File: lazaruside.hu.po

package info (click to toggle)
lazarus 4.0%2Bdfsg-3
links: PTS, VCS
area: main
in suites: forky, sid, trixie
size: 275,760 kB
sloc: pascal: 2,341,904; xml: 509,420; makefile: 348,726; cpp: 93,608; sh: 3,387; java: 609; perl: 297; sql: 222; ansic: 137
file content (21637 lines) | stat: -rw-r--r-- 725,372 bytes
msgid ""
msgstr ""
"Project-Id-Version: \n"
"POT-Creation-Date: \n"
"PO-Revision-Date: \n"
"Last-Translator: Péter Gábor <ptrg@freemail.hu>\n"
"Language-Team: Magyar (Hungarian)\n"
"Language: hu\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=UTF-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Generator: Poedit 2.0.6\n"

#: lazarusidestrconsts.cocoamfstbicommand
msgid "Command"
msgstr ""

#: lazarusidestrconsts.cocoamfstbijumpback
#, fuzzy
msgctxt "lazarusidestrconsts.cocoamfstbijumpback"
msgid "Jump Back"
msgstr "Ugrás vissza"

#: lazarusidestrconsts.cocoamfstbijumpforward
#, fuzzy
msgctxt "lazarusidestrconsts.cocoamfstbijumpforward"
msgid "Jump Forward"
msgstr "Ugrás előre"

#: lazarusidestrconsts.cocoamfstbisearch
msgid "Search Instantly"
msgstr ""

#: lazarusidestrconsts.dbgasmwindowlinktarget
msgid "Link target line"
msgstr ""

#: lazarusidestrconsts.dbgasmwindowsourcefunc
msgid "Function name"
msgstr ""

#: lazarusidestrconsts.dbgasmwindowsourceline
msgid "Source line"
msgstr ""

#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
#, object-pascal-format
msgid "Address Breakpoint %s"
msgstr "Töréspont adott címen %s"

#: lazarusidestrconsts.dbgeventbreakataddress
#, object-pascal-format
msgid "at $%s"
msgstr "itt: $%s"

#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
#, object-pascal-format
msgid "at $%s: from origin %s line %d"
msgstr "itt: $%s (eredete: %s, %d. sor)"

#: lazarusidestrconsts.dbgeventbreakataddresssourceline
#, object-pascal-format
msgid "at $%s: %s line %d"
msgstr "itt: $%s (%s, %d. sor)"

#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
#, object-pascal-format
msgid "Source Breakpoint %s"
msgstr "Töréspont a forráskódban %s"

#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
#, object-pascal-format
msgid "Unknown Breakpoint %s"
msgstr "Ismeretlen töréspont %s"

#: lazarusidestrconsts.dbgeventbreakwatchpoint
#, object-pascal-format
msgid "Watchpoint %s"
msgstr "Figyelési pont %s"

#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
#, object-pascal-format
msgid "Unknown Watchpoint out of scope %s"
msgstr "Ismeretlen figyelési pont a hatókörön kívül %s"

#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
#, object-pascal-format
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Ismeretlen figyelési pont aktiválódott %s. Régi érték \"%s\", Új érték \"%s\""

#: lazarusidestrconsts.dbgeventwatchscopeended
#, object-pascal-format
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr "A(z) \"%s\" figyelési pontja a hatókörön kívül esik %s"

#: lazarusidestrconsts.dbgeventwatchtriggered
#, object-pascal-format
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "A(z) \"%s\" figyelési pontja aktiválódott %s. Régi érték \"%s\", Új érték \"%s\""

#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Előre megadott séma használata"

#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Minden beállítás visszaállítása"

#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Minden hasábköz-beállítás visszaállítása"

#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Minden szövegbeállítás visszaállítása"

#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Előzmény-pont hozzáadása"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Helyi menü"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Helyi menü (hibakeresés)"

#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Helyi menü (tab)"

#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Ugrás a kidolgozáshoz"

#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Ugrás a kidolgozáshoz/blokk másik végéhez"

#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Előzmények közt vissza"

#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Előzmények közt előre"

#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr "Extra beszúrási jel ki/be"

#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Semmi/Alapértelmezett"

#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Beillesztés"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
#, object-pascal-format
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Folytatás: %0:s (Eddig: %1:s)"

#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
#, object-pascal-format
msgid "Continue %0:s"
msgstr "Folytatás: %0:s"

#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Szöveg kijelölése"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Szöveg kijelölése (sorok)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Szöveg kijelölése (szimbólum)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Szöveg kijelölése (szavak)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Szöveg kijelölése (oszlop mód)"

#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Szöveg kijelölése (sor mód)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Üres könyvjelző beállítása"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Aktuális sor kijelölése (Teljes)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Aktuális sor kijelölése (Szöveg)"

#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Aktuális bekezdés kijelölése"

#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Aktuális szó kijelölése"

#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Nagyítás alapállapotra"

#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Ez a lap nem jeleníti meg az összes aktuális beállítást. Nézze meg a bővebb beállítások lapját. Használja ezt a lapot a bővebb beállítások alaphelyzetbe állításához."

#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Általános"

#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Szabványos, minden művelet (töréspont, összecsukás) egérgomb lenyomására"

#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Kibővített, műveletek (töréspont, összecsukás) egérgomb felengedésére. Kijelölés egérgomb lenyomására és mozgatás"

#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr "Kibővített, műveletek csak a hasábköz jobb felén"

#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr "Sorszámok használata a sor kijelöléséhez"

#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Hasábköz"

#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right button click includes caret move"
msgstr "A jobb egérgomb a beszúrási jelet is mozgatja"

#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Szöveg"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl Kerék"

#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt Kerék"

#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Ctrl Kerék"

#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Kijelölés húzása (másolás/beillesztés)"

#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Extra-1 Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Extra-2 Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt Kétszeres"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl Kétszeres"

#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Kétszeres"

#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Shift Kétszeres"

#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Négyszeres"

#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Háromszoros"

#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Középső gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Középső"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
msgid "Horizontal-Wheel"
msgstr "Vízszintes kerék"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Bal 1"

#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Bal 2"

#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Jobb"

#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Kerék"

#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Jobb gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Shift-Alt-Ctrl Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Shift-Alt-Ctrl"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Shift-Alt Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Shift-Alt Kerék"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Shift-Ctrl Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Shift-Ctrl Kerék"

#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Shift Gomb"

#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Kerék"

#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Shift Kerék"

#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "El nem mentett változások vannak. Ezen lap használata visszavonja a haladó lapon történt változásokat"

#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Vízszintes görgetés (rendszer sebesség)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Vízszintes görgetés (egy sor)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Vízszintes görgetés (oldal)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Vízszintes görgetés (fél oldal)"

#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Vízszintes görgetés (oldal, legalább egy sor)"

#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Semmi/Alapértelmezett"

#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Görgetés (rendszer sebesség)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Görgetés (egy sor)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Görgetés (oldal)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Görgetés (fél oldal)"

#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Görgetés (oldal, legalább egy sor)"

#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Nagyítás"

#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Semmi >"

#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Csak olvasható"

#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Kisbetűs, első betű nagy"

#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr "aktív"

#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Értékadás operátor hozzáadása :="

#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Zárójelek kiemelése"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Kód összecsukási fa"

#: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur
msgid "Code folding (current)"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Alapértelmezett szöveg"

#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr "Alapértelmezett szöveg / Ablak"

#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Letiltott töréspont"

#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Engedélyezett töréspont"

#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Hibás sor"

#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Végrehajtási pont"

#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Összecsukott kód jelző"

#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr "Összecsukott szakasz első sora"

#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Globális"

#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Hasábköz"

#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Sor"

#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr "Körvonal színei"

#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Szinkron szerkesztés"

#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Sablon szerkesztése"

#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Szöveg"

#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Hasábköz elválasztó"

#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr "Elrejtett szakasz első sora"

#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Bővített keresés szava"

#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr "Előtag kiemelése"

#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Aktuális kifejezés kiemelése"

#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Bővített keresés"

#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Érvénytelen töréspont"

#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Aktuális sor kiemelése"

#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Sorszám"

#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Módosított sor"

#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Egér hivatkozás"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
msgid "Level 10"
msgstr "10. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
msgid "Level  1"
msgstr "1. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
msgid "Level  2"
msgstr "2. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
msgid "Level  3"
msgstr "3. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
msgid "Level  4"
msgstr "4. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
msgid "Level  5"
msgstr "5. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
msgid "Level  6"
msgstr "6. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
msgid "Level  7"
msgstr "7. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
msgid "Level  8"
msgstr "8. szint"

#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
msgid "Level  9"
msgstr "9. szint"

#: lazarusidestrconsts.dlgaddhiattrrecentlyused
msgid "Recently used item"
msgstr ""

#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Kijelölt terület"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Aktív cella"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Többi cella"

#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Szinkronizált cellák"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Aktív cella"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Többi cella"

#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Szinkronizált cellák"

#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Szöveg blokk"

#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Ismeretlen töréspont"

#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr "Ablak kerete"

#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Szó-zárójelek"

#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Megjelenített speciális karakterek"

#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr "Új mód hozzáadása"

#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Pontosvessző hozzáadása"

#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Felső sor igazítása az előtte lévő megjegyzéshez"

#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "Ábécérendben"

#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always keep caret in visible area of editor"
msgstr "A beszúrási jel mindig maradjon a szerkesztő látható területén"

#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Nem egyértelmű fájlművelet:"

#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Riasztás fordításkor"

#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr "Ikon jelenik meg a hiba/figyelmeztetés/tipp üzenetek előtt. Ugyanez az ikon jelenik meg a forráskód szerkesztő szélén minden esetben."

#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr "Ansi (* *)"

#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Alkalmazás beállításai"

#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Infókimenet-kód beépítése (assertion code)"

#: lazarusidestrconsts.dlgassociateddebugdesktop
#, object-pascal-format
msgid "Associated debug desktop for \"%s\""
msgstr "Társított hibakereső felület ehhez: \"%s\""

#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr "Egy felület kiválasztásakor a társított hibakereső felület is ki lesz választva."

#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Form-ok automatikus létrehozása:"

#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr "A fő .lpr unit létrehozza az összes form-ot az Application.CreateForm() eljárással. Ezek automatikusan meg is lesznek szüntetve."

#: lazarusidestrconsts.dlgautocreatenewforms
msgid "Auto-create new forms"
msgstr "Új form-ok automatikus létrehozása"

#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Fájl automatikus törlése"

#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Művelet-prototípusok automatikus megjelenítése"

#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse pointer when typing"
msgstr "Egér mutatójának elrejtése gépelés közben"

#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Automatikus behúzás"

#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Okos behúzás beállítása)"

#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Automatikus behúzás"

#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Üres metódusok automatikus eltávolítása"

#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Fájlok automatikus átnevezése kisbetűsre"

#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr "Az aktív felület automatikus mentése"

#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end"
msgstr ""
"Az aktív felület mentése az IDE bezárásakor\n"
"Hibakereső felület mentése az IDE bezárásakor és a hibakeresés végén"

#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Elérhető form-ok:"

#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr "E form-okat a program kódjában kell létrehozni és megszüntetni."

#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr "Szükségtelen ugrások mellőzése"

#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Háttér"

#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(nincs alkönyvtár)"

#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "Azonos név (alkönyvtárban)"

#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "Metódusok után"

#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Kijelölés"

#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr "Blokk behúzás (szóközök)"

#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Blokk behúzás"

#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(Billentyűk szerkesztése)"

#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Szóköz/tabulátor az előző sor alapján"

#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Csak pozíció"

#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Szóközök"

#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "Tabulátorok, levágás"

#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "Tabulátorok, aztán szóközök"

#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Blokk behúzás (tab-ok)"

#: lazarusidestrconsts.dlgbookmarksetscroll
msgid "Restore scroll position for bookmarks"
msgstr ""

#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
#, fuzzy
#| msgid "Border space can be set in Anchor editor. A red line is shown if spacing > 0."
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
msgstr "A keret-térköz beállítható a Horgonyszerkesztőben. Egy piros vonal jelenik meg ha a távolság > 0."

#: lazarusidestrconsts.dlgborderspacingcolor
msgid "BorderSpacing frame"
msgstr ""

#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Zárójel kiemelése"

#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket and quote pairs"
msgstr "Illeszkedő zárójel és idézőjel párok"

#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr "Dokkolt felületek nem használhatók nem dokkolt környezetben és fordítva."

#: lazarusidestrconsts.dlgcaretbackcolor
#, fuzzy
#| msgid "Multi/2nd (NotXor)"
msgid "Secondary carets (multi-caret mode)"
msgstr "Többszörös/második (NotXor)"

#: lazarusidestrconsts.dlgcaretcolor
#, fuzzy
#| msgid "Caret"
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret (Text-Cursor)"
msgstr "Beszúrási jel"

#: lazarusidestrconsts.dlgcaretcolorinfo
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
msgstr ""

#: lazarusidestrconsts.dlgcaretforecolor
#, fuzzy
#| msgid "Color (NotXor)"
msgid "Main or primary caret"
msgstr "Szín (NotXor)"

#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr "Beszúrási jel (szöveg kurzor)"

#: lazarusidestrconsts.dlgcaretscrollgroupoptions
msgid "Caret (Text Cursor) past end of line"
msgstr ""

#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "Kis- és nagybetűk megkülönböztetése"

#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Fordító beállításainak ellenőrzése"

#: lazarusidestrconsts.dlgccoorphanedfilefound
#, object-pascal-format
msgid "orphaned file found: %s"
msgstr "árván maradt fájl: %s"

#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Eredmények"

#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Teszt"

#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Teszt: Fordító ellenőrzése ..."

#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Teszt: Fordító beállításainak ellenőrzése ..."

#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Teszt: Fordító dátumának ellenőrzése ..."

#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Teszt: Egy üres fájl fordítása ..."

#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr "Teszt: RTL unit-ok ellenőrzése ..."

#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Teszt: Forráskódok ellenőrzése az FPC .ppu keresési útvonalakon ..."

#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Teszt: Egy üres fájl fordítása"

#: lazarusidestrconsts.dlgccousingconfigfile
#, object-pascal-format
msgid "using config file %s"
msgstr "a használt konfigurációs fájl: %s"

#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "Osztály sorrend"

#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "Utolsóként"

#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "kisbetűs"

#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Előnézet (max. sor hossz = 1)"

#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Olvasás előtag"

#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Tárolt utótag"

#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "NAGYBETŰS"

#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Változó előtag"

#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Írás előtag"

#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Mentés másként - Pascal fájlok automatikus átnevezése kisbetűsre"

#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Fájlok ellenőrzése és automatikus mentése"

#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Csomagok ellenőrzése form létrehozásakor"

#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr "A form csomagokat igényelhet a működéshez. Az ilyen csomagok automatikus telepítése."

#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Kódsablon fájl választása (*.dci)"

#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Bezáró gomb megjelenítése a lapfüleken"

#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Színséma"

#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "C stílusú makrók (globális)"

#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "ANSI karakterláncok használata"

#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Assembler stílus"

#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Üzenetek"

#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Ellenőrzések és infókimenet"

#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Fordító parancsok"

#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "C stílusú operátorok (*=, +=, /= and -=)"

#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Makefile készítése"

#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Hibakeresés"

#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Hibakereső elérési út kiegészítése (semmi):"

#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Kód létrehozása"

#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Mindkettő"

#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Összecsukás"

#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Elrejtés"

#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Fordított blokk-sorrend a felugró menüben"

#: lazarusidestrconsts.dlgcogdb
msgid "Generate info for the debugger (slower / increases exe-size)"
msgstr "Hibakeresési információk létrehozása (lassabb / nagyobb exe-méret)"

#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Heaptrc unit használata (memória szivárgás ellenőrzése)"

#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Include fájlok (-Fi):"

#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Debugger info"
msgstr "Hibakereső infó"

#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Függvénytárak (Library-k) (-Fl):"

#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Összefűzés"

#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "A fordító beállításai XML fájlba menthetők."

#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Szín szerkesztése)"

#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Nincs módosítva"

#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Színek"

#: lazarusidestrconsts.dlgcolorstml
msgid "TML Setup"
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile
#, object-pascal-format
msgid "Sample text file not found: %1:s"
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlerror
msgid "Error:"
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlfromfile
msgid "File:"
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlinfo
#, object-pascal-format
msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed."
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlmissinginclude
#, object-pascal-format
msgid "Did not find all includes: %1:s"
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlnofilesfound
msgid "No files found."
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlnosampletxt
msgid "No sample text configured"
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlok
msgid "OK"
msgstr ""

#: lazarusidestrconsts.dlgcolorstmlrefresh
msgid "Reload"
msgstr ""

#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Parancssori paraméterek (alkalmazás név nélkül)"

#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr "Maximális behúzás az új sor számára ha a megjegyzés előtagot az első megjegyzéssorban lévő megjegyzés elejéhez kell igazítani"

#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Behúzás korlátozása ennyire: "

#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Megjegyzés előtag sortöréskor"

#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Egyezés az aktuális sorral"

#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "Szövegegyezés, beleértve a \"*\"-ot a \"(*\" jelből"

#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "Egyezés a teljes sorral"

#: lazarusidestrconsts.dlgcommentcontinuematchtext
#, object-pascal-format
msgid "Match text after token \"%s\""
msgstr "Szövegegyezés a(z) \"%s\" után"

#: lazarusidestrconsts.dlgcommentcontinuematchtoken
#, object-pascal-format
msgid "Match text including token \"%s\""
msgstr "Szövegegyezés, beleértve a(z) \"%s\" is"

#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Előtag az új sorban"

#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Előtag igazítása az előző sor behúzásához"

#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "Előtag igazítása az első megjegyzéssorban lévő megjegyzés elejéhez"

#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "Az előtag ne legyen behúzva"

#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments and Strings"
msgstr "Megjegyzések és karakterláncok"

#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend if matched or not matched"
msgstr "Meghosszabbítás ha illeszkedik vagy nem illeszkedik"

#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend if matched or not matched (not at EOL)"
msgstr "Meghosszabbítás ha illeszkedik vagy nem illeszkedik (nem a sor végén)"

#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend if matched"
msgstr "Meghosszabbítás ha illeszkedik"

#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr "Meghosszabbítás ha illeszkedik és a beszúrási jel a szöveg belsejében van (nem a sor végén)"

#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Fordítás és összefűzés"

#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Fordító üzenetei"

#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "Fordító üzenetek nyelvi fájlja (*.msg)"

#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Tulajdonságok kiegészítése"

#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr "Az egér mutatója alatti komponens kiválasztása után a felugró menü parancsai működnek rajta."

