité avant l'exécution."

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Veuillez sélectionner du code pour extraire une nouvelle procédure/méthode."

#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Tous>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Changer la police"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Copier le nom de méthode dans le presse-papiers"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Filtrer en associant n'importe quelle partie de la méthode"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Filtrer en associant avec le début de la méthode"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Aller à la sélection"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Aucun>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objets"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Liste des routines"

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Type"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Choisir le répertoire des fichiers .po"

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Ne pas conserver les informations de session"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr "Enregistrer dans le fichier .lps du dossier de configuration de l'EDI"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Sauvegarder dans un fichier .lpi"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Sauvegarder dans un fichier .lps du dossier projet"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Emplacements pour la sauvegarde des informations de session"

#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr ".lpi est le fichier principal d'informations du projet ; .lps est un fichier séparé pour les seules données de la session."

#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr "Position"

#: lazarusidestrconsts.lispositionoutsideofsource
#, object-pascal-format
msgid "%s (position outside of source)"
msgstr "%s (position hors du code source)"

#: lazarusidestrconsts.lisppuinwrongdirectory
#, object-pascal-format
msgid "ppu in wrong directory=%s."
msgstr "ppu dans un répertoire incorrect = %s."

#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
#, object-pascal-format
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr "%s.ppu introuvable. Vérifiez votre fpc.cfg."

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Mot précédent"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
#, object-pascal-format
msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"."
msgstr "Répertoire principal de configuration où Lazarus stocke ses dossiers de configuration. Par défaut, c'est \"%s\"."

#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Chemin de configuration principal"

#: lazarusidestrconsts.lisprior
#, object-pascal-format
msgid "prior %s"
msgstr "avant %s"

#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Priorité"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Privée"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Méthode privée"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, object-pascal-format
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Vous devez probablement installer certains paquets avant de pouvoir continuer.%sAvertissement :%sLe projet dépend de certains paquets de conception, qui pourraient être nécessaires pour ouvrir la fiche dans le concepteur. Si vous continuez, vous pourriez obtenir des erreurs relatives aux composants absents et le chargement de la fiche produira sans doute des résultats très désagréables.%sIl est recommandé d'abandonner et d'installer d'abord ces paquets."

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Routines"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Procédure avec interface"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Programme"

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Programme détecté"

#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Un programme Free Pascal en ligne de commande muni de paramètres supplémentaires utiles."

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Le fichier de code source du programme doit avoir une extension Pascal comme .pas, .pp ou `.lpr"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "La dépendance existe déjà"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Ajouter les fichiers de l'éditeur"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Version Min-Max incorrecte"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Version incorrecte"

#: lazarusidestrconsts.lisprojaddlocalpkg
#, object-pascal-format
msgid "Local (%s)"
msgstr "Local (%s)"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Version maximale (optionnelle) :"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Version minimale (optionnelle) :"

#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr "Nouvelle exigence FPMake"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Nouvelle condition"

#: lazarusidestrconsts.lisprojaddonlinepkg
#, object-pascal-format
msgid "Online (%s)"
msgstr "En ligne (%s)"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Nom du paquet :"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Paquet non trouvé"

#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr "Type de paquet :"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, object-pascal-format
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "La dépendance \"%s\" est introuvable.%sVeuillez choisir un paquet existant."

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "La version maximale \"%s\" est incorrecte.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple : 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "La version maximale est inférieure à la version minimale."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "La version minimale \"%s\" est incorrecte.%sVeuillez utiliser le format majeure.mineure.sous-version.construction%sPar exemple : 1.0.20.10"

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, object-pascal-format
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Le projet a déjà une dépendance avec le paquet \"%s\"."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "Le nom d'unité \"%s\" existe déjà dans le projet%savec le fichier : \"%s\"."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "Le nom d'unité \"%s\" existe déjà dans la sélection%savec le fichier : \"%s\"."

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Le nom de l'unité existe déjà"

#: lazarusidestrconsts.lisproject
#, object-pascal-format
msgid "Project %s"
msgstr "Projet %s"

#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Projet : "

#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "projet"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Le projet a été modifié"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Le projet a changé sur le disque"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Répertoire du projet"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Nom de fichier du projet"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Chemin des inclusions du projet"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Fichier d'informations sur le projet détecté"

#: lazarusidestrconsts.lisprojectinspectorshowprops
msgid "Show properties pane in Project Inspector"
msgstr "Montrer le panneau des propriétés dans l'inspecteur de projet"

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Le projet est exécutable"

#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr "Génère un exécutable binaire qui peut être lancé."

#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Projet"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Propriétés des macros du projet"

#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr "Espaces de nommage de projet"

#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Option du projet"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Répertoire de sortie du projet (par exemple le répertoire des fichiers ppu)"

#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Dossier de sortie du projet"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Répertoire où doit être le fichier principal du projet"

#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Session du projet"

#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "La session du projet a été modifiée"

#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Dossiers des codes sources du projet"

#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
#, object-pascal-format
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s à l'adresse %1:x"

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
#, object-pascal-format
msgid "Project %s raised exception class '%s'."
msgstr "Le projet %s a levé une classe d'exception \"%s\"."

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
#, object-pascal-format
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Le projet %s a levé une classe d'exception \"%s\" avec le message : %s%s"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s dans le fichier \"%1:s\" à l'adresse %2:x"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s dans le fichier \"%1:s\" à la ligne %2:d"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:sdans le fichier \"%1:s\" à la ligne %2:d :%0:s%3:s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Chemin des codes sources du projet"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "unité du projet"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Chemin des unités du projet"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Assistant de projet"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Confirmer la suppression de la dépendance"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Confirmer le retrait du fichier"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, object-pascal-format
msgid "Delete dependency for %s?"
msgstr "Faut-il supprimer la dépendance pour %s ?"

#: lazarusidestrconsts.lisprojinspprojectinspector
#, object-pascal-format
msgid "Project Inspector - %s"
msgstr "Inspecteur de projet - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Paquets requis retirés"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
#, object-pascal-format
msgid "Remove file %s from project?"
msgstr "Voulez-vous retirer le fichier %s du projet ?"

#: lazarusidestrconsts.lisprojinspremoveitemsf
#, object-pascal-format
msgid "Remove %s items from project?"
msgstr "Voulez-vous retirer %s éléments du projet ?"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Toujours créer (même si rien n'a changé)"

#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr "Peut être nécessaire s'il y a un bogue lors de la vérification des dépendances. Non requis en temps normal."

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Erreur"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
#, object-pascal-format
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Impossible de modifier la liste de création automatique des fiches dans le code source du programme.%sVeuillez d'abord corriger les erreurs."

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Demander la valeur"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Propriétés (remplacer ou supprimer)"

#: lazarusidestrconsts.lisproperty
#, object-pascal-format
msgid "%s property"
msgstr "propriété %s"

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protégée"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Méthode protégée"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Méthode publique"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Méthode publiée"

#: lazarusidestrconsts.lispublishedto
#, object-pascal-format
msgid "Published to %s"
msgstr "Publié vers %s"

#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr "Les fichiers appartenant au projet ou au paquet seront inclus automatiquement."

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Répertoire de publication du projet"

#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Publier le projet"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Sauvegarder les fichiers \".lrs\" dans le répertoire de sortie"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr "La ressource sera disponible pour FPC."

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Une unité Pascal doit avoir l'extension .pp ou .pas"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Éditer l'unité virtuelle"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Il existe déjà une unité portant ce nom.%sFichier : %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Le nom d'unité n'est pas un identificateur Pascal correct."

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Les noms d'unité et de fichier ne correspondent pas. %sExemple : unit1.pas et Unit1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Convertir un projet &Delphi"

#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "&Nouveau projet"

#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "&Ouvrir un projet"

#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Ouvrir un projet &récent"

#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Montrer les projets d'&Exemples"

#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
msgid "Quick check Fppkg configuration at start"
msgstr "Vérification rapide de la configuration de Fppkg au démarrage"

#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "Correction rapide d'erreur"

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Solutions rapides"

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Chercher l'identificateur"

#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Quitter"

#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "&Quitter Lazarus"

#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Faut-il vraiment supprimer ?"

#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Onglets récents"

#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Enregistrement"

#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Enregistré"

#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Refaire"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Expression régulière"

#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Relatif"

#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Supprimer"

#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Supprimer ?"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Supprimer toutes les propriétés incorrectes"

#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Supprimer tous les filtres de type de message"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Supprimer toutes les unités"

#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Supprimer l'option du compilateur de message caché"

#: lazarusidestrconsts.lisremovedependenciesfrompackage
#, object-pascal-format
msgid "Remove %s dependencies from package \"%s\"?"
msgstr "Faut-il supprimer %s dépendances du paquet \"%s\" ?"

#: lazarusidestrconsts.lisremovedpropertys
#, object-pascal-format
msgid "Removed property \"%s\"."
msgstr "Propriété supprimée : \"%s\"."

#: lazarusidestrconsts.lisremovefilesfrompackage
#, object-pascal-format
msgid "Remove %s files from package \"%s\"?"
msgstr "Faut-il supprimer %s fichiers du paquet \"%s\" ?"

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Retirer du projet"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Supprimer du chemin de recherche"

#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Faut-il supprimer le chemin d'inclusion ?"

#: lazarusidestrconsts.lisremovelocalvariable3
#, object-pascal-format
msgid "Remove local variable \"%s\""
msgstr "Supprimer la variable locale \"%s\""

#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Supprimer le filtre type de message"

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Supprimer les fichiers inexistants"

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Supprimer les unités sélectionnées"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Les supprimer"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Supprimer les chemins de \"Autres sources\""

#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Faut-il supprimer le chemin de l'unité ?"

#: lazarusidestrconsts.lisremoveuses
#, object-pascal-format
msgid "Remove uses \"%s\""
msgstr "Supprimer l'utilisation de \"%s\""

#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Renommer"

#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Renommer..."

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Faut-il renommer le fichier ?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Le changement de nom du fichier a échoué"

#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Montrer la liste des identificateurs renommés"

#: lazarusidestrconsts.lisrenameto
#, object-pascal-format
msgid "Rename to %s"
msgstr "Renommer en %s"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Renommer en minuscules"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Rouvrir le projet"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Rouvrir avec un autre encodage"

#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Répéter"

#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Remplacer"

#: lazarusidestrconsts.lisreplacedpropertyswiths
#, object-pascal-format
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "Propriété \"%s\" remplacée par \"%s\"."

#: lazarusidestrconsts.lisreplacedtypeswiths
#, object-pascal-format
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "Type \"%s\" remplacé par \"%s\"."

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Remplacement"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Fonctions de remplacement"

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Remplacements"

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Corriger les types et les propriétés inconnus"

#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Remplacer l'identificateur complet"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Le remplacement de la sélection a échoué."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/fr"

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Nouveau balayage"

#: lazarusidestrconsts.lisreset
msgctxt "lazarusidestrconsts.lisreset"
msgid "Reset"
msgstr "Réinitialiser"

#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Voulez-vous réinitialiser les filtres de fichiers aux valeurs par défaut ?"

#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "Voulez-vous réinitialiser les propriétés Left, Width et Height des composants sélectionnés en fonction des valeurs de leur ancêtre ?"

#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr "Le nom de la ressource doit être unique."

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Erreur d'enregistrement de ressource"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Type de ressource du projet"

#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Redémarrer"

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Résultat :"

#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
msgstr ""
"Retourne le mot indexé selon le paramètre à partir de la ligne courante précédant la position du curseur.\n"
"\n"
"Les mots d'une ligne sont numérotés à partir de 1, de la gauche vers la droite, mais le dernier mot,\n"
"qui est toujours une commande de macro à étendre, porte le numéro 0. Ainsi, $PrevWord(0)\n"
"renvoie toujours à la macro en cours.\n"
"\n"
"Ligne d'exemple :\n"
"i 0 count-1 forb|\n"
"Ici, $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"À la fin de votre modèle, utilisez $PrevWord(-1) qui ne donnera qu'une chaîne vide, mais qui opèrera un nettoyage important de tous les $PrevWords trouvés. En bonus, voici une expression régulière utilisée afin de détecter les mots pour cette macro : [\\w\\-+*\\(\\)\\[\\].^@]+"

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent    // the case list will be generated without extra indentation"
msgstr ""
"Retourne la liste de toutes les valeurs de la variable \"case\" en face de la variable.\n"
"\n"
"Paramètres facultatifs (séparés par des virgules) :\n"
"WithoutExtraIndent   // la liste de cas sera générée sans indentation supplémentaire"

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "La restauration a échoué"

#: lazarusidestrconsts.lisrevision
msgid "Revision: "
msgstr "Révision : "

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Droite"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Ancrage à droite"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "L'espace de bordure droit. Cette valeur est ajoutée à la base de l'espace de bordure et employée pour l'espace à droite du contrôle."