#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Beállítás és cél"

#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Beállítás fájlok"

#: lazarusidestrconsts.dlgconsolesizenotsupported
msgid "Current debugger does not support this."
msgstr ""

#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Egyéb hibakeresési infó"

#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Túlcsordulás"

#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Elemzés"

#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Másolás/Beillesztés összecsukási információkkal együtt"

#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy current word when no selection exists"
msgstr "Aktuális szó másolása ha nincs kijelölés"

#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Tartomány"

#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Áthelyezhető"

#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Legyen alapértelmezett a fordító beállítása"

#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "Beállítások megjelenítése"

#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Okosan fűzhető"

#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Egyéb források (.pp/.pas fájlok, csak az IDE használja, nem a fordító)"

#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Verem"

#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Szimbólumok eltávolítása a futtatható állományból"

#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Hibakeresési infó típusa"

#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Automatikus"

#: lazarusidestrconsts.dlgcosymboltypedwarf2
#, fuzzy
#| msgid "Dwarf2"
msgid "Dwarf 2"
msgstr "Dwarf2"

#: lazarusidestrconsts.dlgcosymboltypedwarf2set
#, fuzzy
#| msgid "Dwarf with sets"
msgid "Dwarf 2 with sets"
msgstr "Dwarf készletekkel"

#: lazarusidestrconsts.dlgcosymboltypedwarf3
#, fuzzy
#| msgid "Dwarf3 (beta)"
msgid "Dwarf 3 (beta)"
msgstr "Dwarf3 (béta)"

#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Stabs"

#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Változók feltöltése szeméttel"

#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Unit stílus"

#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Kód generálása valgrind-hez"

#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Bőbeszédűség"

#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "C++ stílusú INLINE"

#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr "Új futtatási paraméterbeállítások létrehozása"

#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Kapcsos { }"

#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr "Jelenleg csak az üzenetek ablaka, az ugrási előzmények és a keresési eredmények esetén működik."

#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Beszúrási jel a sor vége után"

#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr "A beszúrási jel balra/jobbra mozdítása törli a kijelölést (nem mozdul)"

#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Caret skips selection"
msgstr "A beszúrási jel átugrik a kijelölésen"

#: lazarusidestrconsts.dlgcursorskipstab
msgid "Caret skips tabs"
msgstr "A beszúrási jel átugrik a tab-okon"

#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Felhasználó által megadott kiterjesztés (.pp.xxx)"

#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr "hibakeresés"

#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Útvonalszerkesztő"

#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Hibakereső típusa és útvonala"

#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Szerkesztő alapértelmezett betűtípusa"

#: lazarusidestrconsts.dlgdefaulttabfont
msgid "Default tab font"
msgstr ""

#: lazarusidestrconsts.dlgdefaultwinpos
msgid "Default Window/Console position and size"
msgstr ""

#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Alapértelmezett érték"

#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr "Mód törlése"

#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
msgid "Delete"
msgstr "Törlés"

#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
msgid "Delete selected desktop"
msgstr "A kijelölt felület törlése"

#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Sablon törlése: "

#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Gombokon: "

#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Tippek"

#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Menükben: "

#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr "Felület neve"

#: lazarusidestrconsts.dlgdesktopsexported
#, object-pascal-format
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr "%d felület sikeresen exportálva ide: \"%s\""

#: lazarusidestrconsts.dlgdesktopsimported
#, object-pascal-format
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr "%d felület sikeresen importálva innen: \"%s\""

#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr "Eltérő értékek háttere"

#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Irány"

#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Élsimítás kikapcsolása"

#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr "A rácspontok közti távolság a legkisebb lépés a vezérlők mozgatása közben."

#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Jobb margó színének használata"

#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Elválasztó rajzolásának szintje"

#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Beágyazott vonal színe"

#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Vonal színe"

#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"

#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Procedure/Function"

#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Class/Struct"

#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Class/Struct (helyi)"

#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"

#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Unit szakaszok"

#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Uses kifejezés"

#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Var/Type"

#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Var/Type (helyi)"

#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr "A név a komponens alatt jelenjen meg."

#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Vissza"

#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Félkövér"

#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Alkönyvtár"

#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Kódsablonok"

#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Lezáró állományok hozzáadása a pascal blokkokhoz"

#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Felhasználó által megadott kiterjesztés"

#: lazarusidestrconsts.dlgeddelayinsec
#, object-pascal-format
msgid "(%s sec delay)"
msgstr "(%s mp késleltetés)"

#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Megjelenés"

#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Szerkesztő fájljai"

#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Azonosítók kiegészítése"

#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Megfordítás"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Zárolások figyelmen kívül hagyása, a legrégebben használt szerkesztő használata"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Zárolások figyelmen kívül hagyása, ha a szerkesztő az aktuális"

#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Zárolások figyelmen kívül hagyása, ha a szerkesztő az aktuális ablakban van"

#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Zárolt, ha a szöveg látható"

#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Zárolatlan"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Zárolatlan, ha a szöveg középen látható"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Új fül, létező vagy új ablak"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Új fül új ablakban"

#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Új fül létező ablakban"

#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Ezen beállítással a legrégebb óta nem használt szerkesztő lesz használva a fájl számára, még akkor is ha zárolva van és/vagy görgetni kell. A legrégebben használt szerkesztő meghatározásánál nem lesz figyelembe véve az ablakok fókuszálásának sorrendje, még akkor sem ha be van állítva a \"azonos szempontok sorrendje\". Ez a beállítás mindig teljesül, további beállítások nem lesznek ellenőrizve."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Ezen beállítással ellenőrizve lesz, hogy az aktuális szerkesztő tartalmazza-e a cél fájlt és ha igen akkor az aktuális szerkesztő lesz használva, még akkor is a zárolva van és/vagy görgetni kell."

#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Ezen beállítással ellenőrizve lesz, hogy az aktuális ablakban van-e szerkesztő, amely tartalmazza a cél fájlt és ha igen akkor az a szerkesztő lesz használva, még akkor is a zárolva van és/vagy görgetni kell."

#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Ezen beállítással egy zárolt (és csak zárolt) szerkesztő lesz használva, amelyet nem kell görgetni a ugrási cél megjelenítéséhez (az ugrási cél már látható területre esik)."

#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Ezen beállítással bármely nem zárolt szerkesztő lesz használva."

#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Ezen beállítással egy nem zárolt szerkesztő lesz használva, amelyet nem kell görgetni a ugrási cél megjelenítéséhez (az ugrási cél már látható területre esik, 2-5 sor kivételével a tetején/alján)."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Ezen beállítással új fül nyílik meg egy létező vagy új ablakban ha nem található zárolatlan fül. Ez a beállítás mindig teljesül, további beállítások nem lesznek ellenőrizve."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Ha nem található zárolatlan fül akkor ezen beállítással egy új fül nyílik meg egy új ablakban (még akkor is ha más létező ablakok használhatók lennének az új fül számára). Ez a beállítás mindig teljesül, további beállítások nem lesznek ellenőrizve."

#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr "Ha nem található zárolatlan fül akkor ezen beállítással egy új fül nyílik meg egy létező (és csak létező) ablakban. A fül csak akkor nyílik meg ha van nyitott ablak, amely még nem tartalmaz szerkesztőt a célfájllal."

#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Dőlt"

#: lazarusidestrconsts.dlgeditexportbackcolor
msgid "Use Background color in HTML export"
msgstr ""

#: lazarusidestrconsts.dlgeditmaxlength
msgid "(Edit Max Length)"
msgstr ""

#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Szerkesztő betűmérete"

#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Szerkesztő beállításai"

#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Globális séma"

#: lazarusidestrconsts.dlgedmisc
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Egyéb"

#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Ki"

#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Be"

#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Tab és behúzás"

#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Aláhúzott"

#: lazarusidestrconsts.dlgelastictabs
msgid "Elastic tabs"
msgstr ""

#: lazarusidestrconsts.dlgelastictabswidths
msgid "Elastic min Widths"
msgstr ""

#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Elem jellemzői"

#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "Az End billentyűre a legközelebbi sorvéghez ugrik"

#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Rákérdez"

#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Megjegyzés: Projekt fájl az összes fájl a projekt könyvtárban"

#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Biztonsági mentés"

#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Fájlok"

#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Rács"

#: lazarusidestrconsts.dlgenvidestartup
msgid "IDE Startup"
msgstr ""

#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Nyelv"

#: lazarusidestrconsts.dlgenvlanguagerestarthint
msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint"
msgid "Restart the IDE to complete the language change."
msgstr ""

#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Segédvonalak"

#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Egyéb"

#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Semmi"

#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Egyéb fájlok"

#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "A projekt lapjai"

#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Típus"

#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr "Üzenetek előtérbe hozása fordításkor"

#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra character spacing"
msgstr "Extra karakterköz"

#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Extra sorköz"

#: lazarusidestrconsts.dlgextsymb
msgid "Use external debug symbols file"
msgstr "Külső hibakereső szimbólum fájl használata"

#: lazarusidestrconsts.dlgfileassociationinos
msgid "Opening Files from OS"
msgstr ""

#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Fájlkiterjesztések"

#: lazarusidestrconsts.dlgfiles
#, object-pascal-format
msgid "%s files"
msgstr "%s fájl"

#: lazarusidestrconsts.dlgfilterall
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Minden fájl"

#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr "CodeTools sablonfájl"

#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr "DCI fájl"

#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr "Delphi form"

#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Delphi csomag"

#: lazarusidestrconsts.dlgfilterdelphiproject
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Delphi projekt"

#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Delphi unit"

#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr "Futtatható"

#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr "FPC üzenetfájl"

#: lazarusidestrconsts.dlgfilterfppkgconfigurationfile
msgid "Fppkg configuration file"
msgstr ""

#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr "HTML fájlok"

#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr "Bitmap képek"

#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr "Pixmap képek"

#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr "PNG képek"

#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Lazarus felület beállításai"

#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "Szerkeszthető fájltípusok"

#: lazarusidestrconsts.dlgfilterlazarusfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Lazarus fájl"

#: lazarusidestrconsts.dlgfilterlazarusform
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Lazarus form"

#: lazarusidestrconsts.dlgfilterlazarusinclude
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Lazarus include fájl"

#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Lazarus egyéb fájl"

#: lazarusidestrconsts.dlgfilterlazaruspackage
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Lazarus csomag"

#: lazarusidestrconsts.dlgfilterlazarusproject
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Lazarus projekt"

#: lazarusidestrconsts.dlgfilterlazarusprojectsource
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Lazarus projekt forráskód"

#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr "Lazarus munkamenet"

#: lazarusidestrconsts.dlgfilterlazarusunit
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Lazarus unit"

#: lazarusidestrconsts.dlgfilterpackagelistfiles
msgid "Package list files"
msgstr ""

#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "Pascal fájl"

#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Programok"

#: lazarusidestrconsts.dlgfilterxml
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "XML fájlok"

#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "A beszúrási jelnél lévő szöveg keresése"

#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Adatblokk"

#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Adatblokk szakasz"

#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"

#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Megjegyzés"

#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Csomópont"

#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Elem"

#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Lista <>"

#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Objektum (örökölt, szövegközi)"

#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Var/Type (helyi)"

#: lazarusidestrconsts.dlgfoldpasanonprocedure
msgid "Anonymous Procedure"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Megjegyzés (* *)"

#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Asm"

#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (beágyazott)"

#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Megjegyzés { }"

#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"

#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Class/Object"

#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "public/private"

#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"

#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr "For/Do"

#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"

#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "If/Then/Else"

#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Beágyazott megjegyzés"

#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (eljárásban)"

#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Procedure"

#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Record"

#: lazarusidestrconsts.dlgfoldpasrecordcase
msgid "Record case"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasrecordcasesect
msgid "Record case section"
msgstr ""

#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"

#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Megjegyzés //"

#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"

#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Unit"

#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Unit szakasz"

#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"

#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Var/Type (globális)"

#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr "While/Do"

#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr "With/Do"

#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "CData"

#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Megjegyzés"

#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "DocType"

#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Csomópont"

#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Feldolgozási utasítások"

#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr "DPI alapú átméretezés kényszerítése a tervezés idejére."

#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr "Ha ez be van jelölve akkor a projekt DPI beállításai figyelmen kívül lesznek hagyva - csak a form/frame/datamodule Scaled tulajdonsága lesz figyelembe véve."

#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr "A futó Lazarus példány nem fogad el fájlokat."

#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Előtér"

#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr "Az Objektumfelügyelő tartalma változzon meg egy form címsorára kattintva"

#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr "Az érintett form tulajdonságainak megjelenítése az Objektumfelügyelőben egy form címsorára kattintva"

#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Eljárás beszúrási irányelv"

#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Eljárások sorrendjének megtartása"

#: lazarusidestrconsts.dlgfpcexecutable
#, object-pascal-format
msgid "Compiler executable (e.g. %s)"
msgstr "Fordító program (pl. %s)"

#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "FPC forráskód könyvtára"

#: lazarusidestrconsts.dlgfppkgconfigurationfile
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
msgstr "Fppkg beállítási fájl (pl. fppkg.cfg)"

#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Kiemelés"

#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Form szerkesztő"

#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "&Elejétől"

#: lazarusidestrconsts.dlgfromcursor
#, fuzzy
#| msgid "&From cursor"
msgid "From c&ursor"
msgstr "Beszúrási jeltől"

#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "&Globális"

#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Kód generálása gprof-hoz"

#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Méretező színe"

#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr "Az elhalványított felületek dokkolt környezethez tartoznak."

#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr "Az elhalványított felületek nem dokkolt környezethez tartoznak."

#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Rács színe"

#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr "A rács kis pontokból áll, melyek segítenek a vezérlők igazításában."

#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Rácsméret X"

#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Vízszintes rácstávolság"

#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Rácsméret Y"

#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Függőleges rácstávolság"

#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Kódböngésző"

#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "Kódeszközök"

#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Hibakereső"

#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Szerkesztő"

#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Környezet"

#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Csoportos visszavonás"

#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Segédvonalak megjelenítése"

#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr "Amikor egy vezérlő vízszintesen vagy függőlegesen egy másikhoz van igazítva egy kék vonal jelenik meg."

#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Hasábköz"

#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Összezárva"

#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Hasábköz színe"

#: lazarusidestrconsts.dlgguttercurrentlinenumber
msgid "Current Line (number)"
msgstr ""

#: lazarusidestrconsts.dlgguttercurrentlineother
msgid "Current Line (other)"
msgstr ""

#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Hasábköz szélének színe"

#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Hasábköz elválasztó indexe"

#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Féloldalas görgetés"

#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Memória és verem méretei"

#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Memória mérete"

#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr "Egy elem magassága a rácsban."

#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Magasság:"

#: lazarusidestrconsts.dlghideideonrun
#, fuzzy
#| msgid "Hide IDE windows on run"
msgid "Hide IDE windows on Run/Debug"
msgstr "IDE ablakok elrejtése futtatás közben"

#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr "Egyáltalán ne legyen látható az IDE amíg egy program fut."

#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Fül elrejtése egylapos ablakban"

#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Kijelölés színe"

#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Kijelölés betűszíne"

#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Caret"
msgstr "A beszúrási jel bal oldalán"

#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Caret"
msgstr "A beszúrási jel jobb oldalán"

#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Tipp megjelenítése ha \"Sender\" paraméter nincs használva"

#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Tipp megjelenítése ha nem használt unitok vannak a főprogramban"

#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "A Home billentyűre a legközelebbi sorkezdethez ugrik"

#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Külső alkalmazás"

#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Azonosítók kiegészítése"

#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Azonosító módszer"

#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "IDE beállításai"

#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "Aktív $IFDEF kód"

#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "Nem aktív $IFDEF kód"

#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "Kevert állapotú $IFDEF-ek belefoglalása"

#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Aktív $IFDEF csomópont"

#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Nem aktív $IFDEF csomópont"

#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "Kevert állapotú $IFDEF csomópont"

#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:"
msgstr ""
"Egy felület már létezik ugyanezzel a névvel.\n"
"A név jóváhagyása szükséges:"

#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
msgid "Include code templates"
msgstr "Kód sablonok belevétele"

#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr "Előtagokat tartalmazó azonosítókkal együtt"

#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
msgid "Include all keywords and operators"
msgstr ""

#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Rendszer változókkal együtt"

#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr "Szavak felhasználása"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr "mellőzve"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr "az összes unit-ból"

#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr "az aktuális unit-ból"

#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr "Behúzás"

#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr "Tabulátorok"

#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Metódusok elé"

#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "A constructor nevének 'init'-nek kell lennie (a destructor-énak 'done'-nak)"

#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Osztály részek beszúrása"

#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Kidolgozás"

#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Felület"

#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr "Metódusok kidolgozásának beszúrása"

#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Beszúrás a Uses szakaszba ebben:"

#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Szóköz beszúrása ez után:"

#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Szóköz beszúrása ez elé:"

#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Intervallum másodpercben"

#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr "Függőleges helyzet kódblokkhoz ugrás esetén %-ban megadva. (0=fent, 100=lent)"

#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Ugrás (pl. metódus ugrás)"

#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr "Függőleges helyzet sorhoz ugrás esetén %-ban megadva. (0=fent, 100=lent)"

#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr "Ugrás közvetlenül az eljárásra"

#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep caret X position when navigating up/down"
msgstr "A beszúrási jel X pozíciójának megtartása le/fel mozgatás közben"

#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Billentyű szerkesztése)"

#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Gyorsbillentyűk"

#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Gyorsbillentyű hiba"

#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Kulcsszavak írásmódja"

#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "LABEL és GOTO engedélyezése"

#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Nyelv"

#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Utolsó (pl. a forráskód végén)"

#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Lazarus könyvtára (alapértelmezett minden projekthez)"

#: lazarusidestrconsts.dlglazarusinstances
msgid "Lazarus instances"
msgstr ""

#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Segédvonalak balra, fent"

#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly with small limitations)"
msgstr "1 (gyors, hibakereső-barát némi megkötéssel)"

#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (-O1 + gyors optimalizálás)"

#: lazarusidestrconsts.dlglevel3opt
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (-O2 + lassú optimalizálás)"

#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr "4 (-O3 + aggresszív optimalizálás, óvatosan)"

#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization, for debugging)"
msgstr "0 (nincs optimalizálás, hibakereséshez)"

#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Sortörés"

#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Okos összefűzés"

#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Sorszámok megjelenítése a futási hibák esetén"

#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Projekt form-ok megjelenítése"

#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Projekt frame-ek megjelenítése"

#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Projekt unit-jainak megjelenítése"

#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "\"Make\" program"

#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr "Felületek kezelése"

#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Margó és hasábköz"

#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Jelző színe"

#: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec
#, object-pascal-format
msgid "(%s sec delay after caret move)"
msgstr ""

#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr "Függőleges jelző"

#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight all occurrences of Word under Caret"
msgstr "A beszúrási jel alatti szó összes előfordulásának kiemelése"

#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr "Körvonal (globális)"

#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr "Figyelmeztetés: Nincsenek színek beállítva a kiválasztott nyelvhez"

#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Felhasználói kiemelés"

#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Törlés"

#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
#, object-pascal-format
msgid "Delete list \"%s\"?"
msgstr "Törölhető a(z) \"%s\" lista?"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
#, fuzzy
#| msgid "Add Word or Term"
msgid "Add Word or Term by key"
msgstr "Szó vagy kifejezés hozzáadása"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
#, fuzzy
#| msgid "Remove Word or Term"
msgid "Remove Word or Term by key"
msgstr "Szó vagy kifejezés törlése"

#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
#, fuzzy
#| msgid "Toggle Word or Term"
msgid "Toggle Word or Term by key"
msgstr "Szó vagy kifejezés váltása"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Ismétlődő kifejezés"

#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
#, object-pascal-format
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "A(z) %s kifejezés már létezik. Az ismétlések el lesznek távolítva a lista mentésekor."