#: lazarusidestrconsts.lisrightgutter
msgctxt "lazarusidestrconsts.lisrightgutter"
msgid "Right"
msgstr "Droite"

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "C'est le contrôle frère auquel le côté droit est ancré. Le laisser vide pour l'ancrer au parent comme le ferait Delphi (les propriétés BorderSpacing et ReferenceSide sont sans effet)."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Côtés droits"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Espacement droit égal"

#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Exécuter"

#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "Les paquets à la fois d'exécution et de conception n'ont pas de limitations."

#: lazarusidestrconsts.lisrunning
#, object-pascal-format
msgid "%s (running ...)"
msgstr "%s (en cours d'exécution...)"

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Fichier non exécutable"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, object-pascal-format
msgid "The host application \"%s\" is not executable."
msgstr "L'application hôte \"%s\" n'est pas exécutable."

#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Exécuter"

#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Exécution seule : ne peut être installé dans l'EDI"

#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "Les paquets d'exécution seule ne concernent que les projets. Ils ne peuvent pas être installés dans l'EDI, même indirectement."

#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr "Les paquets d'exécution peuvent être utilisés par les projets. Ils ne peuvent pas être installés dans l'EDI, à moins d'être requis par un paquet de conception."

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "\"Exécuter jusqu'à\" a échoué"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Méthodes abstraites - pas encore redéfinies"

#: lazarusidestrconsts.lissamabstractmethodsof
#, object-pascal-format
msgid "Abstract methods of %s"
msgstr "Méthodes abstraites de %s"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Le curseur n'est pas dans une déclaration de classe"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "L'EDI est occupé"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
#, object-pascal-format
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s est une classe abstraite, elle a %s méthodes abstraites."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Aucune méthode abstraite trouvée"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Écraser la sélection complète"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Écraser la première sélection"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Aucune sélection"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
#, object-pascal-format
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Il existe %s méthodes abstraites à redéfinir. %sSélectionnez les méthodes pour lesquelles des squelettes doivent être créés :"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Il n'existe pas de méthode abstraite restant à redéfinir."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Cette méthode ne peut pas être surchargée, car elle est définie dans la classe courante"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Impossible de montrer les méthodes abstraites de la classe courante, parce que"

#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Enregistrer"

#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Tout enregistrer"

#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Enregistrer les éditeurs cochés"

#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Enregistrer tous les fichiers modifiés"

#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Tout enregistrer ou les messages d'origine dans le fichier..."

#: lazarusidestrconsts.lissaveandexitdialog
msgid "Only Save"
msgstr "Seulement enregistrer"

#: lazarusidestrconsts.lissaveandrebuildide
msgid "Rebuild IDE"
msgstr "Reconstruire l'EDI"

#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Voulez-vous enregistrer les fichiers modifiés ?"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Voulez-vous enregistrer les modifications ?"

#: lazarusidestrconsts.lissavechangestoproject
#, object-pascal-format
msgid "Save changes to project %s?"
msgstr "Voulez-vous enregistrer les modifications apportées au projet %s ?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Enregistrer le fichier d'édition courant"

#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "Enregistré avec les paramètres de l'EDI"

#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Enregistré avec la session du projet"

#: lazarusidestrconsts.lissavefilebeforeclosingform
#, object-pascal-format
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Voulez-vous enregistrer le fichier \"%s\"%savant de fermer la fiche \"%s\" ?"

#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Enregistrer la macro sous"

#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Enregistrer les messages"

#: lazarusidestrconsts.lissaveproject
#, object-pascal-format
msgid "Save project %s (*%s)"
msgstr "Enregistrer le projet %s (*%s)"

#: lazarusidestrconsts.lissavesessionchangestoproject
#, object-pascal-format
msgid "Save session changes to project %s?"
msgstr "Voulez-vous enregistrer les changements de session dans le projet %s ?"

#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Enregistrer les informations de pliage"

#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr "Les éditeurs de code acceptent le pliage (disparition momentanée) des blocs de code."

#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Enregistrer l'historique de saut"

#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr "Le Ctrl-Clic sur un identificateur dans l'éditeur de code est stocké dans l'historique de saut."

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Enregistrer les paramètres"

#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Enregistrer les messages visibles dans le fichier..."

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Enregistrer "

#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
#, object-pascal-format
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr "Sauvegarder le fichier \"%s\" en tant que \"%s\" produit une perte de caractères à la ligne %s, colonne %s."

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Facteur d'ajustement :"

#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr "Rechercher les fichiers dans le répertoire parent"

#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr "Chercher les fichiers de code source dans les répertoires frères (répertoire parent et ses enfants)"

#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Recherche en cours"

#: lazarusidestrconsts.lisscanning2
#, object-pascal-format
msgid "%s. Scanning ..."
msgstr "%s. Parcours..."

#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Recherche en cours dans le répertoire parent"

#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Chemins de recherche"

#: lazarusidestrconsts.lissearchunit
#, object-pascal-format
msgid "Search Unit \"%s\""
msgstr "Rechercher l'unité \"%s\""

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
#, object-pascal-format
msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"."
msgstr "Répertoire de configuration secondaire où Lazarus recherche ses fichiers de modèles de configuration. Par défaut, c'est \"%s\"."

#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Chemin de configuration secondaire"

#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr "&Second essai"

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Voir les messages."

#: lazarusidestrconsts.lisseeprojectprojectinspector
#, object-pascal-format
msgid "%sSee Project -> Project Inspector"
msgstr "%sVoir Projet -> Inspecteur de Projet"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Choisir un élément d'aide :"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Choisir un nœud"

#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr "Choisir un autre ensemble graphique LCL (macro LCLWidgetType)"

#: lazarusidestrconsts.lisselectbuildmode
msgid "Select build mode"
msgstr "Sélectionner le mode de construction"

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Sélectionner les fiches Delphi (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Sélectionné"

#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr "Ajout sélectionné :"

#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "Contrôles sélectionnés et enfants"

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(voisin du  bas sélectionnée)"

#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Mappage de la commande sélectionnée"

#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "sélectionné pour l'installation"

#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "sélectionné pour la désinstallation"

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(voisin de gauche sélectionné)"

#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr "Message sélectionné dans la fenêtre des messages :"

#: lazarusidestrconsts.lisselectedmodeswerecompiled
#, object-pascal-format
msgid "Selected %d modes were successfully compiled."
msgstr "%d modes choisis ont été compilés avec succès."

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(voisin de droite sélectionné)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(voisin du haut sélectionné)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Choisir le fichier"

#: lazarusidestrconsts.lisselectfpcpath
msgid "Select the path where FPC is installed"
msgstr "Sélectionnez le chemin d'accès où FPC est installé"

#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Choisir le répertoire des codes sources de FPC"

#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr "Choisir un cadre"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "La sélection dépasse la constante chaîne"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Sélection d'outils"

#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Choisir le répertoire des codes sources de Lazarus"

#: lazarusidestrconsts.lisselectpathto
#, object-pascal-format
msgid "Select path to %s"
msgstr "Définir le chemin à %s"

#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "Choisir le répertoire de destination"

#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Définir toutes les couleurs :"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Valeur par défaut"

#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr "À définir pour traduire les messages du compilateur dans une autre langue que l'anglais. Par exemple, pour l'allemand : $(FPCSrcDir)/compiler/msg/errordu.msg."

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Définir l'indentation par défaut)"

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Court :"

#: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar
msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty."
msgstr "Forme abrégée de $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). La sous-cible est omise si elle est vide."

#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Court (sans le chemin)"

#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
#, object-pascal-format
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr "Le composant \"%s\" doit-il être auto-créé au démarrage de l'application ?"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Afficher"

#: lazarusidestrconsts.lisshowabstractmethodsof
#, object-pascal-format
msgid "Show abstract methods of \"%s\""
msgstr "Montrer les méthodes abstraites de \"%s\""

#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Afficher l'arbre des composants"

#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr "Voir la console"

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Montrer les conseils de déclaration"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Montrer les différences entre les modes..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Montrer les unités/paquets vides"

#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr "Montrer le message FPC \"lignes compilées\""

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Montrer les glyphes pour"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Afficher la gouttière"

#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Afficher l'aide"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Afficher les conseils"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Afficher les identificateurs"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Afficher la boîte d'information"

#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Montrer l'ID Type de message"

#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr "Afficher les lignes multiples"

#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Montrer uniquement si changés"

#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr "Montrer seulement un bouton dans la barre des tâches pour l’EDI au lieu d’un par fenêtre. Certains gestionnaires de fenêtres Linux, tel Cinnamon, ne peuvent pas le faire et montrent toujours un bouton par fenêtre."

#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr "Montrer la sortie"

#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview gutter"
msgstr "Montrer la gouttière"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Afficher les paquets"

#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Montrer la position de l'éditeur de source"

#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
msgid "Show property filter"
msgstr "Afficher le filtre de propriété"

#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "Afficher les identificateurs récents au sommet"

#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Montrer les chemins relatifs"

#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr "Montre tous les contrôles dans un arbre hiérarchique."

#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr "Une boîte en bas affiche la description de la propriété choisie."

#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings."
msgstr "Montrer la boîte de dialogue pour définir les paramètres les plus importants."

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Afficher les caractères spéciaux"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Afficher la barre d'état"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Afficher les unités"

#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr "Afficher les unités avec sections d'initialisation/finalisation"

#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr "Ces unités peuvent initialiser des données globales utilisées par le programme ou l'application. À retirer avec précaution."

#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Montrer les unités inutilisées..."

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Montrez les conseils de valeur pendant le débogage"

#: lazarusidestrconsts.lisshowversionandexit
msgid "Show version and exit."
msgstr "Afficher la version et sortir."

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Réduire au plus petit"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Frère"

#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Programme simple"

#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "Un programme minimal Free Pascal en ligne de commande."

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Syntaxe simplifiée"

#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Ignorer les erreurs"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Ignorer le fichier"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Ignorer le fichier et continuer le chargement"

#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project."
msgstr "Ignorer le chargement du dernier projet."

#: lazarusidestrconsts.lisskipstartupchecks
msgid "Skip selected checks at startup. Valid options are:"
msgstr "Sauter les coches sélectionnées au démarrage. Les options valides sont les suivantes :"

#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr "Plus lent mais plus précis."

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Plus petit plutôt que plus rapide"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Correspondances"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Désolé, ce type n'est pas encore implémenté"

#: lazarusidestrconsts.lissorthistorylimit
msgid "History items limit"
msgstr "Limite des éléments de l'historique"

#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr "Tri en cours"

#: lazarusidestrconsts.lissortorderalphabetic
msgid "Alphabetic"
msgstr "Alphabétique"

#: lazarusidestrconsts.lissortorderdefinition
msgid "Definition (Scoped)"
msgstr "Définition (portée)"

#: lazarusidestrconsts.lissortorderscopedalphabetic
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
msgid "Alphabetic (Scoped)"
msgstr "Alphabétique (portée)"

#: lazarusidestrconsts.lissortordertitle
msgid "Order by"
msgstr "Ordonner selon"

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Croissant"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Sensible à la casse"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Décroissant"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Domaine"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Ignorer les espaces"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Lignes"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Options"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Paragraphes"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Aperçu"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Accepter"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Trier la sélection"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Mots"

#: lazarusidestrconsts.lissourceanddestinationaresame
#, object-pascal-format
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr "Les répertoires source \"%s\"%set destination \"%s\"%ssont identiques. Veuillez choisir un autre répertoire."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, object-pascal-format
msgid "Source directory \"%s\" does not exist."
msgstr "Le dossier source  \"%s\" n'existe pas."

#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Gestionnaire de fenêtres de l'éditeur de source"

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Code source modifié"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, object-pascal-format
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Le code source de la page \"%s\" a changé. Voulez-vous l'enregistrer ?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
#, object-pascal-format
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "Les codes sources des pages ont été modifiés. Voulez-vous enregistrer la page \"%s\" ? (%d plus)"

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Chemins des codes sources"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Espacement régulier"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Système d'exploitation source"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Recherche en cours"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Texte à rechercher"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Démarrer la conversion"

#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Démarrer l'EDI"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Démarrer avec un nouveau projet"

#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr "La barre de statut montre le nom de la propriété et la classe où elle est publiée."

#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Arrêter"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Voulez-vous arrêter le débogage en cours et recréer le projet ?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Voulez-vous arrêter le débogage ?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Voulez-vous arrêter le débogage ?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Arrêt si exception"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Voulez-vous arrêter le débogage ?"

#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Enregistrement des délimiteurs de chemin \\ et / comme"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Erreur de flux"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Sous-procédure"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Sous-procédure de même niveau"

#: lazarusidestrconsts.lissubtarget
msgid "Subtarget"
msgstr "Sous-cible"

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Succès"

#: lazarusidestrconsts.lissuccessfullyexported
#, object-pascal-format
msgid "Successfully exported to \"%s\"."
msgstr "Exporté avec succès vers \"%s\"."

#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
#, object-pascal-format
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr "%d modes de construction ont été exportés avec succès vers \"%s\"."