#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Hozzáadás/Eltávolítás minden szerkesztőben"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Lista törlése"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Név"

#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Lista hozzáadása"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Kis- és nagybetűk megkülönböztetése"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Határ beállítása a kifejezés végére"

#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Határ beállítása a kifejezés elejére"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Határok mellőzése ha kifejezés hosszabb mint"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "kijelölés"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "aktuális szó"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Billentyűvel hozzáadott kifejezések beállítása"

#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "A kijelölés határainak intelligens keresése"

#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Új lista"

#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "Nincsenek listák"

#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Kijelölés ..."

#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
#, fuzzy
#| msgid "Key Settings"
msgid "Key mappings"
msgstr "Billentyű beállítások"

#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Elsődleges beállítások"

#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr "Kulcsszó-zárójelek a beszúrási jelnél (globális)"

#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match whole words, if length is less or equal to:"
msgstr "Teljes szóegyezés, ha a hossz kevesebb vagy egyenlő ezzel:"

#: lazarusidestrconsts.dlgmarkupwordkeycombo
#, object-pascal-format
msgid "Markup current word by key: %s"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Kulcsszavak figyelmen kívül hagyása"

#: lazarusidestrconsts.dlgmarkupwordoncaretmove
msgid "Automatically markup current word on caret move"
msgstr ""

#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Szóközök levágása (az aktuális kijelölés kiemelésekor)"

#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Maximum számláló"

#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "Maximális sorhossz:"

#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Legutóbbi fájlok maximális száma"

#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr "A 0 érték korlátlant jelent."

#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Legutóbbi projektek maximális száma"

#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
msgid "Middle-click-modifier to close all other tabs"
msgstr "Középső gomb módosítója minden más lap bezárásához"

#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
msgid "Middle-click-modifier to close tabs on the right"
msgstr "Középső gomb módosítója a jobbra lévő lapok bezárásához"

#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Metódusok és tulajdonságok vegyítése"

#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr "Mód"

#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Egér művelet"

#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Egyszeres"

#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Kétszeres"

#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Háromszoros"

#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Négyszeres"

#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Bármi"

#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Extra 1"

#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Extra 2"

#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Bal"

#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Középső"

#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Visszaállítás"

#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Jobb"

#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Kerék le"

#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
msgid "Wheel left"
msgstr "Kerék balra"

#: lazarusidestrconsts.dlgmouseoptbtnwheelright
msgid "Wheel right"
msgstr "Kerék jobbra"

#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Kerék fel"

#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Bekérés"

#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Beszúrási jel mozgatása (extra)"

#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "Felengedéskor"

#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Művelet"

#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Kattintás"

#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Egér szerkesztése"

#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Ismétlődő bejegyzés"

#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Ez a bejegyzés ütközik egy meglévő bejegyzéssel"

#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Gomb"

#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr "Beszúrási jel"

#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Tartalom"

#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Kattintás"

#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Művelet"

#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Fel/Le"

#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Beállítás"

#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Sorrend"

#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Prioritás"

#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Egér"

#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Bővebb"

#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "IDE parancs"

#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"

#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"

#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "n"

#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"

#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "I"

#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"

#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "I"

#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Mind"

#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Hasábköz"

#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr "Sorváltások"

#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Összecsukható fa"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Összezárt [+]"

#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Kibontotott [-]"

#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr "Áttekintő"

#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr "Áttekintőbeli jelzés"

#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Sorszámok"

#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Szöveg"

#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Kijelölés"

#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Paraméter"

#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Más műveletek, amelyek ugyanezt a gombot használják"

#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "A következőktől függően kerülhetnek futtatásra: Módosító billentyűk, Tartalék beállítások, Egyszeres/Kétszeres kattintás, Fel/Le ..."

#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Szűrő mód. kulcsok"

#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Prioritás"

#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Hibakeresés"

#: lazarusidestrconsts.dlgmsgwincolorurgenterror
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Hiba"

#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr "Végzetes"

#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "Tipp"

#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr "Fontos"

#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr "Normál"

#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr "Megjegyzés"

#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr "Pánik"

#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr "Idő és statisztika"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr "Egyéb"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr "Egyéb 2"

#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr "Egyéb 3"

#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Figyelmeztetés"

#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr "A navigáló billentyűk az összes beszúrási jelet mozgatják (oszlopkijelölés)"

#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr "A DEL billentyű figyelmen kívül hagyása sor végén (nem vonja össze a sorokat)"

#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr "Többszörös beszúrási jel "

#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr "A navigáló billentyűk az összes beszúrási jelet mozgatják"

#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr "Többszörös beszúrási jel engedélyezése oszlopkijelöléskor"

#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr "Mindig új példány indítása"

#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr "Ne lehessen több példányt futtatni"

#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr "Fájlok megnyitása egy futó példányban"

#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Többszörös kijelölés"

#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Jump target priority between multiple editors"
msgstr "Ugrási cél előnyben részesítése több szerkesztő esetén"

#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Sorrend az azonos szempontoknak megfelelő szerkesztők számára"

#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "A fájl számára legutóbb fókuszba állított szerkesztő"

#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Szerkesztő (a fájl számára) a legutóbb fókuszba állított ablakban"

#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Szempontok elsőbbségi listája a szerkesztő kiválasztásához:"

#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Lapok és ablakok"

#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Jegyzettömb fülek"

#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Elnevezések"

#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr "Új felület ..."

#: lazarusidestrconsts.dlgnewprojecttype
msgid "New Project Type"
msgstr ""

#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Nincs automatikus átnevezés"

#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Nincsenek hozzáadható unit-ok."

#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Nincs kiemelés"

#: lazarusidestrconsts.dlgnonformbackgroundcolor
msgid "Other Designer background (e. g. TDataModule)"
msgstr ""

#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Forráskódszerkesztő füleinek helye"

#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Ne legyen sortörés ez után:"

#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Ne legyen sortörés ez előtt:"

#: lazarusidestrconsts.dlgnsprincipalclass
msgid "NSPrincipalClass"
msgstr ""

#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Objektum felügyelő"

#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height (0 = auto)"
msgstr "Elem magassága (0 = automatikus)"

#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Egyéb"

#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Gyorsbeállítás"

#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Alapértelmezett Delphi beállítások"

#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Alapértelmezett Lazarus beállítások"

#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Optimalizálás szintjei"

#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Egyéb Optimalizálások"

#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Egyéb unit fájlok (-Fu):"

#: lazarusidestrconsts.dlgoverviewgutterback1color
msgid "Background 1"
msgstr "Háttér 1"

#: lazarusidestrconsts.dlgoverviewgutterback2color
msgid "Background 2"
msgstr "Háttér 2"

#: lazarusidestrconsts.dlgoverviewguttercolor
msgid "Overview Gutter"
msgstr "Áttekintő hasábköz"

#: lazarusidestrconsts.dlgoverviewgutterpagecolor
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
msgid "Page"
msgstr "Lap"

#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Kijelölés felülírása"

#: lazarusidestrconsts.dlgoverwritedesktop
#, object-pascal-format
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?"
msgstr ""
"Létezik \"%s\" nevű felület.\n"
"Felülírható a régi felület?"

#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Tippek a komponens palettához"

#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Alapértelmezett pascal kiterjesztés"

#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Vezérlő állományok kiemelése mint a kulcsszavaké"

#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr "Kibővített pascal kulcsszó beállítások"

#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr "Kiemelés (a beszúrási jelnél)"

#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Összetartozó kulcsszavak"

#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr "Körvonal"

#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Paraméterek átadása az összefűzőnek \"-k\" használatával, szóközökkel kell elválasztani"

#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr "A \"String\" kulcsszó kiemelése"

#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "Alapértelmezett"

#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Nincs"

#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Csak \"String\""

#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Megmaradó kijelölés"

#: lazarusidestrconsts.dlgpersistentcursor
msgid "Visible caret in unfocused editor"
msgstr "Nem aktív szerkesztőben is látható a beszúrási jel"

#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr "Nem aktív szerkesztőben nem villog a beszúrási jel"

#: lazarusidestrconsts.dlgpoansiutf8
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
msgstr "ANSI kódlap UTF-8 (Windows 10 1903+)"

#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Alkalmazás"

#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "Felhasználó (asInvoker)"

#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "Ikon törlése"

#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Alkalmazásköteg létrehozása"

#: lazarusidestrconsts.dlgpodebugger
msgctxt "lazarusidestrconsts.dlgpodebugger"
msgid "Debugger"
msgstr "Hibakereső"

#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Alapértelmezés betöltése"

#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr "DPI tudatosság"

#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr "kikapcsolva"

#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr "Vista-8: kikapcsolva, 8.1+: monitorfüggő"

#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr "Vista-8: bekapcsolva, 8.1+: monitorfüggő"

#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr "Vista-8: bekapcsolva, 8.1/10+: monitorfüggő/V2"

#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr "bekapcsolva"

#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Futási szint"

#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Form-ok"

#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "a lehető legmagasabb (highestAvailable)"

#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"

#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Ikon:"

#: lazarusidestrconsts.dlgpoicondesc
#, object-pascal-format
msgid "(size: %d:%d, bpp: %d)"
msgstr "(méret: %d:%d, bpp: %d)"

#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(semmi)"

#: lazarusidestrconsts.dlgpointertypecheck
msgid "@<pointer> returns a typed pointer"
msgstr ""

#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "Ikon betö&ltése"

#: lazarusidestrconsts.dlgpolongpathaware
#, fuzzy
#| msgid "Long path awareness"
msgid "Long path awareness (Windows 10 1607+)"
msgstr "Hosszú útvonal tudatosság"

#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Egyéb"

#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "Adminisztrátor (requireAdministrator)"

#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Erőforrások"

#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "Ikon mentése"

#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Munkamenet"

#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Megnevezés:"

#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "UI Access (uiAccess)"

#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr "Alkalmazásköteg használata futtatáshoz és hibakereséshez"

#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr "LCL méretezés használata (Hi-DPI)"

#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest resource (and enable themes)"
msgstr "Jegyzékfájl használata (és témák engedélyezése)"

#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Kétszeres kattintás előnyben részesítése az egyszeres helyett"

#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Prioritások"

#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Projekt"

#: lazarusidestrconsts.dlgprojectoptionsfor
#, object-pascal-format
msgid "Options for Project: %s"
msgstr "Projekt beállításai: %s"

#: lazarusidestrconsts.dlgprojecttoopenorcreate
msgid "Project to Open or Create"
msgstr ""

#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Projekt fájlok"

#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "Kérdés felülírásnál"

#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Tulajdonságok kiegészítése"

#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Tulajdonság név"

#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project and packages at start"
msgstr "Legutóbbi projekt és csomagok megnyitása indításkor"

#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Keret-térköz megjelenítése"

#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Rács megjelenítése"

#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Rácshoz igazítás"

#: lazarusidestrconsts.dlgreallydeletedesktop
#, object-pascal-format
msgid "Really delete desktop \"%s\"?"
msgstr "Valóban törölhető a(z) \"%s\" felület?"

#: lazarusidestrconsts.dlgredirappend
msgid "To file (append)"
msgstr ""

#: lazarusidestrconsts.dlgredirinput
msgid "From file"
msgstr ""

#: lazarusidestrconsts.dlgredirinputend
msgid "From file (at EOF)"
msgstr ""

#: lazarusidestrconsts.dlgrediroff
msgid "No redirection"
msgstr ""

#: lazarusidestrconsts.dlgrediroverwrite
msgid "To file (overwrite)"
msgstr ""

#: lazarusidestrconsts.dlgredirstderr
msgid "Redirect StdErr"
msgstr ""

#: lazarusidestrconsts.dlgredirstdin
msgid "Redirect StdIn"
msgstr ""

#: lazarusidestrconsts.dlgredirstdnotsupported
msgid "Current debugger does not support redirection."
msgstr ""

#: lazarusidestrconsts.dlgredirstdout
msgid "Redirect StdOut"
msgstr ""

#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Hivatkozás"

#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "Reguláris kifejerések"

#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr "Felület átnevezése"

#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
msgid "Rename"
msgstr "Átnevezés"

#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
msgid "Rename selected desktop"
msgstr "A kijelölt felület átnevezése"

#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Összes cseréje"

#: lazarusidestrconsts.dlgreplacewith
msgid "Replace wit&h"
msgstr "Csere erre:"

#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Jelentés"

#: lazarusidestrconsts.dlgreset
msgctxt "lazarusidestrconsts.dlgreset"
msgid "Reset"
msgstr "Alaphelyzet"

#: lazarusidestrconsts.dlgresetall
msgid "Reset all"
msgstr "Az összes visszaállítása"

#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Segédvonalak jobbra, lent"

#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Jobb-kattintás kijelöl"

#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Jobb margó"

#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Munkakönyvtár"

#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Unokák kiválasztása"

#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Nyújtható létrehozás"

#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Nyújtható kijelölés"

#: lazarusidestrconsts.dlgrunninginstancemodalerror
#, object-pascal-format
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s"
msgstr ""
"A futó Lazarus példány nem fogad el fájlokat.\n"
"Megnyitás egy új IDE példányban?\n"
"\n"
"%s"

#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr "Egy Lazarus példány már fut, de nem válaszol."

#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Megjelenítő (nem win32-höz, pl. 198.112.45.11:0, x.org:1, hydra:0.1)"

#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Környezet"

#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Helyi"

#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Rendszer változók"

#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Megjelenítő használata"

#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Felhasználói felülírások"

#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Futtatási paraméterek"

#: lazarusidestrconsts.dlgrunwithdebug
msgid "Run uses the debugger (disable for release-mode)"
msgstr ""

#: lazarusidestrconsts.dlgsavecurrentdesktop
msgid "Save current desktop"
msgstr "Jelenlegi felület mentése"

#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr "Jelenlegi felület mentése másként"

#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
msgid "Save active desktop as ..."
msgstr "Az aktív felület mentése másként ..."

#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
msgid "Save active desktop as"
msgstr "Az aktív felület mentése másként"

#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Elmentett sor"

#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Szerkesztő beállításainak elmentése bezárt fájlokhoz is"

#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr "A fájlok elérhetők a \"Legutóbbi megnyitása\" listában."

#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Szerkesztő beállításainak mentése csak a projekt fájlokhoz"

#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr "Csak az e projekthez tartozó fájlok."

#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr "Mentés helye"

#: lazarusidestrconsts.dlgscrollbarpasteolfixed
msgid "Force 1024 columns minimum for horizontal scroll range"
msgstr ""

#: lazarusidestrconsts.dlgscrollbarpasteolnone
msgid "Do not add any permanent space to horizontal scroll range"
msgstr ""

#: lazarusidestrconsts.dlgscrollbarpasteolpage
msgid "Always add one page to horizontal scroll range"
msgstr ""

#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Egy sorral rövidebb görgetés"

#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Görgetés"

#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Görgetési tipp megjelenítése"

#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Görgetés a fájl vége után"

#: lazarusidestrconsts.dlgscrollpastendline
#, fuzzy
#| msgid "Allow caret to move past end of line"
msgid "Allow Caret to move past the end of line"
msgstr "A beszúrási jel túlmehet a sor végén"

#: lazarusidestrconsts.dlgseachdirectorynotfound
#, object-pascal-format
msgid "Search directory \"%s\" not found."
msgstr "A(z) \"%s\" keresési könyvtár nem található."

#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Keresés felhasználó által megszakítva."

#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Keresés ..."

#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Útvonalak"

#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr "Keresés hatóköre"

#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr "Az összes gyermek-vezérlő kijelölése a szülővel együtt."

#: lazarusidestrconsts.dlgselectallnoscroll
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
msgstr "Ne legyen görgetés az Összes/Bekezdés/Zárójelezett rész kijelölése esetén"

#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "Kijelölt szöveg"

#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
msgid "Set active"
msgstr "Aktiválás"

#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
msgid "Set active"
msgstr "Aktiválás"

#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Minden elem alapértelmezettre"

#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Elem alapértelmezettre állítása"

#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Tulajdonság-beállítás változója"

#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr "Az alapértelmezett értékadó eljárás paraméterének neve."

#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr "Előtag"

#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr "Ha be van jelölve akkor a \"Tulajdonság-beállítás változója\" csak előtag, egyébként rögzített név."

#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr "Állandó"

#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr "Ha be van jelölve akkor az értékadó eljárás paramétere állandóként (\"const\") lesz meghatározva."

#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Minden unit megjelenítése"

#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of nonvisual components"
msgstr "Nem vizuális komponensek feliratának megjelenítése"

#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Lefordított eljárások megjelenítése"

#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Sorszámok megjelenítése"

#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Feltételek megjelenítése"

#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Hibakeresési információ megjelenítése"

#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Tervezési tippek megjelenítése"

#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr "A tipp megjeleníti a vezérlő helyzetét vagy méretét mozgatás vagy átméretezés közben."

#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Minden megjelenítése"

#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "A program információinak megjelenítése (csak Win32)"

#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr "Fájlnév megjelenítése a felíratban"

#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Általános információk megjelenítése"

#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Hasábköz tippek megjelenítése"

#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Tippek megjelenítése"

#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr "Ablakok megjelenítése"

#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Sorszámok megjelenítése"

#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr "Üzenetikonok megjelenítése"

#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Megjegyzések megjelenítése"

#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Megpróbált fájlok megjelenítése"

#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Használt unit fájlok megjelenítése"

#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Figyelmeztetések megjelenítése"

#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Csak egy gomb jelenjen meg a tálcán"

#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Osztályok előzetes deklarációjának kihagyása"

#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Perjel //"

#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Okos tabulátor"

#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Szimbólum hátul (.pp~)"

#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Számláló (.pp;1)"

#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Szimbólum elől (.~pp)"

#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Segédvonalakhoz igazítás"

#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr "Amikor egy vezérlő elég közel van egy másik vezérlőhöz, akkor az igazított helyzetbe ugrik."

#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr "Fülek több sorba rendezése"

#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Szóköz"

#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Tippek a fő gyorsgombokhoz (megnyitás, mentés, ...)"

#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Kiindulópont"

#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Verem mérete"

#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Leállítás ennyi hiba után:"

#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Szöveg hozzáadása a karakterlánc lezárásakor"

#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Előtag a karakterlánchoz az új sorban"

#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "Karakterlánc ''"

#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Karakterláncok meghosszabbítása sortöréskor"

#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Altulajdonságok"

#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Szintaxis beállításai"

#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "A tabulátor behúzza a blokkokat"

#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Fülek számának megjelenítése a jegyzettömbökben"

#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Tabulátorok átalakítása szóközre"

#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Tabulátor szélessége"

#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Cél CPU család"

#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Cél OS"

#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Cél platform"

#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Cél processzor"

#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Cél-függő beállítások"

#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Könyvtár a teszt projektek építéséhez"

#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr "Szövegstílus"

#: lazarusidestrconsts.dlgtexttofind
#, fuzzy
#| msgid "&Text to find"
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "Search s&tring"
msgstr "Keresendő szöveg"

#: lazarusidestrconsts.dlgthiselementusescolor
msgid "The element uses (and edits) the schemes:"
msgstr "Az elem használja (és módosítja) a következő sémát:"

#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
msgid "Toggle as debug desktop"
msgstr "Hibakereső felületként történő használat ki-/bekapcsolása"

#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
msgid "Toggle as debug desktop"
msgstr "Hibakereső felületként történő használat ki-/bekapcsolása"

#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Aktuális osztály/eljárás tipp"

#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Szóközök levágásának stílusa"

#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "Kurzor előtt és után"

#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "Kurzor után"

#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "Sor elhagyásakor"

#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Egyáltalán nincs szóköz"

#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Sorvégi szóközök levágása"

#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Visszavonáslista megtartása mentés után"

#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Visszavonás / Újra"

#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Visszavonás korlátja"

#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Frissítés"

#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Unit kimeneti könyvtár (-FU):"

#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Nem mentett sor"

#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Kód blokkok"

#: lazarusidestrconsts.dlguseconsolebuffer
msgid "Set Columns/Rows"
msgstr ""

#: lazarusidestrconsts.dlguseconsolepos
msgid "Set Left/Top"
msgstr ""

#: lazarusidestrconsts.dlguseconsolesize
msgid "Set Width/Height"
msgstr ""

#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "További fordító beállításfájl használata"

#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Elválasztó rajzolása"

#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Szabványos fordító beállításfájl használata (fpc.cfg)"

#: lazarusidestrconsts.dlgusehighlight
msgid "Use Highlight"
msgstr "Kiemelés használata"

#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr "Ikonok a kódkiegészítés dobozban"

#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Futtató alkalmazás használata"

#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr "A rendszer kezeli az írásjelek bevitelét"

#: lazarusidestrconsts.dlguserschemeerror
#, object-pascal-format
msgid "Failed to load user-scheme file %s"
msgstr "Nem sikerült betölteni a felhasználói sémafájlt: %s"

#: lazarusidestrconsts.dlguseschemedefaults
msgid "- Scheme globals -"
msgstr "- Globális séma -"

#: lazarusidestrconsts.dlguseschemelocal
msgid "selected language"
msgstr "Kiválasztott nyelv"

#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Szintaxiskiemelés használata"

#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Fül előzmények használata fülek bezárásakor"

#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Unit hozzáadása a uses szakaszhoz"

#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Érték"

#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Bőbeszédűség fordítás alatt:"

#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Hasábköz látható"

#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Jobb margó látható"

#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "Csak egész szavak"

#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Szélesség:"

#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Win32 gui alkalmazás"

#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Ablak"

#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Kivételek"

#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Szavak"

#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Előnézet"

#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "FPC logo kiírása"

#: lazarusidestrconsts.drsignoringprojectdebuggersettings
msgid " (Ignoring project settings below)"
msgstr ""

#: lazarusidestrconsts.drsstoreconverterconfiginses
msgid "Store converter config in session"
msgstr ""

#: lazarusidestrconsts.drsstoredispformatconfiginses
msgid "Store display formats config in session"
msgstr ""

#: lazarusidestrconsts.drsstoreformatterconfiginses
msgid "Store formatter config in session"
msgstr ""

#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
msgid "Store project debugger configs in session"
msgstr ""

#: lazarusidestrconsts.drsthedebuggerbackendselecti
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
msgstr ""

#: lazarusidestrconsts.drsthisonlyaffectsdispformats
msgid "This only affects the display formats below. The settings which formats to use are always stored in the session."
msgstr ""

#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
msgid "This only affects the list of converters below. The settings which list to use are always stored in the session."
msgstr ""

#: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter
msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session."
msgstr ""

#: lazarusidestrconsts.drsuseideglobaldispformats
msgid "Use the IDEs-global display formats"
msgstr ""

#: lazarusidestrconsts.drsuseprojecfdispformats
msgid "Use the projects display formats"
msgstr ""

#: lazarusidestrconsts.drsusetheidegloballistofconv
msgid "Use the IDE-Global list of converters"
msgstr ""

#: lazarusidestrconsts.drsusetheidegloballistofformatter
msgid "Use the IDE-Global list of formatters"
msgstr ""

#: lazarusidestrconsts.drsusetheprojectlistofconver
msgid "Use the project list of converters"
msgstr ""

#: lazarusidestrconsts.drsusetheprojectlistofformatter
msgid "Use the project list of formatters"
msgstr ""

#: lazarusidestrconsts.drsusingidedefaultdebuggerse
msgid "Using IDE default debugger settings"
msgstr ""

#: lazarusidestrconsts.drsusingselectedidedebuggers
msgid "Using selected IDE debugger settings"
msgstr ""

#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "A kijelölt elemeknek egyazon form-on kell lenniük."

#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Igazítás ..."

#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Kijelölés törlése"

#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Tükrözés vízszintesen"

#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Tükrözés függőlegesen"

#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "Hátrább eggyel"

#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "Előbbre eggyel"

#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Háttérbe"

#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Előtérbe"

#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Visszaállítás ..."

#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Form mentése XML-ként"

#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Átméretezés ..."

#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Nagyítás"

#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Minden kijelölése"

#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Méret ..."

#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Méret"

#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Lehetőség: Rácshoz igazítás"

#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Lehetőség: Segédvonalakhoz igazítás"

#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-sorrend"

#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "Mindkét oldalon"

#: lazarusidestrconsts.initdlgdebugchangepath
msgid "Change path"
msgstr ""

#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
msgid "Error: The backend is not configured."
msgstr ""

#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
msgid "(The configured backend's package is not installed.)"
msgstr ""

#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
msgstr ""

#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
msgid "Hint: The backend type is OK, but not the recommended type."
msgstr ""

#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
msgid "Create a new recommended backend"
msgstr ""

#: lazarusidestrconsts.initdlgdebugcurrent
#, fuzzy
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
msgid "Current"
msgstr "Aktuális"

#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
msgid "The selected backend uses the external executable:"
msgstr ""

#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
#, object-pascal-format
msgid "The selected backend requires an external executable: \"%s\""
msgstr ""

#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
#, object-pascal-format
msgid "Default for your OS/Arch is: \"%s\"."
msgstr ""

#: lazarusidestrconsts.initdlgdebugignore
#, fuzzy
msgctxt "lazarusidestrconsts.initdlgdebugignore"
msgid "Ignore"
msgstr "Kihagyás"

#: lazarusidestrconsts.initdlgdebugkeepbackend
msgid "Keep backend"
msgstr ""

#: lazarusidestrconsts.initdlgdebugnew
#, fuzzy
msgctxt "lazarusidestrconsts.initdlgdebugnew"
msgid "New"
msgstr "Új"

#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
msgid "Error: External executable is a directory, not a file."
msgstr ""

#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
msgid "Error: External executable not found."
msgstr ""

#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
msgid "Error: External file is not executable."
msgstr ""

#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
msgid "Error: No default for external executable found."
msgstr ""

#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
msgid "Error: No external executable specified."
msgstr ""

#: lazarusidestrconsts.initdlgdebugpopupinformation
#, object-pascal-format
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
msgstr ""

#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
msgid "Select an existing backend"
msgstr ""

#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr ""

#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
#, object-pascal-format
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr ""

#: lazarusidestrconsts.initdlgdebugstatemissingpackages
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
msgstr ""

#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
msgstr ""

#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
msgstr ""

#: lazarusidestrconsts.initdlgdebugstatesetupok
msgid "Setup is OK."
msgstr ""

#: lazarusidestrconsts.initdlgdebugstateupdatebackend
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
msgstr ""

#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = nincs, 1 = elválasztó rajzolása csak a legfelső szinten, 2 = rajzolás az első két szinten"

#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Fájlok hozzáadása"

#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Nem egyértelmű ős-típus"

#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Nem egyértelmű osztálynév"

#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Nem egyértelmű unit-név"

#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor type"
msgstr "Ős típusa:"

#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Megszakadt függőségek"

#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Az osztálynév már létezik"

#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Új komponens létrehozása"

#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Függőség"

#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr "Unit könyvtára:"

#: lazarusidestrconsts.lisa2pexistingfile2
#, object-pascal-format
msgid "Existing file: \"%s\""
msgstr "Létező fájl: \"%s\""

#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "A fájl már létezik"

#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
#, object-pascal-format
msgid "File \"%s\" already exists in the package."
msgstr "A(z) \"%s\" fájl már létezik a csomagban."

#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "A fájl használatban van"

#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename/URL"
msgstr "Fájlnév/URL"

#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "A fájl nem unit"

#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr "Ikon 24x24:"

#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr "Ikon 36x36:"

#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr "Ikon 48x48:"

#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Érvénytelen ős típus"

#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Érvénytelen körkörös függőség"

#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Érvénytelen osztály név"

#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Érvénytelen fájl"

#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Érvénytelen fájlnév"

#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Érvénytelen unit-név"

#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, object-pascal-format
msgid "\"%s\" is not a valid unit name."
msgstr "A(z) \"%s\" nem érvényes unit-név."

#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Új osztály név:"

#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Új fájl"

#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, object-pascal-format
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Nem található csomag a(z) \"%s\" függőséghez.%sVálasszon egy létező csomagot!"

#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr "Csomag/Projekt"

#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Túl hosszú lapnév"

#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette page:"
msgstr "Paletta lap:"

#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Fájlnév rövidítése vagy hosszabbítása"

#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Összes megjelenítése"

#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, object-pascal-format
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "A(z) \"%s\" őstípusnak ugyanaz a neve,%smint a(z) \"%s\" unit-nak."

#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, object-pascal-format
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "A(z) \"%s\" őstípus nem érvényes pascal azonosító."

#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, object-pascal-format
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "A(z) \"%s\" osztálynév és a(z) \"%s\" őstípus megegyezik."

#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, object-pascal-format
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "A(z) \"%s\" osztálynév már létezik a(z)%s%s csomagban %sFájl: \"%s\""

#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, object-pascal-format
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "A(z) \"%s\" osztálynak ugyanaz a neve,%smint a(z) \"%s\" unit-nak."

#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, object-pascal-format
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "A(z) \"%s\" osztálynév nem érvényes pascal azonosító."

#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, object-pascal-format
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "A(z)\"%s\" fájl már része a jelenlegi projektnek.%sRossz ötlet fájlokat megosztani projektek és csomagok között."

#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, object-pascal-format
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "A(z) \"%s\" fájlnév nem egyértelmű, mert a csomagnak még nincs alapértelmezett könyvtára.%sAdjon meg egy fájlnevet teljes elérési úttal!"

#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "A legnagyobb változatszám kisebb, mint a legkisebb változatszám."

#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, object-pascal-format
msgid "The package already has a dependency on the package \"%s\"."
msgstr "A csomaghoz már be van állítva függőségként a(z) \"%s\" csomag."

#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, object-pascal-format
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "A(z) \"%s\" lapnév túl hosszú (legfeljebb 100 karakter lehet)."

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "A(z) \"%s\" unit-név már létezik a csomagban: %s%s"

#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in this package."
msgstr "A(z) \"%s\" unit-név már létezik ebben a csomagban."

#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, object-pascal-format
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "A(z) \"%s\" unit-név%sés a(z) \"%s\" fájlnév különbözik."

#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, object-pascal-format
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "A(z) \"%s\" unit-név megegyezik egy regisztrált komponens nevével.%sEnnek használata furcsa hibaüzeneteket okozhat."

#: lazarusidestrconsts.lisa2punitname
msgid "Unit name:"
msgstr "Unit neve:"

#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "A unit-név már létezik"

#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Változások elvetése?"

#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Minden betöltés megszakítása"

#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Megszakítva"

#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Projekt betöltés megszakítása"

#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "Részletek"

#: lazarusidestrconsts.lisabout2
#, object-pascal-format
msgid "About %s"
msgstr "Részletek erről: %s"

#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Dokumentáció:"

#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Az IDE adatai"

#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "Lazarus névjegye"

#: lazarusidestrconsts.lisaboutlazarusmsg
#, object-pascal-format, fuzzy
#| msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers."
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
msgstr "Licenc: GPL/LGPL. Lásd a Lazarus és a Free Pascal forráskódokat a licenc részleteiért.%sA Lazarus egy IDE grafikus és konzolos alkalmazások létrehozására Free Pascal használatával. A Free Pascal egy Pascal és Object Pascal fordító, amely fut Windows-on, Linux-on, Mac OS X-en, FreeBSD-n stb.%sA Lazarus a kirakós hiányzó darabja, mely lehetővé teszi programok fejlesztését az összes fenti platformra egy Delphi-szerű környezetben. Az IDE egy RAD (Rapid Application Development) eszköz mely tartalmaz űrlaptervezőt.%sAhogy a Lazarus növekszik egyre több fejlesztőre van szükségünk."

#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "A Közreműködők listája nem található."

#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Hivatalos:"

#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, object-pascal-format
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "Egy %s nem tartalmazhat TControl-okat.%sCsak nem-vizuális komponensek helyezhetők el rajta."

#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Köszönetnyilvánítások"

#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Művelet:"

#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Aktiválás"

#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Reguláris kifejezés szintaxis bekapcsolása szöveghez és cseréhez (mint a perl-ben)"

#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Kijelölt aktiválása"

#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Aktív"

#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Aktív szűrő"

#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr "Új elválasztó hozzáadása a kijelölt elem fölött"

#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr "Új elválasztó hozzáadása a kijelölt elem alatt"

#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Delphi7 utánzása definíciók hozzáadásával "

#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Hasznos, ha a kód ellenőrzi a támogatott fordító változatokat"

#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
#, object-pascal-format
msgid "Added missing object \"%s\" to pascal source."
msgstr "A hiányzó \"%s\" objektum hozzá lett adva a pascal forráskódhoz."

#: lazarusidestrconsts.lisaddedpropertysfors
#, object-pascal-format
msgid "Added property \"%s\" for %s."
msgstr "A(z) \"%s\" tulajdonság hozzá lett adva ehhez: \"%s\""

#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr "-FcUTF8 hozzáadása"

#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr "Szükséges lehet ha a forrásfájlok nem csak ansi karakterláncokat tartalmaznak."

#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Szűrő hozzáadása ..."

#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr "A kiegészítés nem illeszkedik az üzenetre"

#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr "A kiegészítés illeszkedik az üzenetre"

#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr "Kiegészítések"

#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "A \"do\" kulcsszó hozzáadása"

#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr "Módosító hozzáadása: \"overload\""

#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr "Módosító hozzáadása: \"override\""

#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr "Módosító hozzáadása: \"reintroduce\""

#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
#, object-pascal-format
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Új építési mód hozzáadása, átmásolva a beállításokat innen: \"%s\""

#: lazarusidestrconsts.lisaddnewdiskfiles
msgid "Add new disk files?"
msgstr ""

#: lazarusidestrconsts.lisaddnewfilesfromfilesystem
msgid "Add New Files from File System"
msgstr ""

#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Új makró hozzáadása"

#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Új készlet hozzáadása"

#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Csomag követelmény hozzáadása?"

#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
#, fuzzy
#| msgid "add package(s) to list of installed packages (combine with --build-ide to rebuild IDE)."
msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "Csomag(ok) hozzáadása a telepítettek listájához (az IDE újraépítéséhez a --build-ide kapcsolóval)"

#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Csomag hozzáadása a projekthez"

#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Paraméter zárójelek hozzáadása"

#: lazarusidestrconsts.lisaddthefollowingfiles
msgid "Add the following files:"
msgstr ""

#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Hozzáadás az include keresési útvonalakhoz?"

#: lazarusidestrconsts.lisaddtoproject
#, object-pascal-format
msgid "Add %s to project?"
msgstr "%s hozzáadása a projekthez?"

#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr "Hozzádadja az indításkori komponensekhez?"

#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Hozzáadás a unit keresési útvonalakhoz?"

#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Az \"interfaces\" unit hozzáadása"

#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Unit hozzáadása (nem ajánlott)"

#: lazarusidestrconsts.lisaddvaluetomacro
#, object-pascal-format
msgid "Add value to macro %s"
msgstr "Érték hozzárendelése a makróhoz: %s"

#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Fájlok hozzáadása csomaghoz"

#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Cél csomag"

#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Fájltípus"

#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Érvénytelen csomag"

#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, object-pascal-format
msgid "Invalid package ID: \"%s\""
msgstr "Érvénytelen csomag azonosító: \"%s\""

#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "A csomag csak olvasható"

#: lazarusidestrconsts.lisaf2ppackagenotfound
#, object-pascal-format
msgid "Package \"%s\" not found."
msgstr "A(z) \"%s\" csomag nem található."

#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Összes megjelenítése"

#: lazarusidestrconsts.lisaf2pthepackageisreadonly
#, object-pascal-format
msgid "The package %s is read only."
msgstr "A(z) %s csomag csak olvasható"

#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
#, object-pascal-format
msgid "A filter with the name \"%s\" already exists."
msgstr "Egy szűrő már létezik ezzel a névvel: \"%s\"."

#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "Tisztítás után (minden vagy általános fájlok) váltás automatikus tisztításra"

#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Igazítás"

#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Minden blokk jónak tűnik."

#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Minden építési mód>"

#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Minden örökölt beállítás"

#: lazarusidestrconsts.lisalloptions
#, object-pascal-format, fuzzy, badformat
#| msgid "All Options"
msgid "All options of FPC%s (\"%s\")"
msgstr "Minden beállítás"

#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Többsoros keresés engedélyezése"

#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Ezen eljárás minden paramétere be lett már állítva e hívásban. Nincs mit hozzáadni."