#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
#, object-pascal-format
msgid "Successfully exported compiler options to \"%s\"."
msgstr "Les options du compilateur ont été correctement exportées dans \"%s\"."

#: lazarusidestrconsts.lissuccessfullyimported
#, object-pascal-format
msgid "Successfully imported from \"%s\"."
msgstr "Importé avec succès depuis \"%s\"."

#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
#, object-pascal-format
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr "Succès de l'importation de %d modes de construction depuis \"%s\"."

#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
#, object-pascal-format
msgid "Successfully imported compiler options from \"%s\"."
msgstr "Succès de l'importation des options du compilateur depuis \"%s\"."

#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Proposer un nom par défaut de nouveau fichier en minuscules"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Chemin d'inclusion suspect"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Chemin d'unité suspect"

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Nom de variable incorrect"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, object-pascal-format
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" n'est pas un identificateur correct."

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Surcharger une variable système"

#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Basculer les paramètres de filtre"

#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr "Basculer vers l'onglet Favoris après avoir demandé le nom du composant."

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Mode syntaxe"

#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "system.ppu non trouvé. Vérifiez votre fpc.cfg."

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tabulation"

#: lazarusidestrconsts.listaborderconfirmsort
#, object-pascal-format
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Voulez-vous trier l'ordre de tabulation de tous les contrôles enfants de \"%s\" suivant leurs positions?"

#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Tabulation : déplacer le contrôle sélectionné vers le bas"

#: lazarusidestrconsts.listaborderof
#, object-pascal-format
msgid "Tab Order of %s"
msgstr "Ordre de tabulation de %s"

#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr "Calculer récursivement l'ordre de tabulation pour les contrôles enfants"

#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr "de manière récursive"

#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Calculer l'ordre de tabulation selon leurs coordonnées X, Y"

#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Tabulation : déplacer le contrôle sélectionné vers le haut"

#: lazarusidestrconsts.listabsfor
#, object-pascal-format
msgid "Tabs for %s"
msgstr "Tabulations pour %s"

#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Cible :"

#: lazarusidestrconsts.listarget2
#, object-pascal-format
msgid ", Target: %s"
msgstr ", Cible : %s"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Processeur cible"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Nom du fichier cible : (\"-o\", vide = utilise le répertoire de sortie de l'unité)"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Nom du fichier cible (\"-o\") :"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Fichier de destination du projet"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Nom du fichier de destination + paramètres"

#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "La cible est en lecture seule"

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Système d'exploitation de destination"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Cellule modifiable"

#: lazarusidestrconsts.listemplateeditparamcellhelp
#, object-pascal-format
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s  while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "Insérer une cellule modifiable. On peut naviguer dans les cellules avec la touche TAB.%0:sLa macro \"param\" accepte une liste d’arguments séparés par des virgules.%0:sLe premier argument est la valeur par défaut.%0:sLe 2ème (optionnel) peut être utilisé pour lier la cellule à une autre cellule (édition synchronisée).%0:s%0:s  while param(\"foo\") do param(foo);%0:sInsère 2 cellules indépendantes, chacune avec le texte par défaut \"foo\"%0:sLes guillemets sont optionnels. %0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInsère 2 cellules liées, l’édition de l’une changera aussi l’autre.%0:sLa valeur \"1\" fait référence à la position de l’autre \"param()\". Ainsi s'il y a plus de paramètres:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sLes 2ème et 3ème sont liés. (le 3ème a la référence \"2\") %0:s%0:s\"sync peut être raccourci en \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sLe 2ème et le 3ème sont liés%0:sNote : \"Sync\" n’a pas de position et pas de \"=\", ainsi il se synchronise avec la cellule précédente avec la même valeur par défaut (dans le cas présent \"foo\")."

#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "Fichier modèle"

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Répertoire de test"

#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "Tester l'URL"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
#, object-pascal-format
msgid "The Application Bundle was created for \"%s\""
msgstr "Le paquetage de l'application a été créé pour \"%s\""

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, object-pascal-format
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "La classe \"%s\" est un TControl et ne peut être collée que dans un contrôle.%sCollage impossible."

#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
#, object-pascal-format
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "Le fichier de compilateur\"%s\" semble incorrect :%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, object-pascal-format
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "Le composant %s ne peut être supprimé, car il n'est pas détenu par %s."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "L'éditeur de composants de la classe \"%s\" a provoqué l'erreur :%s\"%s\""

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, object-pascal-format
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "L'éditeur de composants de la classe \"%s\"%sappelé avec le verbe #%s \"%s\"%s a provoqué l'erreur :%s\"%s\""

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Le composant %s est hérité de%s.%sPour supprimer un composant hérité, ouvrez l'ancêtre et supprimez-le."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Le composant %s est hérité de%s.%sPour renommer un composant hérité, ouvrez l'ancêtre et renommez-le à ce moment."

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "Le nom du composant doit être unique parmi tous les composants de la fiche/module de données. Le nom est insensible à la casse, comme un identificateur Pascal normal."

#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "La configuration sera rétrogradée/convertie."

#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, object-pascal-format
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "\"%s\" contient un répertoire inexistant :%s%s"

#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, object-pascal-format
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "Le %s contient un caractère *.%sLazarus considère ce caractère comme normal et ne le comprend pas comme un masque de fichier."

#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "Le FPC en cours n'a pas de fichier de configuration. Il va probablement manquer quelques unités. Vérifiez votre installation de FPC."

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, object-pascal-format
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "Le débogueur \"%s\"%sn'existe pas ou n'est pas exécutable.%sVoir Outils -> Options du débogueur"

#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "Le mode par défaut doit être enregistré dans le projet, pas dans la session."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, object-pascal-format
msgid "The destination directory%s\"%s\" does not exist."
msgstr "Le répertoire de destination%s\"%s\" n'existe pas."

#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
#, object-pascal-format
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "Le répertoire \"%s\" ne contient plus de fichiers inclus dans le projet. Faut-il supprimer ce répertoire du chemin de recherche des inclusions du projet ?"

#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
#, object-pascal-format
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "Le répertoire \"%s\" ne contient plus aucune unité du projet. Faut-il supprimer ce répertoire du chemin de recherche des unités du projet ?"

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, object-pascal-format
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "Le répertoire \"%s\" n'est plus requis dans le chemin des unités. %sVoulez-vous le supprimer ?"

#: lazarusidestrconsts.listhefile
#, object-pascal-format
msgid "The file \"%s\""
msgstr "Le fichier \"%s\""

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "L'index de fichier est nécessaire pour des fonctions telles que la recherche de déclaration. Lors de la recherche, vous pouvez modifier les codes sources et les compiler, mais les fonctions de recherche vous indiqueront des erreurs d'unités non trouvées. Cela peut prendre une minute."

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "Le fichier\"%s\" n'est pas un projet Lazarus.%sVoulez-vous créer un nouveau projet pour ce \"%s\"?"

#: lazarusidestrconsts.listhefilemaskisinvalid
#, object-pascal-format
msgid "The file mask \"%s\" is invalid."
msgstr "Le masque de fichier \"%s\" est incorrect."

#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
#, object-pascal-format
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "Le masque de fichier \"%s\" n'est pas une expression régulière correcte."

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, object-pascal-format
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Le fichier \"%s\" semble être un programme.%sFaut-il fermer le projet en cours et créer un nouveau projet Lazarus pour ce programme ?%s\"Non\" chargera le fichier comme un fichier de code source normal."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, object-pascal-format
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Le fichier %s semble être le fichier programme d'un projet Lazarus existant."

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, object-pascal-format
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "Le fichier \"%s\" n'a pas été trouvé.%sSouhaitez-vous le rechercher manuellement ?"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, object-pascal-format
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "Le fichier \"%s\" n'a pas été trouvé.%sIgnorer continuera à charger le projet,%sAbandonner arrêtera le chargement."

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, object-pascal-format
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "Les méthodes suivantes employées par %s ne sont pas dans le code source%s%s%s%s%sFaut-il enlever les références pendantes ?"

#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "Le répertoire des codes sources de FPC \"%s\" ne semble pas correct :%s%s"

#: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect
#, object-pascal-format
msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s"
msgstr "Le fichier de configuration Fppkg \"%s\" ne semble pas correct : %s%s"

#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
#, object-pascal-format
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "L'exécutable du compilateur Free Pascal porte en général le nom \"%s\". Vous pouvez aussi utiliser le compilateur particulier à la cible comme \"%s\". Veuillez en indiquer le chemin complet."

#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr "L'EDI est encore en cours de construction."

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "L'identificateur est une unité. Veuillez utiliser la commande \"Fichier\" - \"Enregistrer sous\" afin de renommer une unité."

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, object-pascal-format
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "La touche %s est déjà attribuée à %s%s.%s%sVoulez-vous retirer l'ancienne affectation et affecter la touche à la nouvelle fonction %s ?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, object-pascal-format
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "L'ensemble d'application %s%snécessaire à l'exécution n'existe pas ou n'est pas exécutable.%sVoulez-vous en créer un ?%s Voir Projet->Options du Project...->Paramètres de l'application."

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, object-pascal-format
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "L'application de lancement \"%s\"%sn'existe pas ou n'est pas exécutable.%sVoir Éxécuter -> Paramètres d'exécution -> Local"

#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
#, object-pascal-format
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "Le répertoire Lazarus contient les codes sources de l'EDI et les fichiers des paquets de la LCL, ainsi que de nombreux paquets standard. Par exemple, il contient le ficher \"ide%slazarus.lpi\". On y trouve aussi les fichiers de traduction."

#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "Le répertoire Lazarus \"%s\" n'a pas l'air correct :%s%s"

#: lazarusidestrconsts.listhelazarussourcesuse
#, object-pascal-format
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
msgstr "Les sources de Lazarus utilisent une liste différente de paquets de base.%sIl est recommandé de compiler l'EDI proprement en utilisant lazbuild."

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "Le fichier LFM (fiche Lazarus) contient des propriétés incorrectes. Cela veut dire qu'il contient des propriétés/classes qui n'existent pas dans la LCL actuelle. L'action recommandée est de retirer ces propriétés du LFM et de corriger le code Pascal manuellement."

#: lazarusidestrconsts.listhemacrodoesnotbeginwith
#, object-pascal-format
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "La macro \"%s\" ne commence pas par \"%s\"."

#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
#, object-pascal-format
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "L'exécutable Make porte généralement le nom \"%s\". Il est nécessaire pour la construction de l'EDI. Veuillez en fournir le chemin complet."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, object-pascal-format
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Le nouveau fichier include n'est pas encore dans le chemin de recherche.%sVoulez-vous ajouter le répertoire %s ?"

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, object-pascal-format
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "La nouvelle unité n'est pas encore dans le chemin de recherche des unités. %sFaut-il ajouter le répertoire %s ?"

#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "L'ancienne configuration sera mise à niveau."

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
#, object-pascal-format
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "\"Autres sources\" contient un répertoire qui est déjà dans \"Autres fichiers d'unités\".%s%s"

#: lazarusidestrconsts.listheoutputdirectoryismissing
#, object-pascal-format
msgid "The output directory \"%s\" is missing."
msgstr "Le répertoire de sortie \"%s\" est absent."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
#, object-pascal-format
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche d'inclusion de %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche d'inclusion hérité de %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche d'unités héritée de %s."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
#, object-pascal-format
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Le répertoire de sortie %s est répertorié dans le chemin de recherche unités de %s."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr " Le répertoire de sortie devrait être un répertoire séparé et ne contenir aucun fichier de code source."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "La classe propriétaire porte ce nom"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Le propriétaire porte ce nom"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Le paquet %s ajoute le chemin \"%s\" au chemin d'inclusion de l'EDI.%sIl s'agit probablement d'une mauvaise configuration du paquet."

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Le paquet %s ajoute le chemin \"%s\" au chemin des unités de l'EDI.%sIl s'agit probablement d'une mauvaise configuration du paquet."

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Le paquet contient déjà une unité portant ce nom."

#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, object-pascal-format
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr "Le paquet %s ne peut pas être installé, car il nécessite le paquet \"%s\" qui est un paquet d'exécution seule."

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, object-pascal-format
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr "Le paquet %s ne peut pas être désinstallé, car il est nécessaire à l'EDI lui-même."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, object-pascal-format
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Le paquet %s n'a aucune procédure \"Register\", ce qui signifie qu'il ne fournit aucune fonctionnalité nouvelle à l'EDI. L'installer va probablement augmenter la taille de l'EDI et pourrait même le rendre instable.%sConseil : si vous voulez utiliser un paquet dans votre projet, utilisez l'élément du menu intitulé \"Ajouter au projet\"."

#: lazarusidestrconsts.listhepackageisalreadyinthelist
#, object-pascal-format
msgid "The package %s is already in the list"
msgstr "Le paquet %s est déjà dans la liste"

#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
#, object-pascal-format
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "Le paquet %s n'est pas un paquet de conception. Il ne peut pas être installé dans l'EDI."

#: lazarusidestrconsts.listhepackageisusedby
#, object-pascal-format
msgid "The package \"%s\" is used by"
msgstr "Le paquet \"%s\" est utilisé par"

#: lazarusidestrconsts.listhepathofmakeisnotcorrect
#, object-pascal-format
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "Le chemin de Make n'est pas correct : \"%s\""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, object-pascal-format
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "Le programme Make est introuvable.%sCet outil est nécessaire pour créer Lazarus."

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Les options de compilation du projet et les directives du code source principal diffèrent. Pour la nouvelle unité, le mode et le type de chaîne de caractères des options du projet sont utilisés :"

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
msgid "Running your application with debugger"
msgstr "Exécution de votre application avec le débogueur"

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
msgstr "Ce choix peut être modifié ultérieurement dans Projet -> Options du projet -> Options du compilateur -> Débogage."

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
msgid "Run with no debugger"
msgstr "Exécuter sans débogueur"

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
#, object-pascal-format
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
msgstr "\"%s\" ne peut exécuter votre application qu'après sa compilation avec l'activation de l'information de débogage appropriée."

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
msgid "Choose Debug Information format"
msgstr "Choisir le format des informations de débogage"

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, object-pascal-format
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "Le projet n'utilise pas les interfaces de l'unité LCL, mais il semble qu'il en ait besoin.%sVous obtiendrez des erreurs étranges avec l'éditeur de liens si vous utilisez les fiches LCL sans interfaces."

#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
#, object-pascal-format
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
msgstr "Le projet n'a pas de commande de compilation.%sVoir Projet -> Options du projet -> Options du compilateur -> Commandes du compilateur"

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Le projet n'a pas de fichier de code source principal."

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, object-pascal-format
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "Le fichier d'information projet \"%s\"%sest identique au fichier principal du code source !"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
#, object-pascal-format
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "Le fichier d'information du projet \"%s\"%sa changé sur le disque."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, object-pascal-format
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Le projet doit être enregistré avant d'être construit%sSi vous définissez un répertoire de test dans les options d'environnement,%svous pourrez créer de nouveaux projets et les créer aussitôt.%sVoulez-vous enregistrer le projet ?"

#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr "Le projet utilise des ressources FPC qui nécessitent au moins FPC 2.4"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, object-pascal-format
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Le projet utilise le système d'exploitation cible = %s et le CPU = %s.%sLe fichier system.ppu pour cette cible n'a pas été trouvé dans les répertoires des exécutables FPC. %sAssurez-vous que FPC est correctement installé pour cette cible et que le fichier fpc.cfg contient les bons répertoires."

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
#, object-pascal-format
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr "Le projet écrit les symboles de débogage dans un fichier externe. Le \"%s\" ne supporte que les symboles à l'intérieur de l'exécutable."

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
#, object-pascal-format
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr "Le projet écrit les symboles de débogage dans l'exécutable plutôt que dans un fichier externe. Le \"%s\" ne prend en charge que les symboles présents dans un fichier externe."

#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
#, object-pascal-format
msgid "%sThere are additional notes for this message on%s"
msgstr "%sIl existe des notes supplémentaires pour ce message à%s"

#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr "Il n'y a pas de clés en conflit."

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
#, object-pascal-format
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "D'autres fichiers dans le répertoire portent le même nom,%sne différant que par la casse :%s%s%sFaut-il les effacer ?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, object-pascal-format
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "Un fichier porte le même nom et une extension similaire sur le disque%sFichier : %s%sFichier équivoque : %s%sFaut-il effacer le fichier équivoque ?"

#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Il y a déjà un mode de construction portant ce nom."

#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
#, object-pascal-format
msgid "There is already a component class with the name %s."
msgstr "Il existe déjà une classe de composants nommée %s."

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Il existe déjà un composant portant ce nom"

#: lazarusidestrconsts.listhereisalreadyafilein
#, object-pascal-format
msgid "There is already a file%s%s%sin %s"
msgstr "Il existe déjà un fichier%s%s%sdans %s"

#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
#, object-pascal-format
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr "Il existe déjà un fichier \"%s\" dans %s%sAncien : %s%sNouveau : %s%s%sFaut-il continuer ?"

#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, object-pascal-format
msgid "There is already a form with the name \"%s\""
msgstr "Il y a déjà une fiche nommée \"%s\""

#: lazarusidestrconsts.listhereisalreadyamacrowiththename
#, object-pascal-format
msgid "There is already a macro with the name \"%s\"."
msgstr "Il existe déjà une macro nommée \"%s\"."

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
#, object-pascal-format
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Il existe déjà une macro de l'EDI nommée \"%s\""

#: lazarusidestrconsts.listhereisalreadyapackageinthelist
#, object-pascal-format
msgid "There is already a package %s in the list"
msgstr "Il existe déjà un paquet %s dans la liste"

#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
#, object-pascal-format
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr "Il existe déjà une unité \"%s\" dans %s%sAncien : %s%sNouveau : %s%sVous devez vous assurer que le chemin de recherche de l'unité ne contient qu'un seul d'entre eux.%s%sFaut-il continuer?"

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, object-pascal-format
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Une autre unité porte déjà le nom \"%s\". Les identificateurs Pascal doivent être uniques."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, object-pascal-format
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Une unité du projet porte déjà le nom \"%s\".%sVeuillez choisir un nom différent"

#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
#, object-pascal-format
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr "Fpc.exe n'est pas dans le répertoire de %s. D'habitude, l'exécutable Make est installé au même endroit que le compilateur FPC."

#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
#, object-pascal-format
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
msgstr "Il n'y a pas de compilateur Free Pascal (par exemple fpc%0:s ou ppc<cpu>%0:s) configuré dans les options du projet. CodeTools ne fonctionnera pas correctement.%1:s%1:sMessage d'erreur :%1:s%2:s"

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Il doit y avoir au moins un mode de création."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, object-pascal-format
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "La classe de ressource \"%s\" descend de \"%s\". Il s'agit probablement d'une erreur de frappe pour TForm."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
#, object-pascal-format
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Il y a eu une erreur lors de l'écriture du composant sélectionné %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
#, object-pascal-format
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Il y a eu une erreur lors de la conversion du flux binaire du composant sélectionné %s:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
#, object-pascal-format
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Il y a eu une erreur lors de la copie du flux du composant vers le presse-papiers :%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "Le composant racine ne peut être supprimé."

#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Ces fichiers seront effacés"

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Ces paramètres sont enregistrés avec le projet."

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Ces unités n'ont pas été trouvées :"

#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
#, object-pascal-format
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Les codes sources des paquets Free Pascal sont nécessaires pour la navigation et la complétion de code. Par exemple y figure le fichier \"%s\"."

#: lazarusidestrconsts.listhetargetdirectoryisafile
#, object-pascal-format
msgid "The target directory is a file:%s"
msgstr "Le répertoire cible est un fichier : %s"

#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr "Le nom du fichier cible est un répertoire."

#: lazarusidestrconsts.listhetargetisnotwritable
#, object-pascal-format
msgid "The target %s is not writable."
msgstr "La cible %s n'est pas accessible en écriture."

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
#, object-pascal-format
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "Le répertoire de test est introuvable :%s\"%s\"%s(voir les options de l'EDI)"

#: lazarusidestrconsts.listheunitalreadyexists
#, object-pascal-format
msgid "The unit \"%s\" already exists."
msgstr "L'unité \"%s\" existe déjà."

#: lazarusidestrconsts.listheunitbelongstopackage
#, object-pascal-format
msgid "The unit belongs to package %s."
msgstr "L'unité appartient au paquet %s."

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, object-pascal-format
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "L'unité %s existe deux fois dans le chemin des unités %s :"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "L'unité porte ce nom"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, object-pascal-format
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "Le nom de l'unité \"%s\" n'est pas en minuscules.%sLe compilateur FreePascal ne cherche pas toutes les casses. Il est recommandé d'utiliser un nom de fichier en minuscules.%sVoulez-vous renommer le fichier en minuscules ?"

#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
#, object-pascal-format
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "L'unité %s fait partie des codes sources de FPC, mais le fichier XML FPDoc correspondant n'a pas été trouvé.%sSoit vous n'avez pas encore ajouté le répertoire fpcdocs au chemin de recherche ou l'unité n'est pas encore documentée.%sLes fichiers FPDoc pour les sources FPC peuvent être téléchargés depuis : %s%sVeuillez ajouter le répertoire dans les options de l'éditeur de FPDoc.%sPour créer un nouveau fichier dans le répertoire, celui-ci doit être accessible en écriture."

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
#, object-pascal-format
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "L'unité %s est utilisé par d'autres fichiers.%sFaut-il mettre à jour les références automatiquement?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, object-pascal-format
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "L'unité porte déjà le nom \"%s\". Les identificateurs Pascal doivent être uniques."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, object-pascal-format
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "Le chemin de recherche d'unité \"%s\" contient le répertoire des codes sources \"%s\" du paquet %s"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, object-pascal-format
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Le  répertoire de travail \"%s\" n'existe pas.%sVeuillez vérifier le répertoire de travail dans le menu Exécuter>Paramètres d'exécution."

#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
#, object-pascal-format
msgid "This component already contains a class with the name %s."
msgstr "Ce composant contient déjà une classe nommée %s."

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Cette fonction nécessite une ouverture du fichier .lfm dans l'éditeur de source."

#: lazarusidestrconsts.listhishelpmessage
msgid "This help message."
msgstr "Ce message d'aide."

#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr "Il s'agit d'un projet de test pour un paquet de conception. Le test s'effectuera en dehors de l'EDI."

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, object-pascal-format
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Ceci ressemble à un fichier Pascal.%sIl est recommandé d'employer des noms de fichier en minuscules pour éviter divers problèmes avec certains systèmes de fichiers et compilateurs.%sVoulez-vous le renommer en lettres minuscules?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Le projet na pas de fichier de code source principal"

#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Seul le mode de construction par défaut existe pour ce projet."

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, object-pascal-format
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Ce jeu d'options pour construire Lazarus n'est pas pris en charge par cette installation.%sLe répertoire \"%s\" est en lecture seule.%sVoir le site Lazarus pour d'autres façons d'installer Lazarus."

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, object-pascal-format
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Cette instruction ne peut pas être extraite.%sVeuillez sélectionner du code pour en extraire une nouvelle procédure/méthode."

#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr "Cela permettra de changer en une seule fois tous les modes de construction. Pas encore implémenté."

#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Cela va créer une dépendance circulaire."

#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
#, object-pascal-format
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "Ceci remplira le presse-papiers avec beaucoup de texte (%s).%sVoulez-vous poursuivre ?"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Titre"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
#, fuzzy
#| msgid "Title in taskbar shows for example: project1 - Lazarus"
msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus."
msgstr "Le titre de la barre des tâches montre par exemple : project1 - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Titre (laisser vide pour la valeur par défaut)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Chemin :"

#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr "Configuration de la barre d'outils"

#: lazarusidestrconsts.listoolhasnoexecutable
#, object-pascal-format
msgid "tool \"%s\" has no executable"
msgstr "l'outil \"%s\" n'a pas d'exécutable associé"

#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "En-tête d'outil : Échec"

#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "En-tête d'outil : En cours"

#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "En-tête d'outil : Défilé vers le haut"

#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "En-tête d'outil : Succès"

#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "outil arrêté avec le code de sortie %s. Utilisez le menu contextuel pour obtenir plus d'informations."

#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr "outil arrêté avec ExitCode 0 et ExitStatus %s. Utilisez le menu contextuel pour obtenir plus d'informations."

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Haut"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Ancrage en haut"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "L'espace de frontière supérieur. Cette valeur est ajoutée à la base de l'espace de frontière et utilisée pour l'espace au-dessus du contrôle."

#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Procedure hint"
msgstr "Afficher le conseil de Classe/Procédure"

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Hauts"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Il s'agit du contrôle frère auquel le côté supérieur est ancré. Le laisser vide pour l'ancrer au parent comme le ferait Delphi (les propriétés BorderSpacing et ReferenceSide sont sans effet)."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Espacement égal en haut"

#: lazarusidestrconsts.listotalpages
#, object-pascal-format
msgid "Total Pages: %s"
msgstr "Total des pages : %s"

#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "Traduire les messages"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "L'arborescence a besoin d'un rafraichissement"

#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
#, object-pascal-format
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Deux fichiers déplacés auront le même nom de fichier :%s%s%s%s%s dans %s"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Types (non supprimés si aucun remplacement)"

#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Répertoires supplémentaires :"

#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Toutes les unités de paquets"

#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Toutes les unités de l'éditeur de source"

#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Toutes les unités"

#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "Par défaut, seules les unités du projet et les unités de code source de l'éditeur sont parcourues. Ajoutez ici une liste de répertoires, séparés par un point-virgule, à parcourir en plus."