#: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp
msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package."
msgstr ""

#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, object-pascal-format
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "A(z) \"%s\"%sminden módosítása el fog veszni és a fájl újra meg lesz nyitva."

#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Alfa"

#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Helyettesítő billentyű"

#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Helyettesítő billentyű (vagy 2 billentyű egymás után)"

#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Mindig legyen kisbetűsre alakítva a javasolt alapértelmezett fájlnév"

#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "A kijelölt elemeket mindig fókuszálva rajzolja"

#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Tiltás mindig"

#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Egy makró már létezik ezzel a névvel."

#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Megtévesztő fájl"

#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, object-pascal-format
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Megtévesztő fájl: \"%s\"%sEz a fájl összetéveszthető ezzel: \"%s\"%sTörli a megtévesztő fájlt?"

#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Alsó szél horgonyzása a testvér alsó széléhez. A BorderSpacing használható a távolság beállításához. A testvér BorderSpacing tulajdonsága nem számít."

#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Alsó szél horgonyzása a testvér felső széléhez. A megtartott távolságot ennek és a testvérnek a BorderSpacing tulajdonsága együtt határozza meg."

#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Horgonyszerkesztő - nincs vezérlő kijelölve"

#: lazarusidestrconsts.lisanchorenabledhint
#, object-pascal-format
msgid "Enabled = Include %s in Anchors"
msgstr "Bekapcsolva = %s hozzáadása a horgonyokhoz"

#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Bal szél horgonyzása a testvér bal széléhez. A BorderSpacing használható a távolság beállításához. A testvér BorderSpacing tulajdonsága nem számít."

#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Bal szél horgonyzása a testvér jobb széléhez. A megtartott távolságot ennek és a testvérnek a BorderSpacing tulajdonsága együtt határozza meg."

#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Jobb szél horgonyzása a testvér bal széléhez. A megtartott távolságot ennek és a testvérnek a BorderSpacing tulajdonsága együtt határozza meg."

#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Jobb szél horgonyzása a testvér jobb széléhez. A BorderSpacing használható a távolság beállításához. A testvér BorderSpacing tulajdonsága nem számít."

#: lazarusidestrconsts.lisanchorsof
#, object-pascal-format
msgid "Anchors of %s"
msgstr "%s horgonyai"

#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "A kijelölt vezérlők horgonyai"

#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Felső szél horgonyzása a testvér alsó széléhez. A megtartott távolságot ennek és a testvérnek a BorderSpacing tulajdonsága együtt határozza meg."

#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Felső szél horgonyzása a testvér felső széléhez. A BorderSpacing használható a távolság beállításához. A testvér BorderSpacing tulajdonsága nem számít."

#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
#, object-pascal-format
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "Hiba történt a legutóbbi indításkor a(z) %s betöltése közben!%sÚjra megnyitja a projektet?"

#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr "Megjelenés"

#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "&Alkalmazás osztályának neve"

#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Egy grafikus felületű Free Pascal alkalmazás, mely a kereszt-platformos LCL függvénytárat használja a GUI megjelenítésére."

#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Alkalmazás"

#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
#, fuzzy
#| msgid "apply build flags (-B) to dependencies too"
msgid "Apply build flags (-B) to dependencies too."
msgstr "Építési kapcsolók (-B) használata a függőségekhez is"

#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Elnevezési szokások alkalmazása"

#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr "A név és a kiterjesztés betűméretének igazítása a platformhoz és a fájltípushoz."

#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Egy projekt unit-ját nem használhatják más csomagok/projektek"

#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Keret-térköz a vezérlő körül. A másik négy térköz ehhez az értékhez adódik hozzá."

#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Kérdés minden megtalált szöveg cseréje előtt"

#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Kérdés a projekt munkamenetének mentése előtt"

#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr "Komponensnév kérése a tervezőablakra helyezéskor."

#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Fájlnév kérése új fájl esetén"

#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Kérjen nevet a létrehozáskor"

#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr "Az IDE főablakának magassága automatikusan legyen beállítva"

#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr "Teljes komponens paletta megjelenítése"

#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr "Ha a komponens paletta több sort foglal el akkor mind jelenjen meg, ne csak egy."

#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Automatikus kiegészítés: ki"

#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Automatikus kiegészítés: be"

#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Kiemelés és párok"

#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Automatikus"

#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Automatikusan"

#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr "Az .lfm fájlok automatikus átalakítása .lrs erőforrás fájlokká"

#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "ne egészítse ki a kijelölést"

#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Automatikus kiegészítés . után"

#: lazarusidestrconsts.lisautomaticallyinvokeontype
msgid "Automatically invoke on typing"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
msgid "Only complete if word is longer or equal"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
msgid "Only complete when at end of word"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
msgid "Use completion box delay"
msgstr ""

#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "sortöréskor"

#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "szóközre"

#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "tab"

#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "kifejezés végén"

#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "ne adjon hozzá karaktert"

#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr "Automatikus beillesztés ha csak egy lehetséges azonosító van"

#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Kiegészítés és tippek"

#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Automatikus megjelenítés"

#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Telepíthető"

#: lazarusidestrconsts.lisavailableprojectbuildmodes
#, fuzzy
#| msgid "Available project build modes:"
msgid "Available project build modes"
msgstr "Elérhető projekt építési módok:"

#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Készítsen biztonsági mentést a megváltozott fájlokról"

#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Biztonsági mentés sikertelen"

#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "A Backup könyvtár létrehozása a projekt könyvtárában"

#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
#, object-pascal-format
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "A csomag nevének vagy változatának módosítása megszakítja a függőségeket. Ezeket a függőségeket is módosítja?%sVálassza az Igen-t minden felsorolt függőség módosításához.%sVálassza a Kihagyás-t a függőségek megszakításához és a folytatáshoz."

#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "kezdete"

#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "Kapcsolódó után"

#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
#, fuzzy
#| msgid "be less verbose, can be given multiple times"
msgid "Be less verbose. Can be given multiple times."
msgstr "Kevésbé részletes, többször megadható"

#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
#, fuzzy
#| msgid "be more verbose, can be given multiple times"
msgid "Be more verbose. Can be given multiple times."
msgstr "Részletesebb, többször megadható"

#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "A legjobb megjelenés egy HTML vezérlő telepítésével érhető el, mint például a turbopoweriprodsgn"

#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Mindig építsen futtatás előtt"

#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Építés parancs"

#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "Projekt építésekor inkább a Fájl építése parancsot hívja meg"

#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "Projekt futtatásakor inkább a Fájl futtatása parancsot hívja meg"

#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Futtatás parancs"

#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Amikor ez a fájl aktív a forráskódszerkesztőben"

#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Munkakönyvtár (maradjon üres a fájl útvonalához)"

#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Nem alapértelmezett értékek félkövérré tétele"

#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Keret-térköz"

#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Lent"

#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Alsó keret-térköz. Ez az érték hozzáadódik az alap oldaltérközhöz és a vezérlő aljára vonatkozik."

#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Alsó oldal horgonyozása"

#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Alsó oldalak egy vonalban"

#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Ez az a társvezérlő, amelyikhez az alsó oldal horgonyzása történik. Hagyja üresen, hogy a szülőhöz történjen Delphi stílusban (a BorderSpacing és a ReferenceSide értéke nem számít)."

#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Alsó oldali távolságok egyenlően"

#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr "Böngészés és fordító kiválasztása (pl. ppcx64"

#: lazarusidestrconsts.lisbtnapply
msgid "&Apply"
msgstr ""

#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "Bezárás"

#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "Cse&re ..."

#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "Keresés"

#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "&Kilépés"

#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Eltávolítás"

#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr "&Átnevezás"

#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "Cse&re"

#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Építés"

#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
#, fuzzy
#| msgid "build all files of project/package/IDE"
msgid "Build all files of project/package/IDE."
msgstr "Projekt/csomag/IDE minden fájljának építése"

#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Építés"

#: lazarusidestrconsts.lisbuilddate
msgid "Build Date"
msgstr ""

#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "IDE építése"

#: lazarusidestrconsts.lisbuildidewithpackages
#, fuzzy
#| msgid "build IDE with packages"
msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option."
msgstr "IDE építése csomagokkal"

#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr "Építés"

#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "A Lazarus építése nem sikerült"

#: lazarusidestrconsts.lisbuildmode
#, object-pascal-format
msgid "Build Mode: %s"
msgstr "Építési mód: %s"

#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Különbségek az építési módok között"

#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Különbségek más építési módoktól"

#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Mód:"

#: lazarusidestrconsts.lisbuildmodes
#, fuzzy
#| msgid "Build modes"
msgid "Build mode"
msgstr "Építési módok"

#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Új projekt építése"

#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Építés száma"

#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "Építés"

#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Elfoglalt"

#: lazarusidestrconsts.lisbyte
#, object-pascal-format
msgid "%s byte"
msgstr "%s byte"

#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Ezt a komponenst ne töltse be"

#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Unit betöltés megszakítása"

#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Átnevezés megszakítása"

#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Projekt fordítása nem lehetséges"

#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Legfelső szintű komponenst nem lehet másolni."

#: lazarusidestrconsts.liscannotcreatefile
#, object-pascal-format
msgid "Cannot create file \"%s\""
msgstr "A fájl nem hozható létre: \"%s\""

#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr "Az utolsó mód nem törölhető."

#: lazarusidestrconsts.liscannotexecute
#, object-pascal-format
msgid "cannot execute \"%s\""
msgstr "nem futtatható: \"%s\""

#: lazarusidestrconsts.liscannotfind
#, object-pascal-format
msgid "Cannot find %s"
msgstr "Nem található: %s"

#: lazarusidestrconsts.liscannotfindexecutable
#, object-pascal-format
msgid "cannot find executable \"%s\""
msgstr "nem található a program \"%s\""

#: lazarusidestrconsts.liscannotfindlazarusstarter
#, object-pascal-format
msgid "Cannot find Lazarus starter:%s%s"
msgstr "A Lazarus indító nem található:%s%s"

#: lazarusidestrconsts.liscannotopenform
#, object-pascal-format
msgid "Cannot open form \"%s\"."
msgstr "A(z) \"%s\" form nem nyitható meg."

#: lazarusidestrconsts.liscannotsaveform
#, object-pascal-format
msgid "Cannot save form \"%s\"."
msgstr "A(z) \"%s\" form nem menthető."

#: lazarusidestrconsts.liscannotsubstitutemacros
#, object-pascal-format
msgid "Cannot substitute macro \"%s\"."
msgstr "A(z) \"%s\" makrót nem lehet behelyettesíteni."

#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "Nem tesztelhető a fordító hibakeresés vagy fordítás közben."

#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Csak TComponent-ek osztálya módosítható"

#: lazarusidestrconsts.liscantfindavalidppu
#, object-pascal-format
msgid "Can't find a valid %s.ppu"
msgstr "Nem található érvényes %s.ppu"

#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "Fájlok összehasonlítása (nem foltok létrehozásához)"

#: lazarusidestrconsts.liscaptionofactivebuildmode
msgid "Caption of active build mode"
msgstr ""

#: lazarusidestrconsts.liscbpfiles
#, object-pascal-format
msgid "%s (%s files)"
msgstr "%s (%s fájl)"

#: lazarusidestrconsts.liscbpreallydeletesourcefiles
#, object-pascal-format
msgid "Really delete %s source files%s%s"
msgstr "Valóban törlendő %s forrásfájl%s%s"

#: lazarusidestrconsts.lisccdchangeclassof
#, object-pascal-format
msgid "Change Class of %s"
msgstr "%s osztályának módosítása"

#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "nincs osztály"

#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Megtévesztő fordító"

#: lazarusidestrconsts.lisccochecktestdir
#, object-pascal-format
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Ellenőrizze a teszt könyvtárat itt: %sEszközök --> Beállítások -> Könyvtár a tesztprojektek építéséhez"

#: lazarusidestrconsts.lisccocompilernotanexe
#, object-pascal-format
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "A(z) \"%s\" fordító nem futtatható fájl.%sRészletek: %s"

#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "tartalmaz "

#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Kimenet másolása a vágólapra"

#: lazarusidestrconsts.lisccodatesdiffer
#, object-pascal-format
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Az FPC .ppu fájljainak dátuma több mint egy órával eltér.%sEz azt jelentheti, hogy különböző telepítésből származnak.%sFájl1: %s%sFájl2: %s"

#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "HIBA:"

#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "FPC unit elérési út tartalmaz egy forrást:"

#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "újsor szimbólumok"

#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "TIPP:"

#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Érvénytelen fordító"

#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Érvénytelen keresési útvonal"

#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Érvénytelen teszt könyvtár"

#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Hiányzó unit"

#: lazarusidestrconsts.lisccomsgrtlunitnotfound
#, object-pascal-format
msgid "RTL unit not found: %s"
msgstr "RTL unit nem található: %s"

#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "többszörös fordítóbeállítások találhatók:"

#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "fpc.cfg nem található"

#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "nem ASCII"

#: lazarusidestrconsts.lisccoppuexiststwice
#, object-pascal-format
msgid "ppu exists twice: %s, %s"
msgstr "ppu kétszer létezik: %s, %s"

#: lazarusidestrconsts.lisccoppuolderthancompiler
#, object-pascal-format
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Ez a .ppu fájl régebbi, mint a fordító maga: %s%s"

#: lazarusidestrconsts.lisccortlunitnotfounddetailed
#, object-pascal-format
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr "Az RTL részét képező %s unit nem található.%sEz általában azt jelenti, hogy a(z) %s rossz útvonalat tartalmaz vagy a telepítés hibás."

#: lazarusidestrconsts.lisccoseveralcompilers
#, object-pascal-format
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "Több Free Pascal fordító is van az útvonalakon.%s%s%sTalán nem lett törölve egy régebbi fordító?"

#: lazarusidestrconsts.lisccoskip
msgctxt "lazarusidestrconsts.lisccoskip"
msgid "Skip"
msgstr "Átlépés"

#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "különleges karaktereket"

#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Minden teszt sikerült."

#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "A tesztfájl létrehozása nem lehetséges"

#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, object-pascal-format
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "A(z) \"%s\" pascal tesztfájl létrehozása nem lehetséges."

#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "szokatlan karaktereket"

#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Figyelmeztetés"

#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "FIGYELMEZTETÉS:"

#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "hibás útvonal elválasztó"

#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Kategóriák"

#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Összetettség"

#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Konstansok"

#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Üres blokkok"

#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Üres osztály szakaszok"

#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Üres szerkezetek"

#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Üres eljárások"

#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(szűrő)"

#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "beszúrási jel követése"

#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Egy gyökér vezérlő"

#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "\"Sok\"-nak tekintett paraméterek száma"

#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Hosszú eljárások"

#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "\"Hosszú\"-nak tekintett eljárások sorainak száma"

#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Sok egymásba ágyazott eljárás"

#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Sok paraméter"

#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Kategóriák megjelenítése"

#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Forrás csomópontok megjelenítése"

#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "A \"Sok\"-nak tekintett egymásba ágyazott eljárások száma"

#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Elveszett ablak középre helyezése"

#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Vezérlő középre igazítása vízszintesen, az adott testvérhez viszonyítva. A BorderSpacing nem számít."

#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Vezérlő középre igazítása függőlegesen, az adott testvérhez viszonyítva. A BorderSpacing nem számít."

#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Form középre helyezése"

#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Ablakban középre"

#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Középvonalak egyvonalba"

#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Előnyben részesített megjelenítési mód"

#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Kategória"

#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Forrás"

#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Soha, csak kézzel"

#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Csak kategória módban használva"

#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "Üresjáratban"

#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Automatikus frissítés"

#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Egyéb"

#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Frissítés"

#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "Másik fájl kiválasztásakor a forráskódszerkesztőben"

#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Eljárások"

#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Tulajdonságok"

#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "\"Published\" tulajdonságok \"default\" nélkül"

#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Észrevételek megjelenítése erről:"

#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Stílus"

#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Környezet"

#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Tennivalók (ToDo)"

#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Típusok"

#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Névtelen konstansok"

#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Rendezetlen tagok"

#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Rendezetlen láthatóság"

#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Uses"

#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Változók"

#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Hibás behúzás"

#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
#, object-pascal-format
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "Kivétel keletkezett a következő törlése közben:%s\"%s:%s\"%s%s"

#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Nem tudom, hogyan kell másolni ezt a kijelölést az Form szerkesztőben"

#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Nem tudom, hogyan kell kivágni ezt a kijelölést az Form szerkesztőben"

#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Nem tudom, hogyan kell törölni ezt a kijelölést az Form szerkesztőben"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Hiba a komponens létrehozása közben"

#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
#, object-pascal-format
msgid "Error creating component: %s%s%s"
msgstr "Hiba a komponens létrehozása közben: %s%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Hiba a komponens megsemmisítése közben"

#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
#, object-pascal-format
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Hiba a(z) %s típusú komponens megsemmisítése közben a(z) %s unitból:%s%s"

#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Hiba a közvetítő megsemmisítése közben"

#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
#, object-pascal-format
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Hiba a(z) %s közvetítő megsemmisítése közben a(z) %s unitból:%s%s"

#: lazarusidestrconsts.liscfeinfile
#, object-pascal-format
msgid "In file %s"
msgstr "A(z) %s fájlban"

#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Érvénytelen komponens tulajdonos"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm már létezik"

#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
#, object-pascal-format
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Ismeretlen típus: %s"

#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
#, object-pascal-format
msgid "TCustomFormEditor.DeleteComponent  Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent  Hol van a TCustomNonFormDesignerForm? %s"

#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
#, object-pascal-format
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator már regisztrálva van: %s"

#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "A(z) \"%s\" osztály komponensszerkesztője a következő hibát okozta:%s\"%s\""

#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
#, object-pascal-format
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "A(z) %s típusú komponens nem tudta beállítani saját szülőjeként ezt: %s:%s"

#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, object-pascal-format
msgid "Unable to clear the form editing selection%s%s"
msgstr "Nem lehet megszüntetni a kijelölést az Form szerkesztőben%s%s"

#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Módosítás"

#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Építési mód váltása"

#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Osztály módosítása"

#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
#, object-pascal-format, fuzzy, badformat
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "A(z) %1:s %0:s koordinátája megváltozott erről: %2:d, erre: %3:d, ebben: %4:s."

#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Kódolás módosítása"

#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Fájl módosítása"

#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Szülő módosítása"

#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "A változások nincsenek mentve"

#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Váltás Unix-ra: /"

#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Váltás Windows-ra: \\"

#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Mindet kijelöli"

#: lazarusidestrconsts.lischeckcompilerpath
msgid "Please make sure that the path to the compiler in the IDE options is correct."
msgstr ""

#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "A fájlok megváltozását a lemezen inkább a tartalom, mint az időbélyeg alapján figyelje"

#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
#, object-pascal-format
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ". Ellenőrizni kell, hogy a(z) %s csomag létrehozza-e a(z) %s.ppu-t, hogy semmi sem törli ezt a fájlt és hogy nem két csomag használja-e a unit forrását!"