#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Réduire tous les nœuds"

#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Développer tous les nœuds"

#: lazarusidestrconsts.lisudfile
#, object-pascal-format
msgid "File: %s"
msgstr "Fichier : %s"

#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Filtre)"

#: lazarusidestrconsts.lisudimplementationuses
#, object-pascal-format
msgid "Implementation Uses: %s"
msgstr "Clause uses de l'implémentation : %s"

#: lazarusidestrconsts.lisudimplementationuses2
#, object-pascal-format
msgid "implementation uses: %s"
msgstr "clause uses de l'implémentation : %s"

#: lazarusidestrconsts.lisudinterfaceuses
#, object-pascal-format
msgid "Interface Uses: %s"
msgstr "Clause uses de l'interface : %s"

#: lazarusidestrconsts.lisudinterfaceuses2
#, object-pascal-format
msgid "interface uses: %s"
msgstr "clause uses de l'interface : %s"

#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Projets et paquets"

#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Parcours..."

#: lazarusidestrconsts.lisudscanningunits
#, object-pascal-format
msgid "Scanning: %s units ..."
msgstr "Parcours : %s unités..."

#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Recherche)"

#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "Trouver l'occurrence suivante de cette expression"

#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "Trouver l'unité suivante contenant cette expression"

#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "Trouver l'occurrence précédente de cette expression"

#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "Trouver l'unité précédente contenant cette expression"

#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Unités sélectionnées"

#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Afficher les nœuds des répertoires"

#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "Afficher les nœuds des projet et des paquets"

#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Unités"

#: lazarusidestrconsts.lisudunits2
#, object-pascal-format
msgid "Units: %s"
msgstr "Unités : %s"

#: lazarusidestrconsts.lisudusedbyimplementations
#, object-pascal-format
msgid "Used by Implementations: %s"
msgstr "Utilisé par les sections implementation : %s"

#: lazarusidestrconsts.lisudusedbyimplementations2
#, object-pascal-format
msgid "used by implementations: %s"
msgstr "utilisé par les sections implementation : %s"

#: lazarusidestrconsts.lisudusedbyinterfaces
#, object-pascal-format
msgid "Used by Interfaces: %s"
msgstr "Utilisé par les sections interface : %s"

#: lazarusidestrconsts.lisudusedbyinterfaces2
#, object-pascal-format
msgid "used by interfaces: %s"
msgstr "utilisé par les sections interface : %s"

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Ne plus montrer ce message."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Erreur dans l'expression régulière"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Police sans UTF-8"

#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Aller à la ligne :"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Non trouvé"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, object-pascal-format
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Faut-il remplacer cette occurrence de \"%s\"%s par \"%s\" ?"

#: lazarusidestrconsts.lisuesearching
#, object-pascal-format
msgid "Searching: %s"
msgstr "Recherche de : %s"

#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Faut-il poursuivre la recherche depuis le début ?"

#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Faut-il poursuivre la recherche depuis la fin ?"

#: lazarusidestrconsts.lisuesearchstringnotfound
#, object-pascal-format
msgid "Search string '%s' not found!"
msgstr "Chaîne recherchée \"%s\" non trouvée !"

#: lazarusidestrconsts.lisuethecurre
#, object-pascal-format
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "La police courante de l'éditeur ne supporte pas l'UTF-8, mais votre système semble l'employer. %sCela signifie que les caractères non ASCII seront probablement mal affichés. %sVous pouvez choisir une autre police dans les options de l'éditeur."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Effacer le cache d'inclusion"

#: lazarusidestrconsts.lisuidbytes
#, object-pascal-format
msgid "%s bytes"
msgstr "%s octets"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Inclus par :"

#: lazarusidestrconsts.lisuidinproject
msgid "In project:"
msgstr "Dans le projet :"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Lignes :"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Nom :"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "non"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Taille :"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Type :"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "oui"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Afficher les valeurs des outils de code"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Impossible de convertir le flux binaire en texte"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Impossible de copier les composants vers le presse-papiers"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, object-pascal-format
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Impossible d'ajouter le commentaire d'en-tête de la ressource au fichier ressource %s\"%s\".%sProbablement une erreur de syntaxe."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, object-pascal-format
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Impossible d'ajouter la ressource T%s:FORMDATA au fichier ressource %s\"%s\".%sProbablement une erreur de syntaxe."

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
#, object-pascal-format
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr "Impossible d'ajouter une dépendance %s, car le paquet %s a déjà une dépendance %s"

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
#, object-pascal-format
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr "Impossible d'ajouter une dépendance %s, car elle créerait une référence circulaire. Dépendance %s"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
#, object-pascal-format
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Impossible d'ajouter %s au projet, car ce dernier contient déjà une unité portant le même nom."

#: lazarusidestrconsts.lisunabletobackupfileto
#, object-pascal-format
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Impossible de faire une copie de sauvegarde du fichier \"%s\" vers \"%s\" !"

#: lazarusidestrconsts.lisunabletochangeclassofto
#, object-pascal-format
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sImpossible de changer la classe de %s à %s"

#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
#, object-pascal-format
msgid "Unable to change project scaled in source.%s%s"
msgstr "Impossible de modifier le projet mis à l'échelle dans le code source.%s%s"

#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
#, object-pascal-format
msgid "Unable to change project title in source.%s%s"
msgstr "Impossible de changer le titre du projet dans le code source%s%s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Impossible de nettoyer le répertoire de destination"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, object-pascal-format
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Impossible de nettoyer \"%s\".%sVeuillez vérifier les permissions."

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
#, object-pascal-format
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Impossible de convertir le composant texte en format binaire :%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
#, object-pascal-format
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Impossible de convertir le fichier %s\"%sErreur : %s"

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, object-pascal-format
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Impossible de convertir les données texte de la fiche du fichier %s\"%s\"%sen flux binaire. (%s)"

#: lazarusidestrconsts.lisunabletoconverttoencoding
#, object-pascal-format
msgid "Unable to convert to encoding \"%s\""
msgstr "Impossible de convertir avec l'encodage \"%s\""

#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file because there is already a directory with this name."
msgstr "Impossible de créer le nouveau fichier, car il existe déjà un répertoire de ce nom."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Impossible de créer le tampon temporaire pour LFM."

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, object-pascal-format
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Impossible de supprimer le fichier équivoque \"%s\""

#: lazarusidestrconsts.lisunabletoexecute
#, object-pascal-format
msgid "unable to execute: %s"
msgstr "impossible d'exécuter : %s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Impossible de trouver la section Resourcestring dans cette unité ou toute autre utilisée."

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, object-pascal-format
msgid "Unable to find a valid classname in \"%s\""
msgstr "Impossible de trouver un nom de classe correct dans \"%s\""

#: lazarusidestrconsts.lisunabletofindfile
#, object-pascal-format
msgid "Unable to find file \"%s\"."
msgstr "Impossible de trouver le fichier \"%s\"."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, object-pascal-format
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Impossible de trouver le fichier \"%s\".%sS'il appartient à votre projet, vérifiez le chemin de recherche dans%sProjet->Options du projet... -> Options du compilateur->Chemins->Autres fichiers unités. Si ce fichier appartient à un paquet, vérifiez les options de compilation appropriées du paquet. Si ce fichier appartient à Lazarus, assurez-vous que la compilation est propre. Si le fichier appartient à FPC, vérifiez le fichier fpc.cfg. En cas de doute, vérifiez Projet->Options du projet...->Test"

#: lazarusidestrconsts.lisunabletofindinlfmstream
#, object-pascal-format
msgid "Unable to find %s in LFM Stream."
msgstr "Impossible de trouver %s dans le flux LFM."

#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Impossible de trouver la méthode."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, object-pascal-format
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "Impossible de trouver l'unité Pascal (.pas, .pp) du fichier .lfm%s\"%s\""

#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
#, object-pascal-format
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "Impossible de trouver la classe de composant \"%s\".%sElle n'est pas enregistrée via RegisterClass et est introuvable dans le fichier lfm.%sElle est requise par l'unité :%s%s"

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Impossible de recueillir les changements de l'éditeur."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Impossible d'obtenir le code source pour le concepteur de fiche."

#: lazarusidestrconsts.lisunabletoloadfile2
#, object-pascal-format
msgid "unable to load file %s: %s"
msgstr "impossible de charger le fichier %s : %s"

#: lazarusidestrconsts.lisunabletoloadpackage
#, object-pascal-format
msgid "Unable to load package \"%s\""
msgstr "Impossible de charger le paquet \"%s\""

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, object-pascal-format
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "Impossible de charger la classe de composant \"%s\" parce qu'elle dépend d'elle-même."

#: lazarusidestrconsts.lisunabletoopen
#, object-pascal-format
msgid "Unable to open \"%s\""
msgstr "Impossible d'ouvrir \"%s\""

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Impossible d'ouvrir le composant ancêtre"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
#, object-pascal-format
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Impossible d'ouvrir le concepteur de fiches.%sLa classe %s ne descend pas d'une classe comme TForm ou TDataModule."

#: lazarusidestrconsts.lisunabletoread
#, object-pascal-format
msgid "Unable to read %s"
msgstr "Impossible de lire %s"

#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "impossible de lire le statut de sortie du processus"

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, object-pascal-format
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Impossible de supprimer l'ancienne copie de sauvegarde \"%s\" !"

#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
#, object-pascal-format
msgid "Unable to remove project scaled from source.%s%s"
msgstr "Impossible de supprimer le projet mis à l'échelle depuis le code source.%s%s"

#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
#, object-pascal-format
msgid "Unable to remove project title from source.%s%s"
msgstr "Impossible de supprimer du code source le titre du projet.%s%s"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, object-pascal-format
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Impossible de renommer le fichier équivoque \"%s\"%sen \"%s\""

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Impossible de renommer la fiche dans le code source."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Impossible de renommer la méthode. Veuillez corriger l'erreur affichée dans la fenêtre de messages."

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Impossible de renommer la variable dans le code source."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Impossible d'exécuter"

#: lazarusidestrconsts.lisunabletorun2
#, object-pascal-format
msgid "Unable to run \"%s\""
msgstr "Impossible d'exécuter \"%s\""

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Impossible de placer le contrôle d'ancrage latéral"

#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Impossible de montrer la méthode."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Impossible de créer un flux pour les composants sélectionnés"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Impossible de créer un flux pour les composants sélectionnés."

#: lazarusidestrconsts.lisunabletostreamt
#, object-pascal-format
msgid "Unable to stream %s:T%s."
msgstr "Impossible de créer le flux %s:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
#, object-pascal-format
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Impossible de transformer le flux binaire du composant %s:T%s en texte."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Impossible de mettre à jour la déclaration CreateForm dans le code source du projet"

#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Tout décocher"

#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Défaire"

#: lazarusidestrconsts.lisuninstall
#, object-pascal-format
msgid "Uninstall %s"
msgstr "Désinstaller %s"

#: lazarusidestrconsts.lisuninstallfail
msgid "Uninstall failed"
msgstr "La désinstallation a échoué"

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Désinstallation impossible"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Désinstaller la sélection"

#: lazarusidestrconsts.lisuninstallthemtoo
msgid "Uninstall them too"
msgstr "Les désinstaller aussi"

#: lazarusidestrconsts.lisunithaschangedsave
#, object-pascal-format
msgid "Unit \"%s\" has changed. Save?"
msgstr "L'unité \"%s\" a été modifiée. Faut-il l'enregistrer ?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "L'identificateur de l'unité existe"

#: lazarusidestrconsts.lisunitinpackage
#, object-pascal-format
msgid "%s unit %s in package %s"
msgstr "%s unité %s dans le paquet %s"

#: lazarusidestrconsts.lisunitmustsavebeforeinherit
#, object-pascal-format
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
msgstr "L'unité \"%s\" doit être enregistrée avant de pouvoir être héritée. Voulez-vous la sauvegarder maintenant?"

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Nom d'unité déjà existant dans le projet"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Le nom de l'unité commence par..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Le nom de l'unité contient..."

#: lazarusidestrconsts.lisunitnotfound
#, object-pascal-format
msgid "unit %s not found"
msgstr "unité %s introuvable"

#: lazarusidestrconsts.lisunitnotfoundatnewposition
#, object-pascal-format
msgid "unit %s not found at new position \"%s\""
msgstr "unité %s introuvable à la nouvelle position \"%s\""

#: lazarusidestrconsts.lisunitnotfoundinfile
#, object-pascal-format
msgid "A unit not found in file %s"
msgstr "Une unité introuvable dans le fichier %s"

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Répertoire de sortie de l'unité"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "chemin de l'unité"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Chemins des unités"

#: lazarusidestrconsts.lisunitrequirespackage
#, object-pascal-format
msgid "unit %s requires package %s"
msgstr "l'unité %s requiert le paquet %s"

#: lazarusidestrconsts.lisunitsnotfoundinfile
#, object-pascal-format
msgid "Units not found in file %s"
msgstr "Unités introuvables dans le fichier %s"

#: lazarusidestrconsts.lisunusedunitsof
#, object-pascal-format
msgid "Unused units of %s"
msgstr "Unités inutilisées de %s"

#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Nom de fichier du compilateur inhabituel. Normalement, il commence avec fpc, ppc ou ppcross."