#: lazarusidestrconsts.lischeckifpackageisinthedependencies
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ". Ellenőrizni kell, hogy a(z) %s csomag szerepel-e a függőségek között"

#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "Ellenőrizze, hogy a következő szimbólum a forrásban egy \"end\" és hogy nem ad-e vissza \"LineEnding + end; + LineEnding\" sorozatot."

#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Beállítások ellenőrzése"

#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ". Ellenőrizze a(z) %s csomag keresési útvonalát, próbáljon tiszta újraépítést, ellenőrizze a kidolgozás uses szakaszát!"

#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr "A forráskód következő elemének vizsgálata alapján pontosvessző beillesztése ha szükséges."

#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, object-pascal-format
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Ellenőrizze a célt (OS, CPU, LCL vezérlőkészlet típusa)! Talán újra kell fordítani a csomagot ehhez a célhoz vagy másik célt választani a projekthez."

#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr "Minden/Semmi kijelölése"

#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Válasszon egy másik nevet!"

#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "Válasszon egy fájlt CodeTools sablonokkal!"

#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Válasszon egy FPDoc hivatkozást!"

#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Válasszon egy billentyűt ..."

#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr "Válasszon nevet a komponensnek!"

#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Válasszon egy példa fájlt!"

#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Válasszon egy FPC üzenetfájlt!"

#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Válasszon egy pascal fájlt behúzási példaként!"

#: lazarusidestrconsts.lischoosecompilerexecutable
#, object-pascal-format
msgid "Choose compiler executable (%s)"
msgstr "Válasszon fordító programot! (%s)"

#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Válasszon egy fordítóüzenet fájlt! "

#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Válasszon hibakereső programot!"

#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Válasszon Delphi csomagot! (*.dpk)"

#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Válasszon Delphi projektet! (*.dpr)"

#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Válasszon Delphi unit-ot! (*.pas)"

#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Válasszon könyvtárat!"

#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr "Válasszon egy programot!"

#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Válasszon FPC forrás könyvtárat!"

#: lazarusidestrconsts.lischoosefppkgconfigurationfile
msgid "Choose the fppkg configuration file"
msgstr ""

#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Válasszon Lazarus könyvtárat!"

#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "Válasszon \"make\" programot!"

#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr "Válasszon nevet és szöveget"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Válasszon egyet ezek közül új fájl létrehozásához!"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Válasszon egyet ezek közül új csomag létrehozásához!"

#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Válasszon egyet ezek közül új projekt létrehozásához!"

#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Válasszon egyet ezek közül egy meglévő elemből való származtatáshoz!"

#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Válasszon program forráskódot! (*.pp,*.pas,*.lpr)"

#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Válasszon struktúrát a közrezáráshoz!"

#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Válassza ki a tesztek könyvtárát!"

#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Körkörös függőség érzékelve"

#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr "&Osztály"

#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Osztályok kiegészítése"

#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Az osztály és a tulajdonságok léteznek, Az értékek nem lettek ellenőrizve."

#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, object-pascal-format
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "A(z) \"%s\" osztály nem egy regisztrált komponens osztály.%sNem lehet beilleszteni."

#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Osztály nem található"

#: lazarusidestrconsts.lisclassnotfoundat
#, object-pascal-format
msgid "Class %s not found at %s(%s,%s)"
msgstr "A(z) %s osztály nem található itt: %s(%s,%s)"

#: lazarusidestrconsts.lisclassofmethodnotfound
#, object-pascal-format
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "A(z) \"%s\" osztály, amely a \"%s\" metódust tartalmazza nem található."

#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Törlés"

#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Könyvtár tisztítása"

#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Alkönyvtárak tisztítása"

#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Minden szövegfájl megtartása"

#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "A szűrőfeltételeknek megfelelő fájlok megtartása"

#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "A szűrőfeltételeknek megfelelő fájlok eltávolítása"

#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Egyszerű szintaxis (pl. .* helyett *)"

#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Minden tisztítása"

#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Lazarus forráskód tisztítása"

#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "Építés után váltás automatikusra"

#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Tisztítás"

#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Tisztítás és építés"

#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Tisztítás és projekt építése"

#: lazarusidestrconsts.liscleanuplazbuild
msgid "Clean up + lazbuild"
msgstr ""

#: lazarusidestrconsts.liscleanuppackage
#, object-pascal-format
msgid "Clean up package \"%s\"."
msgstr "Csomag tisztítása: \"%s\""

#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Unit-ok elérési útjának tisztítása?"

#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Kiürítés"

#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Könyvtár tartalmának törlése?"

#: lazarusidestrconsts.lisclearfilter
msgid "Clear filter"
msgstr ""

#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Beállításszűrők törlése"

#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Kattintson ide a fájl böngészéséhez"

#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr "Kattintson ide a lehetőségek megjelenítéséhez"

#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr "Kattintson a paletta-lap kiválasztásához!"

#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Klónozás"

#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Bezárás"

#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Minden kijelölt bezárása"

#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Fájlok bezárása"

#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Ablak elrejtése"

#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Forráskódszerkesztő bezárása. Be akarja zárni az összes fájlt vagy elrejteni az ablakot?"

#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Forráskódszerkesztő bezárása"

#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "LCL felületfüggő beállítások:"

#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Paraméter"

#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Komponensek"

#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Öröklődés"

#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Lista"

#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Paletta"

#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Lapok"

#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr "A paletta látható"

#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "Alaphelyzet"

#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Megtévesztő további fordítóbeállítási fájl"

#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Meghívás:"

#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, object-pascal-format
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sKattintson az OK-ra ha mindenképpen ezt akarja tenni!"

#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Parancs:"

#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Kód"

#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Kódtallózó"

#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr "Kód létrehozásának beállításai"

#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr "Osztály szakasz"

#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Hely"

#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Kód létrehozásának beállításai"

#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Útvonal hozzáadása"

#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Tallózás"

#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Csere megerősítése"

#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Súgó elem létrehozása"

#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Útvonal törlése"

#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Leírás"

#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Hibák"

#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Példa"

#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "FPDoc beállításai"

#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Félkövér formázó címke beszúrása"

#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Kód formázó címke beszúrása"

#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Dőlt formázó címke beszúrása"

#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Megjegyzés formázó címke beszúrása"

#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Aláhúzott formázó címke beszúrása"

#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Változó formázó címke beszúrása"

#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Öröklött"

#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Link beszúrása ..."

#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Bekezdés formázó címke beszúrása"

#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "FPDoc szerkesztő"

#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(öröklött leírás nem található)"

#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<SEMMI>"

#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Lásd még"

#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Rövid leírása"

#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Rövid"

#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgctxt "lazarusidestrconsts.liscodeobignoreconstinfuncs"
msgid "Ignore constants in next functions"
msgstr "Konstansok kihagyása a következő függvényekben"

#: lazarusidestrconsts.liscodeobscharconst
msgctxt "lazarusidestrconsts.liscodeobscharconst"
msgid "Search for unnamed char constants"
msgstr "Névtelen karakter konstansok megkeresése"

#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Kódvizsgáló"

#: lazarusidestrconsts.liscodeobsignoreeconstants
msgctxt "lazarusidestrconsts.liscodeobsignoreeconstants"
msgid "Ignore next unnamed constants"
msgstr "A következő meg nem nevezett konstansok kihagyása"

#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Sablon hozzáadása"

#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Kódsablon hozzáadása"

#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Automatikus kiegészítés bekapcsolva"

#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Megjegyzés:"

#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Kódsablon szerkesztése"

#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Hiba"

#: lazarusidestrconsts.liscodetemplerroralreadyexists
msgid "A token already exists."
msgstr ""

#: lazarusidestrconsts.liscodetemplerroremptyname
msgid "The token cannot be empty."
msgstr ""

#: lazarusidestrconsts.liscodetemplerrorinvalidname
msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number."
msgstr ""

#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Megnevezés:"

#: lazarusidestrconsts.liscodetoolsdefsaction
#, object-pascal-format
msgid "Action: %s"
msgstr "Művelet: %s"

#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, object-pascal-format
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Az automatikusan létrehozott csomópontok nem szerkeszthetők,%sés nem is rendelkezhetnek nem automatikusan létrehozott gyermek csomópontokkal."

#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, object-pascal-format
msgid "%s, auto generated"
msgstr "%s, automatikusan generált"

#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "Az automatikusan létrehozott csomópontok nem szerkeszthetők."

#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Blokk"

#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "CodeTools beállításszerkesztő"

#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Fordító útvonala"

#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Csomópont átalakítása"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, object-pascal-format
msgid "Create Defines for %s Directory"
msgstr "Beállítások létrehozása a(z) %s könyvtárhoz"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Beállítások létrehozása a Free Pascal fordítóhoz"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
#, fuzzy
#| msgid "Create Defines for Free Pascal SVN Sources"
msgid "Create Defines for Free Pascal Git Sources"
msgstr "Beállítások létrehozása a Free Pascal SVN forrásokhoz"

#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, object-pascal-format
msgid "Create Defines for %s Project"
msgstr "Beállítások létrehozása a(z) %s projekthez"

#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "FPC makrók és útvonalak létrehozása egy FPC porjekt könyvtárhoz"

#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Define"

#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Define (rekurzív)"

#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Csomópont törlése"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "A(z) %s fő könyvtár,%sahová a Borland az összes %sforrását telepítette.%sPéldául: C:\\Programok\\Borland\\Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "A(z) %s fő könyvtár,%sahová a Borland az összes %s forrását telepítette,%samelyeket ez a %s projekt használ.%sPéldául: C:\\Programok\\Borland\\Delphi%s"

#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Leírás:"

#: lazarusidestrconsts.liscodetoolsdefsdirectory
#, object-pascal-format
msgid "%s directory"
msgstr "%s könyvtár"

#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"

#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"

#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
#, fuzzy
#| msgid "FPC SVN source directory"
msgid "FPC Git source directory"
msgstr "FPC SVN forráskód könyvtár"

#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"

#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"

#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"

#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Könyvtár"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Delphi 5 fordító sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Delphi 5 könyvtár sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Delphi 5 projekt sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Delphi 6 fordító sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Delphi 6 könyvtár sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Delphi 6 projekt sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Delphi 7 fordító sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Delphi 7 könyvtár sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Delphi 7 projekt sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Free Pascal fordító sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Free Pascal projekt sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
#, fuzzy
#| msgid "Insert Free Pascal SVN Source Template"
msgid "Insert Free Pascal Git Source Template"
msgstr "Free Pascal SVN forráskód sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Kylix 3 fordító sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Kylix 3 könyvtár sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Kylix 3 projekt sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Csomópont beszúrása gyermekként"

#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Csomópont beszúrása alá"

#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Sablon beillesztése"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Érvénytelen szülő"

#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Érvénytelen szülő csomópont"

#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Érvénytelen előző csomópont"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "A(z) %s fő könyvtár,%sahová a Borland az összes %s forrását telepítette.%sPéldául: /home/users/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "A(z) %s fő könyvtár,%sahová a Borland az összes %s forrását telepítette,%samelyeket ez a %s projekt használ.%sPéldául: /home/user/kylix%s"

#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Csomópont mozgatása lefelé"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Csomópont mozgatása egy szinttel lejjebb"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Csomópont mozgatása egy szinttel feljebb"

#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Csomópont mozgatása felfelé"

#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Név:"

#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Új csomópont"

#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "A csomópont csak olvasható"

#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "semmi nincs kijelölve"

#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "A szülő csomópont nem tartalmazhat gyerek csomópontokat."

#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Az előző csomópont nem tartalmazhat gyerek csomópontokat."

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Projekt könyvtár"

#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, object-pascal-format
msgid "%s project directory"
msgstr "%s projekt könyvtár"

#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Kijelölt csomópont:"

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
#, fuzzy
#| msgid "The Free Pascal SVN source directory. Not required. This will improve find declaration and debugging."
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
msgstr "A Free Pascal fordító útvonala . Nem szükséges. Javítja a deklarációk és a hibák keresését."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "A Free Pascal projekt könyvtára."

#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
#, fuzzy
#| msgid "The Free Pascal SVN source directory."
msgid "The Free Pascal Git source directory."
msgstr "A Free Pascal SVN forráskód könyvtára."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, object-pascal-format
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "A Free Pascal fordító útvonala.%s Például: %s/usr/bin/%s -n%s vagy %s/usr/local/bin/fpc @/etc/fpc.cfg%s."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
#, fuzzy
#| msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros."
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
msgstr "A Free Pascal fordító útvonala ehhez a projekthez. Csak akkor van rá szükség ha lentebb be van állítva az FPC SVN forrás. Makrók automatikus létrehozásához használatos."

#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
#, object-pascal-format
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "A Free Pascal fordító útvonala ehhez a forráskódhoz.%sMakrók automatikus létrehozásához használatos."

#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
#, object-pascal-format
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "A(z) %s projekt könyvtára,%samely tartalmazza a .dpr, dpk fájlokat."

#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Undefine"

#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Undefine (mind)"

#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Undefine (rekurzív)"

#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Az érték fájlútvonalként"

#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Az érték szövegként"

#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
#, object-pascal-format
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%saz érték érvénytelen: \"%s\"."

#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Változó:"

#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "@"

#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Zárójel"

#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr "Kalap-jel (^)"

#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Kettőspont"

#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Vessző"

#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Azonosító"

#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Kulcsszó"

#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Újsor"

#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Semmi"

#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Szám"

#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Pont"

#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Pontosvessző"

#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Szóköz"

#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Szöveg konstans"

#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Szimbólum"

#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Utólag végrehajtandó"

#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Előzőleg végrehajtandó"

#: lazarusidestrconsts.liscollapse
msgid "Collapse"
msgstr ""

#: lazarusidestrconsts.liscollapseall
#, fuzzy
#| msgid "Collapse All (/)"
msgid "Collapse All [Ctrl+Minus]"
msgstr "Mindet összecsukja (/)"

#: lazarusidestrconsts.liscollapseall2
msgid "Collapse All"
msgstr ""

#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Minden osztály összecsukása"

#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Minden csomag összecsukása"

#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Minden unit összecsukása"

#: lazarusidestrconsts.liscomboboxes
msgid "Combo Boxes"
msgstr "Kombinált listák"

#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Parancssori paraméterek"

#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "A program parancssori paraméterei"

#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Fordítás"

#: lazarusidestrconsts.liscompileanddonotaskagain
msgid "Compile and do not ask again"
msgstr "Fordítás és ne kérdezze újra"

#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr "Építés a következő módokban"

#: lazarusidestrconsts.liscompilenormally
msgid "Compile normally"
msgstr ""

#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Projekt fordítása"

#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Fordító"

#: lazarusidestrconsts.liscompilercfgismissing
#, object-pascal-format
msgid "%s is missing."
msgstr "%s nem található."

#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
#, object-pascal-format
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "A(z) \"%s\" fordító nem támogatja a célt: %s-%s"

#: lazarusidestrconsts.liscompilererrorinvalidcompiler
#, object-pascal-format
msgid "Error: invalid compiler: %s"
msgstr "Hiba: érvénytelen fordító: %s"

#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Fordító fájlneve"

#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Tipp: A fordító útvonala beállítható a menüben: Eszközök -> Beállítások -> Fájlok -> Fordító útvonala"

#: lazarusidestrconsts.liscompilermessagesfilenotfound
#, object-pascal-format
msgid "Compiler messages file not found:%s%s"
msgstr "A fordító üzenetek fájlja nem található:%s%s"

#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "MEGJEGYZÉS: a CodeTools beállításfájl nem található - az alapértelmezések lesznek használva"

#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "MEGJEGYZÉS: a régi CodeTools beállításfájl beolvasása:"

#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "Fordítás"

#: lazarusidestrconsts.liscompilewithprojectsettings
msgid "Compile with project settings"
msgstr "Fordítás a projekt beállításaival"

#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "A részletekért -vd használatával kell újrafordítani. Másolatokat kell keresni!"

#: lazarusidestrconsts.liscompiling
#, object-pascal-format
msgid "%s (compiling ...)"
msgstr "%s (fordítás ...)"

#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Hosszú sor tippek megjelenítése"

#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Meghosszabbítás a bal szélig"

#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Meghosszabbítás kicsit balra"

#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Soha"

#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Meghosszabbítás csak jobbra"

#: lazarusidestrconsts.liscomponentnameiskeyword
#, object-pascal-format
msgid "Component name \"%s\" is keyword"
msgstr "A(z) \"%s\" komponens név egy kulcsszó"

#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Összes megjelenítése"

#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Csomag megnyitása"

#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Unit megnyitása"

#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr "Tömörítés"

#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr "A létrejövő könyvtár ZIP fájlba lesz tömörítve."

#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Teszt"

#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Feltétel"

#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Feltételes definíciók"

#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Lazarus beállítások könyvtára"

#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr "A kiegészítések beállítási fájlja:"

#: lazarusidestrconsts.lisconfigurebuild
#, object-pascal-format
msgid "Configure Build %s"
msgstr "%s építésének beállítása"

#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "\"Lazarus építés\" beállítása"

#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr "Eszköztár beállítása"

#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Lazarus IDE beállítása"

#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Megerősítés"

#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Megerősítés"

#: lazarusidestrconsts.lisconfirmbuildallprofiles
#, object-pascal-format
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "A Lazarus újra lesz építve a következő profil alapján:%sFolytatja?"

#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Változások jóváhagyása"

#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Törlés jóváhagyása"

#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, object-pascal-format
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Újra kívánja építeni a Lazarus-t a(z) \"%s\" profil alapján?"

#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "AZ IDE új csomagkészletének megerősítése"

#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Művelet"

#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Új csomagkészlet"

#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Régi csomagkészlet"

#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Ütközés"

#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Ütközés észlelhető"

#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Konzolos alkalmazás"

#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Egy parancssoros Free Pascal program, mely a TCustomApplication-t használja a paraméterek ellenőrzéséhez, kivételkezeléshez stb."

#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Konstruktor kód"

#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "tartalmazza"

#: lazarusidestrconsts.liscontents
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Tartalom"

#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "Helyérzékeny"

#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Folytatás és ne kérdezze újra"

#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr "Építés folytatása"

#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Folytatás form betöltése nélkül"

#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Közreműködők"

#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "A vezérlőnek szülőre van szüksége"

#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Megjegyzés hozzáadása csere után"

#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr "A unit neve után a 'MODE Delphi' szintaxis módosító hozzáadásra került."

#: lazarusidestrconsts.lisconvaddingflagforregister
#, object-pascal-format
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr "Jelző hozzáadása a \"Register\" eljáráshoz a(z) %s unit-ban."

#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
#, object-pascal-format
msgid "\")\" is missing from replacement function: %s"
msgstr "Hiányzik a \")\" a csereeljárásból: %s"

#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr "Zárójel nem található"

#: lazarusidestrconsts.lisconvconvertedfrom
#, object-pascal-format
msgid " { *Converted from %s* }"
msgstr " { *Átlalakítva ebből: %s* }"

#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Eltolás hozzáadódik a vezérlők felső koordinátáihoz az őket tartalmazó látható területen belül"

#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Koordináták eltolása"

#: lazarusidestrconsts.lisconvdeletedfile
#, object-pascal-format
msgid "Deleted file %s"
msgstr "Törölt fájl: %s"

#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
#, object-pascal-format
msgid "Added defines %s in custom options"
msgstr "%s definíció hozzáadva az egyéni beállításokhoz"

#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
#, object-pascal-format
msgid "Added Package %s as a dependency."
msgstr "A(z) %s csomag hozzáadva függőségként."

#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
#, object-pascal-format
msgid "Added unit \"%s\" to uses section."
msgstr "A(z) \"%s\" unit hozzá lett adva a uses szakaszhoz."

#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Minden alkönyvtárban keresve lesznek a unit fájlok"

#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "Sikertelen BeginCodeTools!"

#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Kategóriák:"

#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
#, object-pascal-format
msgid "Changed encoding from %s to UTF-8"
msgstr "Karakterkódolás átalakítva UTF-8-ra erről: %s"

#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Az átalakítás megszakadt."

#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Az átalakítás kész."

#: lazarusidestrconsts.lisconvdelphiconversiontook
#, object-pascal-format
msgid "Conversion took: %s"
msgstr "Az átalakítás időtartama: %s volt"

#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Delphi csomag átalakítása"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "&Delphi projekt átalakítása"

#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Delphi unit átalakítása"

#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Az átalakítás közben talált unit fájlok átalakítása ***"

#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** A csomaghoz/projekthez tartozó unit fájlok átalakítása ***"

#: lazarusidestrconsts.lisconvdelphierror
#, object-pascal-format
msgid "Error=\"%s\""
msgstr "Hiba=\"%s\""

#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "Kivétel keletkezett a unit átalakítása közben. Folytatás a már átalakított unitok form fájljaival..."

#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "A unit átalakítása sikertelen"

#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
#, object-pascal-format
msgid "Failed to convert unit \"%s\""
msgstr "A unit átalakítása sikertelen: \"%s\""

#: lazarusidestrconsts.lisconvdelphifixedunitcase
#, object-pascal-format
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "A unit betűméretének véglegesítése erről: \"%s\" erre: \"%s\""

#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Minden unit-fájl megkeresése"

#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Delphi eljárás"

#: lazarusidestrconsts.lisconvdelphimissingincludefile
#, object-pascal-format
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) hiányzó include fájl"

#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Delphi név"

#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Létező csomagnév"

#: lazarusidestrconsts.lisconvdelphipackagerequired
#, object-pascal-format
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "A(z) %s csomag szükséges, de nincs telepítve a Lazarus-ban! Telepítés később."

#: lazarusidestrconsts.lisconvdelphiprojomittedunit
#, object-pascal-format
msgid "Omitted unit %s from project"
msgstr "A(z) %s unit kihagyva a projektből"

#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
#, object-pascal-format
msgid "Removed unit \"%s\" from uses section."
msgstr "A(z) \"%s\" unit el lett távolítva a uses szakaszból."

#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Használt unit-ok véglegesítése és a form fájlok rendbeszedése ***"

#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "A(z) \"%s\" unit a \"%s\" unit-ra lett cserélve a uses szakaszban."

#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
#, object-pascal-format
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Már létezik egy csomag ezzel a névvel: \"%s\"%sElőször zárja be ezt a csomagot!"

#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "A unit-név megtalálható az LCL-ben"

#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
#, object-pascal-format
msgid "Units to replace in %s"
msgstr "Cserélendő unit-ok itt: %s"

#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
#, object-pascal-format
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "Az LCL már tartalmaz egy unit-ot ezzel a névvel: %s. Törli a helyi %s fájlt?"

#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr "A .dproj fájlok nincsenek támogatva. Ezeket a Delphi 2007 vagy újabbak használják. Válasszon .dpr fájlt a projektek és .dpk fájlt a csomagok esetében!"

#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Átalakításisi hiba"

#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Átalakítás"

#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Karakterkódolás átalakítása"

#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Projektek/csomagok kódolásának átalakítása"

#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr "Az átalakítást érintő egyéb beállítások"

#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Projekt vagy csomag átalakítása"

#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Cél"

#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Keresztplatform"

#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Keresztplatform vagy csak-Windows"

#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Az átalakító hozzáadja a feltételes fordítás lehetőséget a különböző cél-platformok támogatására"

#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Használja ugyanazt a DFM form fájlt"

#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Ugyanaz a DFM fájl Lazarus és Delphi számára LFM-be másolás helyett"

#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Delphi támogatása"

#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Feltételes fordítás használata a Delphi támogatásához"

#: lazarusidestrconsts.lisconvfixedunitname
#, object-pascal-format
msgid "Fixed unit name from %s to %s."
msgstr "A unit-név javítva lett erről:  %s, erre: %s"

#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Eljárás cserék"

#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Néhány Delphi eljárás helyettesíthető LCL eljárással"

#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Cserélendő függvények / eljárások"

#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Baloldali eltolás"

#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "új név"

#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Szülő tároló"

#: lazarusidestrconsts.lisconvproblemsfindingallunits
#, object-pascal-format
msgid "Problems when trying to find all units from project file %s"
msgstr "Gondok a(z) %s projektfájlban használt összes unit megkeresése közben"

#: lazarusidestrconsts.lisconvproblemsfixingincludefile
#, object-pascal-format
msgid "Problems when fixing include files in file %s"
msgstr "Gondok a(z) %s fájl beemelt fájljainak rendbeszedése közben"

#: lazarusidestrconsts.lisconvproblemsrepairingformfile
#, object-pascal-format
msgid "Problems when repairing form file %s"
msgstr "Gondok a(z) %s form-fájl rendbeszedése közben"

#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr "Include fájlok rendbeszedése:"

#: lazarusidestrconsts.lisconvreplacedcall
#, object-pascal-format
msgid "Replaced call %s with %s"
msgstr "A(z) %s hívás le lett cserélve erre: %s"

#: lazarusidestrconsts.lisconvreplfuncparameternum
#, object-pascal-format
msgid "Replacement function parameter number should be >= 1: %s"
msgstr "A csere eljárás paramétereinek száma >= 1 legyen: %s"

#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
#, object-pascal-format
msgid "\"$\" should be followed by a number: %s"
msgstr "A \"$\" jel után számnak kell következni: %s"

#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr "Leállítva, mert már létezik egy azonos nevű csomag"

#: lazarusidestrconsts.lisconvthislogwassaved
#, object-pascal-format
msgid "This log was saved to %s"
msgstr "Ez a napló mentve lett ide: %s"

#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Felső eltolás"

#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Tipus cserék"

#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Ismeretlen típusok a form fájlban (DFM/LFM)"

#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Cserélendő típusok"

#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Unit cserék"

#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Unit-nevek egy forrás unit uses szakaszában"

#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Cserélendő unitok"

#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Ismeretlen tulajdonságok"

#: lazarusidestrconsts.lisconvuserselectedtoendconversion
#, object-pascal-format
msgid "User selected to end conversion with file %s"
msgstr "A felhasználó úgy döntött, hogy befejezi az átalakítást e fájllal: %s"

#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr "Eszköztár(ak) hozzáadása/beállítása/törlése"

#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr "Elválasztó hozzáadása"

#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr "A kijelölt elem hozzáadása az eszköztárhoz"

#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr "Elérhető parancsok"

#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr "Eszköztárak keretének stílusa"

#: lazarusidestrconsts.liscoolbarborderstyleitem0
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Nincs"

#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Egyszeres"

#: lazarusidestrconsts.liscoolbarcodeexplorer
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Kódböngésző"

#: lazarusidestrconsts.liscoolbarcodetemplates
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Kódsablonok"

#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr "&Beállítás"

#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr "Biztosan törölhető a kijelölt eszköztár?"

#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr "Legalább egy eszköztárnak léteznie kell!"

#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr "Tervező"

#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr "Általános eszköztár beállításai"

#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr "Eszköztárak fogantyújának stílusa"

#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr "Egyszerű"

#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Kétszeres"

#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr "Vízszintes vonalak"

#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr "Függoleges vonalak"

#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr "Fogantyú"

#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Nyomógomb"

#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr "Fogantyú szélessége"

#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr "IDE Főmenü"

#: lazarusidestrconsts.liscoolbarmessages
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Üzenetek"

#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr "A kijelölt eszköztárelem mozgatása lefelé"

#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr "A kijelölt eszköztárelem mozgatása felfelé"

#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr "IDE eszköztár"

#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr "Csomagszerkesztő"

#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr "Csomagszerkesztő fájljai"

#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr "A kijelölt elem eltávolítása az eszköztárról"

#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr "Alaphelyzet"

#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr "Előbb ki kell választani egy eszköztárat!"

#: lazarusidestrconsts.liscoolbarsourceeditor
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Forráskódszerkesztő"

#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr "Forrás-fül"

#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr "Eszköztár parancsai"

#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr "Az eszköztár látható"

#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr "Eszköztár szélessége"

#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Minden elem másolása a vágólapra"

#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Minden/Eredeti üzenetek másolása a vágólapra"

#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Minden megjelenített üzenet másolása a vágólapra"

#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Leírás másolása a vágólapra"

#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Hiba másolása"

#: lazarusidestrconsts.liscopyfilename
#, object-pascal-format
msgid "Copy Filename %s"
msgstr "Fájlnév másolása: %s"

#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Fájlnév másolása a vágólapra"

#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr "A fájlok másolása nem sikerült"

#: lazarusidestrconsts.liscopyidentifier
#, object-pascal-format
msgid "Copy \"%s\" to clipboard"
msgstr "\"%s\" másolása a vágólapra"

#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "A teljes form másolása nem lehetséges."

#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Elem másolása a vágólapra"

#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Fájl másolása/áthelyezése könyvtárba"

#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Kijelölt elemek másolása a vágólapra"

#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Kijelölt üzenetek másolása a vágólapra"

#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "FPC üzenet keresése"

#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Make üzenet keresése"

#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Kihagyja a fordító hivását"

#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Figyelmeztetés: A hozzáadott fordító beállítási fájl neve megegyezik az egyik szabványos beállítási fájllal, amelyet a Free Pascal keres. Ez azt okozhatja, hogy CSAK a hozzáadott beállítási fájl lesz elemezve és kimarad a szabványos beállítás."

#: lazarusidestrconsts.liscpopenpackage
#, object-pascal-format
msgid "Open Package %s"
msgstr "%s csomag megnyitása"

#: lazarusidestrconsts.liscpopenunit
#, object-pascal-format
msgid "Open Unit %s"
msgstr "%s unit megnyitása"

#: lazarusidestrconsts.liscpu
#, object-pascal-format
msgid ", CPU: %s"
msgstr ", CPU: %s"

#: lazarusidestrconsts.liscreateandedit
msgid "Create and edit"
msgstr ""

#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Először hozzon létre projektet!"

#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Hibakereső és kiadási módok létrehozása"

#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Létrehozza a könyvtárat?"

#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Szűrő létrehozása"

#: lazarusidestrconsts.liscreatefppkgconfig
msgid "Restore Fppkg configuration"
msgstr "Fppkg beállítások visszaállítása"

#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Függvény létrehozása"

#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Súgó csomópont létrehozása"

#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Hozza létre"

#: lazarusidestrconsts.liscreatelocalvariable
#, object-pascal-format
msgid "Create local variable \"%s\""
msgstr "Helyi változó létrehozása: \"%s\""

#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr "Új kiegészítés létrehozása"

#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Új csomag létrehozása)"

#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Új csomag-komponens létrehozása"

#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Projekt létrehozása"

#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Hozza létre / frissítse a .po fájlt az lfm mentésekor"

#: lazarusidestrconsts.liscreatingfileindexoffpcsources
#, object-pascal-format
msgid "Creating file index of FPC sources %s ..."
msgstr "Az FPC források fájlindexének elkészítése %s ..."

#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Válasszon könyvtárat!"

#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "CodeTools könyvtár értékei"

#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Sablonok megadása"

#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<nincs kijelölt változó>"

#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Előnézet megnyitása"

#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "E&szközök"

#: lazarusidestrconsts.lisctdefvariable
#, object-pascal-format
msgid "Variable: %s"
msgstr "Változó: %s"

#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Változó név"

#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Sablonok"

#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Frissítse a metódusok összes begépelését"

#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Frissítse az eljárások valamennyi begépelését"

#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "válasszon makrót"

#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Kód makró kiválasztása"

#: lazarusidestrconsts.liscurrentlclwidgetset
#, object-pascal-format
msgid "Current LCL widgetset: \"%s\""
msgstr "Jelenlegi LCL vezérlőkészlet: \"%s\""

#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Jelenlegi állapot:"

#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Beszúrási jel oszlopa az aktuális szerkesztőben"

#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Beszúrási jel sora az aktuális szerkesztőben"

#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Ezen beállítások át lesznek adva a fordítónak a makrók behelyettesítése után."

#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "egyéni beállítások"

#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Egyéni beállítások"

#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr "Egyéni beállítások"

#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Egyedi program"

#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Egyedi Free Pascal program."

#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Adat modul"

#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Töréspont kiértékelése"

#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Töréspont találat"

#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Töréspont üzenet"

#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Töréspont veremkiíratás"

#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Alapértelmezett szín"

#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Kivétel keletkezett"

#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Modul betöltése"

#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Modul eltávolítása"

#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Hibakeresési szöveg (OutputDebugString)"

#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Folyamat befejezése"

#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Folyamat indítása"

#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Szál befejezése"

#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Szál indítása"

#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Küldött Windows üzenet"

#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Windows üzenet elküldve"

#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Nincs megadva hibakereső"

#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Mindenképp állítsa be a töréspontot"

#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, object-pascal-format
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Nincs megadva hibakereső.%sA töréspontok elhelyezése hatástalan amíg nincs megadva a hibakereső a hibakereső beállításai párbeszédben a menüben."

#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Hibakeresés"

#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks
msgid "Confirm to delete all Breakpoints"
msgstr ""

#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile
msgid "Confirm to delete Breakpoints in same file"
msgstr ""

#: lazarusidestrconsts.lisdebugdialogconfirmdelhistory
msgid "Confirm to clear History"
msgstr ""

#: lazarusidestrconsts.lisdebugdialogconfirmdelwatches
msgid "Confirm to delete all Watches"
msgstr ""

#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Hibakereső"

#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, object-pascal-format, fuzzy, badformat
#| msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug."
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
msgstr "Hibakereső hiba%sHoppá, a hibakereső hibaállapotba került.%sMentse a munkáját most!%sNyomja meg az Leállítás-t, és reménykedjen a legjobbakban, most kihúzzuk a dugót."

#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Érvénytelen hibakereső"

#: lazarusidestrconsts.lisdebugging
#, object-pascal-format
msgid "%s (debugging ...)"
msgstr "%s (hibakeresés ...)"

#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "Automatikus típuskonverzió objektumok esetén"

#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Kivétel hozzáadása"

#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "További keresési útvonal"

#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
msgid "BETA: Allow function calls in watches (if supported by backend)"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr "Az assembler ablak automatikus bezárása ha a forrás nem található"

#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
msgid "Automatically set \"use instance class type\" for new watches"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmbackend
msgid "Debugger backend"
msgstr "Hibakereső háttérprogram"

#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Töréspont"

#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Napló törlése futtatáskor"

#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Hibakereső"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
msgid "Debugger Backend:"
msgstr "Hibakereső háttérprogram:"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings
msgid "Debugger dialogs"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Hibakereső általános beállításai"

#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Hibakereső-függő beállítások (a hibakereső típusától függ)"

#: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront
msgid "Always bring debug-windows (watches, locals) to front when adding items"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Ismétlődő kivételnév"

#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
msgid "Change type"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Írja be a kivétel nevét"

#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Eseménynapló"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Kezelője"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Hibakereső által kezelve"

#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Program által kezelve"

#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "E kivételek figyelmen kívül hagyása"

#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Nyelvi kivételek"

#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Sorok száma korlátozva ennyire:"

#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Modul"

#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name:"
msgstr "Név:"

#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Exceptions"
msgstr "Értesítés kivételek esetén"

#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "OS kivételek"

#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Kimenet"

#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Folyamat"

#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Hibakereső alapra állítása minden futtatás után"

#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
msgid "Show message on stop with Error (Exit-code <> 0)"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Üzenet megjelenítése leállítás esetén"

#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Jelzések"

#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Szál"

#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
#, object-pascal-format
msgid "Unknown Debugger backend \"%s\""
msgstr "Ismeretlen hibakereső háttérprogram: \"%s\""

#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Eseménynapló színeinek használata"

#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
msgid "-- Use IDE default Debugger --"
msgstr "-- Az IDE alapértelmezett hibakeresőjének használata --"

#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
msgid "-- Use project Debugger --"
msgstr ""

#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Ablakok"

#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "A fájl betöltése nem lehetséges"

#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, object-pascal-format
msgid "Unable to load file \"%s\"."
msgstr "A(z) \"%s\" fájl betöltése nem lehetséges"

#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "Alapértelmezett"

#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr "Alapértelmezett láthatósági szakasz az új metódusok számára. Például a kódkiegészítés \"OnShow:=\" esetén"

#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr "Alapértelmezés szerint egy legördülő listából választható a \"True\" vagy a \"False\" érték"

#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(alapértelmezett)"

#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr "Alapértelmezett szakasz a metódusok számára"

#: lazarusidestrconsts.lisdelayforcompletionbox
msgid "Delay for completion box"
msgstr "Kiegészítés doboz késleltetése"

#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Hosszú sor tippek késleltetése a kiegészítés dobozban"

#: lazarusidestrconsts.lisdelayforhints
msgid "Delay for hints"
msgstr "Tipp késleltetése"

#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "Törlés?"

#: lazarusidestrconsts.lisdeleteaddition
#, object-pascal-format
msgid "Delete addition \"%s\"?"
msgstr "A(z) \"%s\" kiegészítés törlése?"

#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "Min&den törlése"

#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Az összes fájlt töröli?"

#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Törli a megtévesztő fájlt?"

#: lazarusidestrconsts.lisdeletemacro
#, object-pascal-format
msgid "Delete macro \"%s\"?"
msgstr "\"%s\" makró törlése?"