#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr "Nom de fichier du compilateur pas2js inhabituel. Normalement, il commence par pas2js."

#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Haut"

#: lazarusidestrconsts.lisupdateapplicationcreateform
msgid "Update Application.CreateForm statements in main unit"
msgstr "Mettre à jour les instructions Application.CreateForm dans l'unité principale"

#: lazarusidestrconsts.lisupdateapplicationscaledstatement
msgid "Update Application.Scaled statement in main unit"
msgstr "Mettre à jour les instructions Application.Scaled dans l'unité principale"

#: lazarusidestrconsts.lisupdateapplicationtitlestatement
msgid "Update Application.Title statement in main unit"
msgstr "Mettre à jour les instructions Application.Title dans l'unité principale"

#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Mettre à jour les informations"

#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Mettre à jour les autres signatures de procédures lorsque seule la casse a changé"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Faut-il mettre à jour les références ?"

#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Mettre à jour"

#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Mettre à jour la configuration"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "chaîne en majuscules"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter."
msgstr "Chaîne de caractères en majuscules donnée en paramètre."

#: lazarusidestrconsts.lisurlonwikithebaseurlis
#, object-pascal-format
msgid "URL on wiki (the base url is %s)"
msgstr "URL du wiki (l'url de base est %s)"

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Message d'utilisation (option -h)"

#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr "Utiliser"

#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Utiliser les chaînes Ansi"

#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Utiliser une case à cocher pour les valeurs booléennes"

#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Utiliser les commentaires des options personnalisées"

#: lazarusidestrconsts.lisusedby
#, object-pascal-format
msgid " used by %s"
msgstr " utilisé par %s"

#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Utiliser les paquets de conception"

#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr "Utilisé pour les fiches auto-créées."

#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr "Utiliser un filtre pour inclure des fichiers supplémentaires"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Utiliser l'identificateur"

#: lazarusidestrconsts.lisuseidentifierinat
#, object-pascal-format
msgid "Use identifier %s in %s at %s"
msgstr "Utiliser l'identificateur %s dans %s à %s"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Lancement de l'application"

#: lazarusidestrconsts.lisusepackageinpackage
#, object-pascal-format
msgid "Use package %s in package %s"
msgstr "Utiliser le paquet %s dans le paquet %s"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Utiliser le paquet dans le paquet"

#: lazarusidestrconsts.lisusepackageinproject
#, object-pascal-format
msgid "Use package %s in project"
msgstr "Utiliser le paquet %s dans le projet"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Utiliser le paquet dans le projet"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
#, object-pascal-format
msgid "Add to list \"%s\""
msgstr "Ajouter à la liste \"%s\""

#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Balisage du texte défini par l'utilisateur"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
#, object-pascal-format
msgid "Remove from list \"%s\""
msgstr "Retirer de la liste \"%s\""

#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
#, object-pascal-format
msgid "Toggle on list \"%s\""
msgstr "Basculer sur la liste \"%s\""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Répertoire \"home\" de l'utilisateur"

#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Ajouter une unité à la clause uses"

#: lazarusidestrconsts.lisuseunitinunit
#, object-pascal-format
msgid "Use unit %s in unit %s"
msgstr "Employer l'unité %s dans l'unité %s"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 avec BOM"

#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Valeur"

#: lazarusidestrconsts.lisvalue2
#, object-pascal-format
msgid "Value%s"
msgstr "Valeur%s"

#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Valeur : "

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Valeurs"

#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr "Les valeurs qui sont différentes des valeurs par défaut sont stockées dans le fichier .lfm et affichées de manière particulière par l'inspecteur d'objets."

#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Variable"

#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr "Verbeux"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Vérifier les appels de méthodes"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Version"

#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Version incompatible"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Vertical"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Copier les informations de version dans le presse-papiers"

#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "Très verbeux"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Afficher le code source (.lfm)"

#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Avertissement : "

#: lazarusidestrconsts.liswarnings
#, object-pascal-format
msgid ", Warnings: %s"
msgstr ", Avertissements : %s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
#, object-pascal-format
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sAvertissement : ceci est l'unité principale. La nouvelle unité principale sera %s.pas."

#: lazarusidestrconsts.liswelcometolazaruside
#, object-pascal-format
msgid "Welcome to Lazarus IDE %s"
msgstr "Bienvenue dans l'EDI Lazarus %s"

#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
#, object-pascal-format
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Bienvenue dans Lazarus %s%sIl y a déjà une configuration de la version %s dans%s%s"

#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Ce qui doit être construit"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Si une unité est renommée, mettre à jour les références"

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr "Lorsqu'elles sont activées, les options en cours sont enregistrées dans le modèle qui sera utilisé pour créer de nouveaux projets"

#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr "Quand il n'y a qu'un seul élément possible d'achèvement de code, l'utiliser immédiatement sans montrer la boîte d'achèvement"

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Quand le curseur de l'éditeur se déplace, montrer le nœud courant dans l'explorateur de code"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr "Le menu Fenêtre montre le nom de la fiche au lieu du titre"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr "Utile principalement lorsque le titre de la fiche est vide."

#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr "La fenêtre reste en avant-plan"

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", avec les inclusions "

#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Sans un compilateur adéquat, la navigation dans le code et la compilation seront décevantes."

#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr "Sans un débogueur approprié, le débogage sera décevant."

#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Sans un répertoire Lazarus approprié, vous obtiendrez de nombreux avertissements."

#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr "Sans un exécutable Make approprié, la compilation de l'EDI n'est pas possible."

#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Sans le code source de FPC, la navigation et la complétion seront très limitées."

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Avec les paquets requis"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Mot sous le curseur dans l'éditeur courant"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Répertoire de construction"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Répertoire d'exécution"

#: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters
msgid "Write config instead of command line parameters"
msgstr "Écrire des paramètres de configuration au lieu de ceux de ligne de commande"

#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr "L'écriture du fichier d'information du paquet a échoué."

#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr "L'écriture du fichier d'information du projet a échoué."

#: lazarusidestrconsts.liswritewhatpackagefilesares
msgid "Write what package files are searched and found."
msgstr "Écrire les fichiers du paquet recherchés et trouvés."

#: lazarusidestrconsts.liswrongversionin
#, object-pascal-format
msgid "wrong version in %s: %s"
msgstr "version erronée dans %s : %s"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Vous pouvez désactiver ceci pour des fiches individuelles dans l'éditeur de paquets"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Vous pouvez désactiver ceci pour des fiches individuelles dans le menu surgissant de l'inspecteur de projet"

#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr "Vous pouvez télécharger FPC et ses codes sources depuis http://sourceforge.net/projects/lazarus/?source=directory"

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Vous ne pouvez pas construire Lazarus pendant que vous déboguez ou compilez."

#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr "Vous ne pouvez pas modifier le mode de construction lors de la compilation."

#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr "Vous pouvez sélectionner les éléments en appuyant simplement sur les lettres soulignées"

#: lazarusidestrconsts.lis_all_
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Tout>"

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Éditeur de source"

#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr "Supprimer si sélectionné"

#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr "incorrect"

#: lazarusidestrconsts.lrspldlpkfileinvalid
#, object-pascal-format
msgid "lpk file invalid (%s)"
msgstr "fichier lpk incorrect (%s)"

#: lazarusidestrconsts.lrspldlpkfilevalid
#, object-pascal-format
msgid "lpk file valid (%s)"
msgstr "fichier lpk correct (%s)"

#: lazarusidestrconsts.lrspldunabletodeletefile
#, object-pascal-format
msgid "Unable to delete file \"%s\""
msgstr "Impossible de supprimer le fichier \"%s\""

#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr "correct"

#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr "Parcourir de nouveau les fichiers lpl"

#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
msgid "Add horizontal spacing between columns"
msgstr "Ajouter l'espacement horizontal entre les colonnes"

#: lazarusidestrconsts.lvlgraphaddverticalspacingar
msgid "Add vertical spacing around nodes"
msgstr "Ajouter l'espacement vertical autour des nœuds"

#: lazarusidestrconsts.lvlgraphextraspacing
msgid "Extra spacing (x/y)"
msgstr "Espacement supplémentaire (x/y)"

#: lazarusidestrconsts.lvlgraphnamesabovenode
msgid "Names above node"
msgstr "Noms au-dessus des nœuds"

#: lazarusidestrconsts.lvlgraphoptabsolutelimi
msgid "Absolute limit for height of levels"
msgstr "Limite absolue pour la hauteur des niveaux"

#: lazarusidestrconsts.lvlgraphoptcrossings
msgid "Crossings"
msgstr "Croisements"

#: lazarusidestrconsts.lvlgraphoptedgelen
msgid "Edge len"
msgstr "Longueur de bord"

#: lazarusidestrconsts.lvlgraphoptedges
msgid "Edges"
msgstr "Bords"

#: lazarusidestrconsts.lvlgraphoptinfo
msgid "Info"
msgstr "Informations"

#: lazarusidestrconsts.lvlgraphoptlevels
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
msgid "Levels"
msgstr "Niveaux"

#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
msgid "Limit height of Levels"
msgstr "Limitez la hauteur des niveaux"

#: lazarusidestrconsts.lvlgraphoptlimitrelativ
#, object-pascal-format
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
msgstr "Limite par rapport au nombre de nœuds pour la hauteur des niveaux.%0sLimite = min(3, val*sqrt(NodeCount))"

#: lazarusidestrconsts.lvlgraphoptsplitpoints
msgid "Splitpoints"
msgstr "Points de partage"

#: lazarusidestrconsts.lvlgraphreducebackedges
msgid "Reduce backedges"
msgstr "Réduire les rebords"

#: lazarusidestrconsts.lvlgraphshapecalculatelay
msgid "Calculate layout from high-edge"
msgstr "Calculer la mise en page à partir du bord élevé"

#: lazarusidestrconsts.lvlgraphshapecurved
msgid "Curved"
msgstr "Courbé"

#: lazarusidestrconsts.lvlgraphshapeedgesshape
msgid "Edges shape"
msgstr "Forme des bords"

#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
msgid "Edges split mode"
msgstr "Mode de fractionnement des bords"

#: lazarusidestrconsts.lvlgraphshapeminimizeedge
msgid "Minimize edges len"
msgstr "Minimiser la longueur des bords"

#: lazarusidestrconsts.lvlgraphshapenodes
msgid "Nodes"
msgstr "Nœuds"

#: lazarusidestrconsts.lvlgraphshapestraight
msgid "Straight"
msgstr "Direct"

#: lazarusidestrconsts.lvlgraphsplitmergeathighe
msgid "Merge at highest"
msgstr "Fusionner au plus haut"

#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
msgid "Merge at source"
msgstr "Fusionner à la source"

#: lazarusidestrconsts.lvlgraphsplitmergeattarge
msgid "Merge at target"
msgstr "Fusionner à la cible"

#: lazarusidestrconsts.lvlgraphsplitnone
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
msgid "None"
msgstr "Aucun"

#: lazarusidestrconsts.lvlgraphsplitseparate
msgid "Separate"
msgstr "Séparer"

#: lazarusidestrconsts.lvlgraphstraightengraph
msgid "Straighten graph"
msgstr "Redresser le graphique"

#: lazarusidestrconsts.optdispgutterchanges
msgid "Changes"
msgstr "Modifications"

#: lazarusidestrconsts.optdispgutterfolding
msgid "Folding"
msgstr "Repliage de code"

#: lazarusidestrconsts.optdispguttermarks
msgid "Marks"
msgstr "Marques"

#: lazarusidestrconsts.optdispgutternocurrentlinecolor
msgid "No current line color"
msgstr "Aucune couleur de ligne en cours"

#: lazarusidestrconsts.optdispgutterseparator
msgid "Separator"
msgstr "Séparateur"

#: lazarusidestrconsts.optdispgutterusecurrentlinecolor
msgid "Use current line color"
msgstr "Utiliser la couleur de ligne en cours"

#: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor
msgid "Use current line number color"
msgstr "Utiliser la couleur du numéro de ligne en cours"

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Ajouter l'unité du paquet à la clause uses"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Ajouter l'inverse"

#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr "Ajouter un terme"

#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Attributs"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Incrémenter automatiquement le numéro de construction"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr "Incrémenté à chaque compilation du projet."

#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "&Construction :"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Jeu de caractères :"

#: lazarusidestrconsts.rscloseall
msgid "Close all pages"
msgstr "Fermer tous les onglets"

#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
msgstr "Fermer l'onglet actif (Ctrl+F4)∥(Ctrl+W)"

#: lazarusidestrconsts.rscloseleft
msgid "Close page(s) on the left"
msgstr "Fermer le(s) onglet(s) de gauche"

#: lazarusidestrconsts.rscloseothers
msgid "Close other page(s)"
msgstr "Fermer tous les autre(s) onglet(s)"

#: lazarusidestrconsts.rscloseright
msgid "Close page(s) on the right"
msgstr "Fermer le(s) onglet(s) de droite"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Définitions conditionnelles"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Créer une nouvelle définition"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Activer i18n"

#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string (Ctrl+F)"
msgstr "Filtrer les lignes dans la liste avec une chaîne de caractères (Ctrl+F)"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found but not listed here: "
msgstr "Trouvé, mais ne figure pas ici : "

#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr "Exclusion"

#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr "Forcer la mise à jour des fichiers PO à la prochaine construction"

#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr "Identificateurs :"

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Options i18n"

#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr "Originaux :"

#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr "L'information de version est enregistrée si le format d'exécutable l'admet."

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Inclure les informations de version dans l'exécutable"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Options de langue"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Sélection de la langue :"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "Version &majeure :"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Version mi&neure :"

#: lazarusidestrconsts.rsnewsearchwithsamecriteria
msgid "New search with same criteria (Ctrl+N)"
msgstr "Nouvelle recherche avec les mêmes critères (Ctrl+N)"

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Autres informations"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Répertoire de sortie PO :"

#: lazarusidestrconsts.rsrefreshthesearch
msgid "Refresh the search (F5)"
msgstr "Rafraîchir la recherche (F5)"

#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Ressource"

#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "Faut-il effacer toutes les ressources ?"

#: lazarusidestrconsts.rsresourcefilename
msgctxt "lazarusidestrconsts.rsresourcefilename"
msgid "File name"
msgstr "Nom de fichier"

#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Type"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Révision :"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Sélectionner une entrée héritée"

#: lazarusidestrconsts.rsshowabspath
msgid "Absolute path"
msgstr "Chemin absolu"

#: lazarusidestrconsts.rsshowfilename
msgctxt "lazarusidestrconsts.rsshowfilename"
msgid "File name"
msgstr "Nom de fichier"

#: lazarusidestrconsts.rsshowpathmode
msgid "Path display mode (Ctrl+P)"
msgstr "Mode d'affichage du chemin (Ctrl+P)"

#: lazarusidestrconsts.rsshowrelpath
msgid "Relative path"
msgstr "Chemin relatif"

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Numérotation de version"

#: lazarusidestrconsts.showoptions
msgid "Show options"
msgstr "Afficher les options"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Commandes du menu Aide"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Commandes Défaire/refaire"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Commandes des outils de code"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Commandes de sélection de colonne de texte"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Commandes de déplacement du curseur"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Commandes d'édition de texte"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Commandes du menu Fichier"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Commandes de pliage de texte"

#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Macros"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text bookmark commands"
msgstr "Commandes des signets"

#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr "Commandes multi-curseurs"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Commandes du menu Paquet"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Commandes du menu Projet"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Commandes du menu Exécuter"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Commandes de recherche et de remplacement"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Commandes de sélection de texte"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Commandes des onglets des codes sources"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Édition synchronisée"

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Édition synchronisée (pas dans une cellule)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Édition synchronisée (pendant la sélection)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Édition du modèle"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Édition de modèle (pas dans une cellule)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Commandes du menu Outils"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Commandes du menu Voir"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Commande :"

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Conflit "

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "interrompre la construction"

#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Méthodes abstraites..."

#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "ajouter point d'arrêt d'adresse"

#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "ajouter un point d'arrêt dans le code source"

#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "ajouter un point de suivi/donnée"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Ajouter un point de saut"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "ajouter un point de suivi"

#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Attacher au programme"

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Développer un modèle de code"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Copier le bloc"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Effacer le bloc"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Aller au début du bloc"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Aller à la fin du bloc"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Cacher le bloc"

#: lazarusidestrconsts.srkmecblockindent
msgid "Indent line/block"
msgstr "Indenter la ligne/le bloc"

#: lazarusidestrconsts.srkmecblockindentmove
msgid "Indent line/block (move columns)"
msgstr "Indenter la ligne/le bloc (déplacer les colonnes)"

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Déplacer le bloc"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Marquer le début de bloc"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Marquer la fin de bloc"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Afficher le bloc"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Inverser le bloc"

#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent line/block"
msgstr "Désindenter la ligne/le bloc"

#: lazarusidestrconsts.srkmecblockunindentmove
msgid "Unindent line/block (move columns)"
msgstr "Désindenter la ligne/le bloc (déplacer les colonnes"

#: lazarusidestrconsts.srkmecbreakpointproperties
msgid "show breakpoint properties"
msgstr "afficher les propriétés du point d'arrêt"

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "construire le programme/projet"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "construire le fichier"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Construire Lazarus"

#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr "créer plusieurs modes"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Caractère"

#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr "nettoyer et construire"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Supprimer tout le texte"

#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Effacer tous les signets"

#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "Effacer les signets pour le fichier en cours"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Sélection de colonne en bas"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Sélection de colonne à la toute fin"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Sélection de colonne au tout début"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Sélection de colonne à gauche"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Sélection de colonne à la fin de la ligne"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Sélection de colonne au début de la ligne"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Sélection de colonne du début du texte dans la ligne"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Sélection de colonne au bas de la page"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Sélection de colonne une page plus bas"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Sélection de colonne en haut de la page"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Sélection de colonne une page plus haut"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Sélection de colonne à droite"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Sélection de colonne au dessus"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Sélection de colonne un mot à gauche"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Sélection de colonne un mot à droite"

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Mode de sélection par colonne"

#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "compiler le programme/projet"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "fichier de configuration de la construction"

#: lazarusidestrconsts.srkmeccopy
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Copier"

#: lazarusidestrconsts.srkmeccopyadd
msgid "Copy (Add to Clipboard)"
msgstr "Copier (ajouter au presse-papiers)"

#: lazarusidestrconsts.srkmeccopyaddcurrentline
msgid "Copy current line (Add to Clipboard)"
msgstr "Copier la ligne en cours (ajouter au presse-papiers)"

#: lazarusidestrconsts.srkmeccopycurrentline
msgid "Copy current line"
msgstr "Copier la ligne en cours"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Copier l'éditeur vers une nouvelle fenêtre"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Copier l'éditeur vers la fenêtre libre suivante"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Copier l'éditeur vers la  fenêtre libre précédente"

#: lazarusidestrconsts.srkmeccut
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Couper"

#: lazarusidestrconsts.srkmeccutadd
msgid "Cut (Add to Clipboard)"
msgstr "Couper (ajouter au presse-papiers)"

#: lazarusidestrconsts.srkmeccutaddcurrentline
msgid "Cut current line (Add to Clipboard)"
msgstr "Couper la ligne en cours (ajouter au presse-papiers)"

#: lazarusidestrconsts.srkmeccutcurrentline
msgid "Cut current line"
msgstr "Couper la ligne encours"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Supprimer le début de la ligne"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Supprimer le caractère sous le curseur"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Supprimer la fin de la ligne"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Supprimer le dernier caractère"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Supprimer le début du mot"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Supprimer la ligne courante"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Supprimer la fin du mot"

#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Détacher du programme"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Différences"

#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "Déplacer le curseur vers le bas"

#: lazarusidestrconsts.srkmecduplicateline
msgid "Duplicate line (or lines in selection)"
msgstr "Dupliquer la ligne (ou les lignes sélectionnées)"

#: lazarusidestrconsts.srkmecduplicateselection
msgid "Duplicate selection"
msgstr "Dupliquer la sélection"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Déplacer le curseur à la toute fin"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Déplacer le curseur au tout début"

#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Méthodes vides..."

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Options de l'EDI"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "évaluer/modifier"

#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Extraire la procédure"

#: lazarusidestrconsts.srkmecexttool
#, object-pascal-format
msgid "External tool %d"
msgstr "Outil externe %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Paramètres des outils externes"

#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Chercher le texte"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Chercher la fin d'un bloc"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Chercher le début d'un bloc"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Chercher la déclaration"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Chercher les références de l'identificateur"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Chercher dans les fichiers"

#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Chercher l'occurrence suivante"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Chercher l'occurrence de mot suivante"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr "Chercher les surcharges"

#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr "Chercher les surcharges..."

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Chercher l'occurrence précédente"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Chercher l'occurrence de mot précédente"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Chercher la définition de la procédure"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr "Chercher la méthode"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Replier au curseur"

#: lazarusidestrconsts.srkmecfoldlevel
#, object-pascal-format
msgid "Fold to Level %d"
msgstr "Replier au niveau %d"

#: lazarusidestrconsts.srkmecgotoeditor
#, object-pascal-format
msgid "Go to editor %d"
msgstr "Aller à l'éditeur %d"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Aller à la directive d'inclusion du fichier d'inclusion courant"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Aller au numéro de ligne"

#: lazarusidestrconsts.srkmecgotomarker
#, object-pascal-format
msgid "Go to bookmark %d"
msgstr "Aller au signet %d"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Aller en XY"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Deviner les $IFDEF mal placés"

#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr "Déplacer le curseur d'un demi-mot à gauche (ex. : MotPas)"

#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr "Déplacer le curseur d'un demi-mot à droite (ex. : PasMot)"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Ajouter une entrée au journal des modifications"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Insérer depuis la table des caractères"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Insérer le mot-clé CVS Author"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Insérer le mot-clé CVS Date"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Insérer le mot-clé CVS Header"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Insérer le mot-clé CVS ID"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Insérer le mot-clé CVS Log"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Insérer le mot-clé CVS Name"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Insérer le mot-clé CVS Revision"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Insérer le mot-clé CVS Source"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Insérer la date et l'heure courantes"

#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Insérer le nom de fichier complet"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Insérer la notice GPL"

#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr "Insérer la notice GPL (traduite)"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "Insérer un GUID"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Insérer la notice LGPL"

#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr "Insérer la notice LGPL (traduite)"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Couper la ligne sans affecter le curseur"

#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr "Insérer la notice MIT"

#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr "Insérer la notice MIT (traduite)"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Mode insertion"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Insérer la notice modifiée LGPL"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr "Insérer la notice modifiée LGPL (traduite)"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Insérer le nom d'utilisateur"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "inspecter"

#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Inverser l'affectation"

#: lazarusidestrconsts.srkmeckeymapleft
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Gauche"

#: lazarusidestrconsts.srkmeckeymapright
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Droite"

#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "Déplacer le curseur vers la gauche"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Couper la ligne et déplacer le curseur"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Déplacer le curseur en fin de ligne"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Mode sélection de ligne"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Déplacer le curseur en début de ligne"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Déplacer le curseur au début du texte de la ligne"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Verrouiller l'éditeur"

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "Créer une chaîne ressource"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Aller à la parenthèse appariée"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Déplacer l'éditeur vers la gauche"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Déplacer l'éditeur tout à gauche"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Déplacer l'éditeur vers une nouvelle fenêtre"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Déplacer l'éditeur vers la fenêtre suivante libre"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Déplacer l'éditeur vers la première fenêtre libre"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Déplacer l'éditeur vers la droite"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Déplacer l'éditeur tout à droite"

#: lazarusidestrconsts.srkmecmovelinedown
msgid "Move line down"
msgstr "Déplacer la ligne vers le bas"

#: lazarusidestrconsts.srkmecmovelineup
msgid "Move line up"
msgstr "Déplacer la ligne vers le haut"

#: lazarusidestrconsts.srkmecmoveselectdown
msgid "Move selection down"
msgstr "Déplacer la sélection vers le bas"

#: lazarusidestrconsts.srkmecmoveselectleft
msgid "Move selection left"
msgstr "Déplacer la sélection vers la gauche"

#: lazarusidestrconsts.srkmecmoveselectright
msgid "Move selection right"
msgstr "Déplacer la sélection vers la droite"

#: lazarusidestrconsts.srkmecmoveselectup
msgid "Move selection up"
msgstr "Déplacer la sélection vers le haut"

#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr "Collage multiple"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Signet suivant"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Aller à l'éditeur suivant"

#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr "Aller à l'éditeur suivant dans l'historique"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Aller à l'éditeur suivant avec le même code source"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Aller à la fenêtre suivante"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Mode de sélection normal"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "Ouvrir le fichier sous le curseur"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Mode recouvrement"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Déplacer le curseur au bas de la page"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Déplacer le curseur d'une page vers le bas"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Déplacer le curseur d'une page à gauche"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Déplacer le curseur d'une page à droite"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Déplacer le curseur en haut de la page"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Déplacer le curseur d'une page vers le haut"

#: lazarusidestrconsts.srkmecpaste
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Coller"

#: lazarusidestrconsts.srkmecpasteascolumns
msgid "Paste (as Columns)"
msgstr "Coller (en tant que colonnes)"

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "suspendre le programme"

#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr "Effacer tous les curseurs supplémentaires"

#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr "Les touches du curseur principal effacent tous les autres curseurs"

#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr "Les touches du curseur principal déplacent tous les autres curseurs"

#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr "Ajouter un curseur"

#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr "Inverser le curseur supplémentaire"

#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr "Supprimer une curseur supplémentaire"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Signet précédent"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Aller à l'éditeur précédent"

#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr "Aller à l'éditeur précédent dans l'historique"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Aller au précédent éditeur avec le même code source"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Aller à la fenêtre précédente"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "compilation rapide, pas d'édition de liens"

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "supprimer le point d'arrêt"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Supprimer les méthodes vides"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Supprimer les unités non utilisées"

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Renommer l'identificateur"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Texte à remplacer"

#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Signalement d'un bogue"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "réinitialiser le débogueur"

#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "Déplacer le curseur vers la droite"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "exécuter le programme"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "exécuter le fichier"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "paramètres d'exécution"

#: lazarusidestrconsts.srkmecrunwithdebugging
msgid "run with debugging"
msgstr "exécuter avec débogage"

#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr "exécuter sans débogage"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Faire défiler d'une ligne vers le bas"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Faire défiler d'un caractère vers la gauche"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Faire défiler d'un caractère vers la droite"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Faire défiler d'une ligne vers le haut"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Sélectionner Bas"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Tout sélectionner"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Convertir les tabulations de la sélection en espaces"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Sélectionner jusqu'à la toute fin"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Sélectionner jusqu'au tout début"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Sélectionner Aller en XY"

#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr "Sélectionner le demi-mot à gauche (ex. : MotPas)"

#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr "Sélectionner le demi-mot à droite (ex. : PasMot)"

#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr "Sélectionner Gauche"

#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Sélectionner Fin de Ligne"

#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Sélectionner Début de Ligne"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Sélectionner le début du texte dans la ligne"

#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Sélectionner Bas de Page"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Sélectionner Page Bas"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Sélectionner Page Gauche"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Sélectionner Page Droite"

#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Sélectionner Haut de Page"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Sélectionner Page Haut"

#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr "Sélectionner Droite"

#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr "Sélection intelligente du mot à gauche (début et fin de mot)"

#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr "Sélection intelligente du mot à droite (début et fin de mot)"

#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr "Débuter la sélection collante"

#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr "Débuter la sélection collante (colonnes)"

#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr "Débuter la sélection collante (ligne)"

#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr "Arrêter la sélection collante"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Sélectionner Haut"

#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Sélectionner la fin du mot de gauche"

#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Sélectionner la fin du mot de droite"

#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Sélectionner le mot de gauche"

#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Sélectionner le mot de droite"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Placer un signet libre"

#: lazarusidestrconsts.srkmecsetmarker
#, object-pascal-format
msgid "Set bookmark %d"
msgstr "Définir le signet %d"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Maj-Tab"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Afficher les méthodes abstraites"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr "Afficher le contexte de code"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "montrer le point d'exécution"

#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr "Mouvement intelligent du curseur à gauche (début et fin de mot)"

#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr "Mouvement intelligent du curseur à droite (début et fin de mot)"

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "arrêter le programme"

#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Exécuter la macro"

#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Enregistrer une macro"

#: lazarusidestrconsts.srkmecsynpsyncroedaddcell
msgid "Add Cell"
msgstr "Ajouter une cellule"

#: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase
msgid "Add Cell (case-sensitive)"
msgstr "Ajouter une cellule (sensible à la casse)"

#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx
msgid "Add Cell (context-sensitive)"
msgstr "Ajouter une cellule (sensible au contexte)"

#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase
msgid "Add Cell (context & case-sensitive)"
msgstr "Ajouter une cellule (sensible au contexte et à la casse)"

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Aller à la dernière position dans la cellule"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Aller à la première position dans la cellule"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Sélectionner la cellule"

#: lazarusidestrconsts.srkmecsynpsyncroeddelcell
msgid "Remove current Cell"
msgstr "Supprimer la cellule en cours"

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Échappement"

#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft
msgid "Grow cell on the left"
msgstr "Agrandir la cellule à gauche"

#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright
msgid "Grow cell on the right"
msgstr "Agrandir la cellule à droite"

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Cellule suivante"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Cellule suivante (toutes sélectionnées)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Cellule suivante (premières seulement)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Cellule suivante (toutes sélectionnées/premières seulement)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Cellule précédente"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Cellule précédente (toutes sélectionnées)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Cellule précédente (premières seulement)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Cellule précédente (toutes sélectionnées/premières seulement)"

#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft
msgid "Shrink cell on the left"
msgstr "Réduire la cellule à gauche"

#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright
msgid "Shrink cell on the right"
msgstr "Réduire la cellule à droite"

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Démarrer l'édition synchronisée"

#: lazarusidestrconsts.srkmecsynpsyncroedstartcase
msgid "Start Syncro edit (case-sensitive)"
msgstr "Démarrer l'édition syncro (sensible à la casse)"

#: lazarusidestrconsts.srkmecsynpsyncroedstartctx
msgid "Start Syncro edit (context-sensitive)"
msgstr "Démarrer l'édition syncro (sensible au contexte)"

#: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase
msgid "Start Syncro edit (context & case-sensitive)"
msgstr "Démarrer l'édition syncro (sensible au contexte et à la casse)"

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Aller à la dernière position dans la cellule"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Aller à la première position dans la cellule"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Sélectionner la cellule"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Échappement"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Achever"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Cellule suivante"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Cellule suivante (rotation)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Cellule suivante (toutes sélectionnées)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Cellule suivante (rotation/toutes sélectionnées)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Cellule suivante (premières seulement)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr "Cellule suivante (rotation/premières seulement)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Cellule suivante (toutes sélectionnées/premières seulement)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr "Cellule suivante (rotation/toutes sélectionnées/premières seulement)"

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Cellule précédente"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Cellule précédente (toutes sélectionnées)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Cellule précédente (premières seulement)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Cellule précédente (toutes sélectionnées/premières seulement)"

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Vérification de la syntaxe"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Afficher l'assembleur"

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "inverser le point d'arrêt"

#: lazarusidestrconsts.srkmectogglebreakpointenabled
msgid "enable/disable breakpoint"
msgstr "activer/désactiver le point d'arrêt"

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Afficher les points d'arrêt"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Afficher la pile d'appels"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Afficher le navigateur de code"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Afficher l'explorateur de code"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Afficher la palette de composants"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Afficher la sortie du débogueur"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Basculer entre fiche et unité"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Afficher l'éditeur de documentation"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Afficher les boutons rapides de l'EDI"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Afficher les variables locales"

#: lazarusidestrconsts.srkmectogglemarker
#, object-pascal-format
msgid "Toggle bookmark %d"
msgstr "Inverser le signet %d"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Inverser le surlignage du mot en cours"

#: lazarusidestrconsts.srkmectogglememviewer
msgctxt "lazarusidestrconsts.srkmectogglememviewer"
msgid "View Mem viewer"
msgstr "Voir le visualiseur de mémoire"

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Afficher les messages"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Inverser le mode"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Afficher l'inspecteur d'objets"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Afficher les registres"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Afficher le navigateur de restrictions"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Afficher les résultats de recherche"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Afficher l'éditeur de source"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Afficher les points de suivi"

#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Tout déplier"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Déplier au curseur"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "commande d'édition inconnue"

#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Unités inutilisées..."

#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "Déplacer le curseur vers le haut"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Afficher l'éditeur d'ancres"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Afficher les composants"

#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Afficher les macros de l'éditeur"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Afficher les fiches"

#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Afficher l'historique"

#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr "Afficher l'entrée et la sortie de la console"

#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Afficher l'ordre de tabulation"

#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Afficher les tâches"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Afficher les dépendances de l'unité"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Afficher les informations de l'unité"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Afficher les unités"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Compléter le mot"

#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "Curseur vers la fin du mot à gauche"

#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "Curseur vers la fin du mot à droite"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Déplacer le curseur d'un mot à gauche"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Déplacer le curseur d'un mot à droite"

#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr "Zoomer"

#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr "Dézoomer"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Éditer les touches de commande"

#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr "Continuer avec la prochaine action de bouton de souris relâché"

#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr "Replier les commentaires"

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Replier les commentaires de la sélection"

#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr "Replier les Ifdef inactifs"

#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr "Replier les Ifdef inactifs (exclure les états mixtes)"

#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr "Replier les Ifdef inactifs de la sélection"

#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr "Replier les Ifdef inactifs de la sélection (exclure les états mixtes)"

#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Cacher les commentaires"

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Cacher les commentaires de la sélection"

#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr "Dernier bouton pressé identique"

#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr "Même ligne de texte que sur clic"

#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr "Mêmes touches modificatrices que sur clic"

#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr "Même action que sur clic à cet endroit"

#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr "Rechercher toutes les actions du bouton de la souris enfoncé"

#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr "Déplier les Ifdef actifs"

#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr "Déplier les Ifdef actifs de la sélection"

#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Tout déplier"

#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr "Déplier tous les Ifdef"

#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr "Déplier tous les Ifdef de la sélection"

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr "Tout déplier dans la sélection"

#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr "Déplier les commentaires"

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr "Déplier les commentaires de la sélection"

#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr "Déplier les Ifdef inactifs"

#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr "Déplier les Ifdef inactifs de la sélection"

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Le fichier est en lecture seule"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Le fichier \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" ne peut pas être modifié."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Verrouillé"

#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Enregistrement"

#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Pause-enregistrement"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Ajouter un point de &Suivi sous le curseur"

#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "Ajouter un &Point de suivi sous le curseur"

#: lazarusidestrconsts.uembookmarknset
#, object-pascal-format
msgid "Bookmark &%s: %s"
msgstr "Signet &%s : %s"

#: lazarusidestrconsts.uembookmarknunset
#, object-pascal-format
msgid "Bookmark &%s"
msgstr "Signet &%s"

#: lazarusidestrconsts.uembookmarknunsetdisabled
#, object-pascal-format
msgid "Bookmark %s"
msgstr "Signet %s"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Fermer t&ous les autres onglets"

#: lazarusidestrconsts.uemcloseotherpagesplain
msgid "Close All Other Pages"
msgstr "Fermer tous les autres onglets"

#: lazarusidestrconsts.uemcloseotherpagesright
msgid "Close Pages on the &Right"
msgstr "Fermer les onglets à &droite"

#: lazarusidestrconsts.uemcloseotherpagesrightplain
msgid "Close Pages on the Right"
msgstr "Fermer les onglets à droite"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Fermer l'onglet"

#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Copier le nom du fichier"

#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Cloner vers une nouvelle fenêtre"

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Cloner vers une autre fenêtre"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Nouvelle fenêtre"

#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Déboguer"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Encodage"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "&Évaluer/modifier..."

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Chercher la déclaration"

#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Chercher dans une autre fenêtre"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Aller au signet"

#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr "Aller au signet..."

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Surligneur"

#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "&Inspecter..."

#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Inverser l'affectation"

#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Fin de la ligne"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "&Verrouiller la page"

#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Vers la gauche"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Le plus à gauche possible"

#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Vers la droite"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Le plus à droite possible"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Déplacer vers une nouvelle fenêtre"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Déplacer vers une autre fenêtre"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Nouvelle Fenêtre"

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Aller au signet suivant"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Modifié"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "&Ouvrir le fichier sous le curseur"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Aller au signet précédent"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Aller à la procédure"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Lecture seule"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Retravailler"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Placer un signet libre"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Afficher les numéros de ligne"

#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Source"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "Inver&ser le signet"

#: lazarusidestrconsts.uemtogglebookmarknset
#, object-pascal-format
msgid "Toggle Bookmark &%s: %s"
msgstr "Inverser le signet &%s : %s"

#: lazarusidestrconsts.uemtogglebookmarknunset
#, object-pascal-format
msgid "Toggle Bookmark &%s"
msgstr "Inverser le signet &%s"

#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr "Inverser le signet..."

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "&Inverser le point d'arrêt"

#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Afficher la pile d'appels"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Non implémenté à ce jour"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "REC"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Lecture seule"

#: lazarusidestrconsts.uepselchars
#, object-pascal-format
msgid "%d"
msgstr "%d"

#: lazarusidestrconsts.uepselcol
msgid "COL"
msgstr "COL"

#: lazarusidestrconsts.uepselcxchars
#, object-pascal-format
msgid "%d * %d"
msgstr "%d * %d"

#: lazarusidestrconsts.uepselline
msgctxt "lazarusidestrconsts.uepselline"
msgid "LINE"
msgstr "LIGNE"

#: lazarusidestrconsts.uepselnorm
msgid "DEF"
msgstr "DEF"

#: lazarusidestrconsts.unitdepoptionsforpackage
msgid "Options for Package graph"
msgstr "Options du graphe des paquets"

#: lazarusidestrconsts.unitdepoptionsforunit
msgid "Options for Unit graph"
msgstr "Options du graphe des unités"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Informations sur la version"