#: lazarusidestrconsts.lisdeletemode
#, object-pascal-format
msgid "Delete mode \"%s\""
msgstr "Mód törlése: \"%s\""

#: lazarusidestrconsts.lisdeleteoldfile
#, object-pascal-format
msgid "Delete old file \"%s\"?"
msgstr "Törli a \"%s\" régi fájlt?"

#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Kijelölt makró törlése?"

#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr "Ezen kiegészítés törlése"

#: lazarusidestrconsts.lisdeletevalue
#, object-pascal-format
msgid "Delete value \"%s\"?"
msgstr "\"%s\" érték törlése?"

#: lazarusidestrconsts.lisdeletevalue2
#, object-pascal-format
msgid "Delete value %s"
msgstr "%s érték törlése"

#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr "Elválasztás pontosvesszővel."

#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr "Delphi kompatibilis erőforrások. Ajánlott."

#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "A \"tervezési\" csomagok komponenseket és menübejegyzéseket adnak az IDE-hez. A projektek használhatják őket, de nem lesznek beléjük építve. A fordító nem fogja megtalálni ezen csomagok unit-jait a projekt fordításakor."

#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr "Felületek ..."

#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Célkönyvtár"

#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Destruktor kód"

#: lazarusidestrconsts.lisdfileswererenamedtol
#, object-pascal-format
msgid "%d files were renamed to lowercase."
msgstr ""

#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Kis-/nagybetűre érzéketlen"

#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "1. fájl"

#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "2. fájl"

#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Üres sor hozzáadások/törlések figyelmen kívül hagyása"

#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Sorvég eltérések figyelmen kívül hagyása (pl. #13 = #13#10)"

#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Szóközök számának figyelmen kívül hagyása"

#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Szóközök figyelmen kívül hagyása (újsor karakterek nélkül)"

#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Sorvégi szóközök figyelmen kívül kihagyása"

#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Sor eleji szóközök figyelmen kívül kihagyása"

#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Csak a kijelölés"

#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Eltérés megnyitása a szerkesztőben"

#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
#, object-pascal-format
msgid "different unit %s found at new position \"%s\""
msgstr "másik %s unit található az új helyen: \"%s\""

#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Direktívák"

#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Direktívák új unit számára"

#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Könyvtárak"

#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Könyvtár:"

#: lazarusidestrconsts.lisdirectorynotfound
#, object-pascal-format
msgid "Directory \"%s\" not found."
msgstr "A(z) \"%s\" könyvtár nem található."

#: lazarusidestrconsts.lisdirectorynotfound2
#, object-pascal-format
msgid "directory %s not found"
msgstr "A(z) %s könyvtár nem található."

#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "A könyvtár, ahová az IDE a .po fájlokat írja"

#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "I18N kikapcsolása az LFM-hez"

#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr "-Xg beállítás letiltása?"

#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr "-Xg beállítás letiltása"

#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Változások eldobása"

#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Változások eldobása"

#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Változások eldobása és projekt megnyitása"

#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Változások eldobása és kilépés"

#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Változások eldobása, új projekt létrehozása"

#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Kattintson az alábbi elemek egyikére, hogy lássa a különbségeket"

#: lazarusidestrconsts.lisdiskdifferrorreadingfile
#, object-pascal-format
msgid "Error reading file: %s"
msgstr "Hiba a fájl olvasása közben: %s"

#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr "Minden lemezen történt változás figyelmen kívül hagyása"

#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr "Kijelölt fájlok újratöltése a lemezről"

#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Néhány fájl megváltozott a lemezen:"

#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
msgid "Some files have local changes. Either local or external changes will be overwritten."
msgstr ""

#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Nagy- és kisbetűk megkülönböztetése pl. A és a"

#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Minden beállítás ..."

#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Osztály módosítása ..."

#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Definíciók ..."

#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Szerkesztés ..."

#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Exportálás ..."

#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Importálás ..."

#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr "Továbbiak ..."

#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "&Megnyitás ..."

#: lazarusidestrconsts.lisdoesnotexists
#, object-pascal-format
msgid "%s does not exist: %s"
msgstr "%s nem létezik: %s"

#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "Ne változzon"

#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
#, fuzzy
#| msgid "%sDo not check if another IDE instance is already running"
msgid "Do not check if another IDE instance is already running."
msgstr "%sNe legyen ellenőrizve, hogy fut-e már másik IDE példány"

#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Ne zárja be a projektet"

#: lazarusidestrconsts.lisdonotcompiledependencies
#, fuzzy
#| msgid "do not compile dependencies"
msgid "Do not compile dependencies."
msgstr "Ne fordítsa le a függőségeket"

#: lazarusidestrconsts.lisdonotshowsplashscreen
#, fuzzy
#| msgid "Do not show splash screen"
msgid "Do not show splash screen."
msgstr "Ne mutassa az indító képet"

#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Ne mutassa ezt a párbeszédet ebben a projektben"

#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Ne mutassa újra ezt az üzenetet"

#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr "Ne legyen frissítve a projekt információs fájlja építés után. Így az építési szám csak megfelelő beállítás esetén növekszik."

#: lazarusidestrconsts.lisdonwloadonlinepackages
#, object-pascal-format
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?"
msgstr ""
"A következő csomagok nem érhetők el helyileg: %s\n"
"A telepítéshez előbb le kell tölteni őket. Letölti most?"

#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Le"

#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Visszafejlesztés"

#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Beállítások visszafejlesztése"

#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr "Letöltés"

#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "Még mindig létre kívánja hozni az új projektet?"

#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Még mindig meg kíván nyitni egy másik projektet?"

#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Még mindig ki akar lépni?"

#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Rácsvonalak rajzolása"

#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "A kijelölést fókuszálva rajzolja ki, még akkor is ha az üzenetek ablaka nincs fókuszálva. Ezt akkor érdemes használni ha a téma nehezen láthatóan jeleníti meg a fókuszálatlan kirajzolást."

#: lazarusidestrconsts.lisdropdowncount
msgid "Drop Down Count"
msgstr "Legördített elemek száma"

#: lazarusidestrconsts.lisdropdowncounthint
msgid "Used for all ComboBoxes in IDE dialogs"
msgstr ""

#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Kijelölt komponensek másolása a vágólapra"

#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Kijelölt komponensek kivágása a vágólapra"

#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Komponens mozgatása eggyel hátrább"

#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Komponens mozgatása eggyel előbbre"

#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Komponens háttérbe küldése"

#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Komponens előtérbe hozása"

#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Kijelölt komponensek beillesztése a vágólapról"

#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Szülő komponens kijelölése"

#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr "Nem-vizuális komponensek megjelenítése"

#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr "Nem-vizuális komponensek megjelenítésének be- és kikapcsolása"

#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Ismétlés"

#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Ismétlődő bejegyzés"

#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Ismétlődő fájlnév"

#: lazarusidestrconsts.lisduplicatefoundofvalue
#, object-pascal-format
msgid "Duplicate found of value \"%s\"."
msgstr "A(z) \"%s\" érték ismétlődik."

#: lazarusidestrconsts.lisduplicatemodename
#, object-pascal-format
msgid "Mode \"%s\" is already present in the list."
msgstr "A(z) \"%s\" mód már szerepel a listában."

#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Ismétlődő név"

#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, object-pascal-format
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Ismétlődő név: \"%s\" nevű komponens már létezik a(z) %s származtatott komponensben."

#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Többpéldányos .ppu fájl. Töröljön egyet vagy győződjön meg róla, hogy a keresési útvonalak sorrendje megfelelő! (Tipp: az FPC az utolsó útvonalat használja először)"

#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Ismétlődő keresési útvonal"

#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Ismétlődő forrás. Töröljön egyet vagy győződjön meg róla, hogy a keresési útvonalak sorrendje megfelelő! (Tipp: az FPC az utolsó útvonalat használja először)"

#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Ismétlődő unit"

#: lazarusidestrconsts.lisduplicateunitin
#, object-pascal-format
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr "Ismétlődő unit \"%s\" itt: \"%s\""

#: lazarusidestrconsts.lisdynpkgamounttoscrollin
msgid "Amount to scroll in"
msgstr ""

#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
msgid "Amount to scroll in (%)"
msgstr ""

#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
msgid "Amount to scroll in (Max)"
msgstr ""

#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
msgid "Auto Scroll on delete past left border"
msgstr ""

#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
msgid "Auto Scroll on type past right border"
msgstr ""

#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
msgid "Trigger on min chars (% of width)"
msgstr ""

#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
msgid "Trigger on min chars visible"
msgstr ""

#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Szerkesztés"

#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr "Kiegészítő súgó szerkesztése üzenetekhez"

#: lazarusidestrconsts.liseditbuildmodes
msgid "Edit build modes"
msgstr ""

#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Tartalmi súgó szerkesztése"

#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Súgó szerkesztése"

#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Billentyű szerkesztése"

#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Szerkesztő színei"

#: lazarusidestrconsts.liseditormacros
msgctxt "lazarusidestrconsts.liseditormacros"
msgid "Editor Macros"
msgstr "Szerkesztő makrók"

#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr "Szerkesztő eszköztára"

#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr "Szerkesztő eszköztárának beállításai"

#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr "A szerkesztő eszköztára látható"

#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Séma betöltése"

#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Jelenlegi projekt"

#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Egy érvényes eszköznek legalább címének és fájlnevének kell lennie."

#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Eszköz szerkesztése"

#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Billentyű"

#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Makrók"

#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Paraméterek:"

#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Program fájlnév:"

#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for FPC messages"
msgstr "FPC üzenetek keresése a kimenetben"

#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for \"make\" messages"
msgstr "\"make\" üzenetek keresése a kimenetben"

#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Cím és fájlnév szükséges"

#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Munkakönyvtár:"

#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr "Üzenet prioritásának növelése, hogy mindig megjelenjen (alaphelyzetben alacsony: \"Egyéb\")"

#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Mind"

#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Üres metódusok"

#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Üres metódusok találhatók:"

#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Nincs osztály"

#: lazarusidestrconsts.lisemdnoclassat
#, object-pascal-format
msgid "No class at %s(%s,%s)"
msgstr "Nincs osztály itt: %s(%s,%s)"

#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Csak a published"

#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Public"

#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"

#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Metódusok eltávolítása"

#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Keresés ezen osztályszakaszokban:"

#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
#, object-pascal-format
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Nem lehet megjeleníteni az aktuális osztály üres metódusait, mert%s%s"

#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Üres"

#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr "A közzététel célkönyvtára vagy relatív útvonal vagy üres."

#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr "Csak csomagok esetén engedélyezett."

#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
#, object-pascal-format
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ". Engedélyezze a(z) %s \"Unit használatát\" a(z) %s csomagban!"

#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "I18N engedélyezése az LFM-hez"

#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Engedélyezi a nemzetközivé tételt és fordítástámogatást"

#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Makrók engedélyezése"

#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr "Dwarf 2 (-gw) engedélyezése"

#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr "Dwarf 2 készletekkel"

#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr "Dwarf 3 (-gw3) engedélyezése"

#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr "-Xg beállítás engedélyezése?"

#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr "Engedélyezve = az Enter lenyomására a teljes azonosító, a Shift+Enter lenyomására pedig az előtag lesz lecserélve. Tiltva = az Enter lenyomására az előtag, a Shift+Enter lenyomására pedig a teljes azonosító lesz lecserélve."

#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Közrezárás $IFDEF által"

#: lazarusidestrconsts.lisencodingnumberoffilesfailed
#, object-pascal-format
msgid "Number of files failed to convert: %d"
msgstr "A sikertelenül átalakított fájlok száma: %d"

#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "A(z) \"%s\"%sfájl kódolása a lemezen: %s. Az új kódolás: %s."

#: lazarusidestrconsts.lisenternewnameformacros
#, object-pascal-format
msgid "Enter new name for Macro \"%s\""
msgstr "Új név megadása a \"%s\" makró számára"

#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Környezeti változó, neve, mint paraméter"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Érvénytelen hibakereső fájlnév"

#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, object-pascal-format
msgid "The debugger file \"%s\" is not an executable."
msgstr "A(z) \"%s\" hibakereső nem futtatható állomány."

#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
#, object-pascal-format
msgid "Test directory \"%s\" not found."
msgstr "A(z) \"%s\" teszt könyvtár nem található."

#: lazarusidestrconsts.liserrinvalidoption
#, object-pascal-format
msgid "Invalid option at position %d: \"%s\""
msgstr "Érvénytelen beállítás a(z) %d helyen: \"%s\""

#: lazarusidestrconsts.liserrnooptionallowed
#, object-pascal-format
msgid "Option at position %d does not allow an argument: %s"
msgstr "A(z) %d. beállítás nem enged meg argumentumot: %s"

#: lazarusidestrconsts.liserroptionneeded
#, object-pascal-format
msgid "Option at position %d needs an argument : %s"
msgstr "A(z) %d. beállítás argumentumot igényel: %s"

#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Hiba:"

#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Hiba a fájl létrehozása közben"

#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Hiba a fájl törlése közben"

#: lazarusidestrconsts.liserrorin
#, object-pascal-format
msgid "Error in %s"
msgstr "%s hiba"

#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Hibás a fordító fájlneve:"

#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Hiba az egyéni fordítóbeállításokban (Egyéb):"

#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Hiba az egyéni összefűzési beállításokban (Fordítás és összefűzés / Paraméterek átadása az összefűzőnek):"

#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Hiba a \"Hibakereső elérési út kiegészítése\"-ben:"

#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Hiba az \"Include fájlok\" keresési útvonalában:"

#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Hiba a \"Függvénytárak\" keresési útvonalában:"

#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Hiba az \"Objektum fájlok\" keresési útvonalában:"

#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Hiba az \"Egyéb források\" keresési útvonalában:"

#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Hiba az \"Egyéb unit fájlok\" keresési útvonalában:"

#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Hiba az \"unitok kimeneti könytára\" útvonalában:"

#: lazarusidestrconsts.liserrorinvalidbuildmode
#, object-pascal-format, fuzzy
#| msgid "Error: (lazarus) invalid build mode \"%s\""
msgid "Error: invalid build mode \"%s\""
msgstr "Hiba: (lazarus) érvénytelen építési mód: \"%s\""

#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Hiba fájl betöltés közben"

#: lazarusidestrconsts.liserrorloadingfile2
#, object-pascal-format
msgid "Error loading file \"%s\":"
msgstr "Hiba a(z) \"%s\" fájl betöltése közben:"

#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Hiba a komponens mozgatása közben"

#: lazarusidestrconsts.liserrormovingcomponent2
#, object-pascal-format
msgid "Error moving component %s:%s"
msgstr "Hiba a(z) %s komponens mozgatása közben:%s"

#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Hiba a komponens elnevezése közben"

#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Hiba a komponens megnyitása közben"

#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr "Hiba a form megnyitásakor"

#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Hiba .lfm komponens folyam elemzése közben."

#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, object-pascal-format
msgid "Error reading package list from file%s%s%s%s"
msgstr "Hiba a csomaglista fájlból történő beolvasása közben:%s%s%s%s"

#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Hiba XML olvasása közben"

#: lazarusidestrconsts.liserrorreadingxmlfile
#, object-pascal-format
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Hiba az XML fájl olvasása közben: \"%s\"%s%s"

#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Hiba a fájl átnevezése közben"

#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Hibák"

#: lazarusidestrconsts.liserrors2
#, object-pascal-format
msgid ", Errors: %s"
msgstr ", Hibák: %s"

#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr "Hiba a form mentésekor"

#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, object-pascal-format
msgid "Error setting the name of a component %s to %s"
msgstr "Hiba a(z) %s komponens nevének beállításakor erre: %s"

#: lazarusidestrconsts.liserrorwritingfile
#, object-pascal-format
msgid "Error writing file \"%s\""
msgstr "Hiba a fájl írása közben: \"%s\""

#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, object-pascal-format
msgid "Error writing package list to file%s%s%s%s"
msgstr "Hiba a csomaglista %s%s%s%s fájlba írása közben"

#: lazarusidestrconsts.liseverynthlinenumber
#, fuzzy
#| msgid "Every n-th line number"
msgid "Show every n-th line number"
msgstr "Minden n-dik sorszám"

#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Példa fájl:"

#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
#, object-pascal-format
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Példák:%sAzonosító%sTMyEnum.Enum%sUnitnév.Azonosító%s#Csomagnév.UnitNév.Azonosító"

#: lazarusidestrconsts.lisexclude
msgid "Exclude"
msgstr ""

#: lazarusidestrconsts.lisexcludedatruntime
#, object-pascal-format
msgid "%s excluded at run time"
msgstr "%s kihagyva futásidőben"

#: lazarusidestrconsts.lisexcludesforstars
msgid "Excludes for * and ** in unit and include search paths"
msgstr ""

#: lazarusidestrconsts.lisexecutableisadirectory
#, object-pascal-format
msgid "executable \"%s\" is a directory"
msgstr "a(z) \"%s\" állomány egy könyvtár"

#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
#, object-pascal-format
msgid "executable \"%s\" lacks the permission to run"
msgstr "a \"%s\" állománynak nincs futási engedélye"

#: lazarusidestrconsts.lisexecuteafter
msgid "Execute After"
msgstr ""

#: lazarusidestrconsts.lisexecutebefore
msgid "Execute Before"
msgstr ""

#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Futtatás leállítva"

#: lazarusidestrconsts.lisexecutionstoppedexitcode
#, object-pascal-format
msgid "Execution stopped with exit-code %1:d ($%2:s)"
msgstr ""

#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Kilépés"

#: lazarusidestrconsts.lisexitcode
#, object-pascal-format
msgid "Exit code %s"
msgstr "Kilépési kód: %s"

#: lazarusidestrconsts.lisexpand
msgid "Expand"
msgstr ""

#: lazarusidestrconsts.lisexpandall
#, fuzzy
#| msgid "Expand All (*)"
msgid "Expand All [Ctrl+Plus]"
msgstr "Mindet szétnyitja (*)"

#: lazarusidestrconsts.lisexpandall2
msgid "Expand All"
msgstr ""

#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Minden osztály szétnyitása"

#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Minden csomag szétnyitása"

#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Minden unit szétnyitása"

#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "A jelenleg szerkesztett fájl kiterjesztett fájlneve"

#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Exportálás"

#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr "Összes exportálása"

#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Minden elem exportálása fájlba"

#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr "Környezet beállításainak exportálása"

#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Exportálás HTML-ként"

#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr "Exportálás / Importálás"

#: lazarusidestrconsts.lisexportpackagelistxml
#, fuzzy
#| msgid "Export package list (*.xml)"
msgid "Export package list"
msgstr "Csomaglista exportálása (*.xml)"

#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr "Kijelölt exportálása"

#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr "Exportálás >>"

#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Áthelyezés"

#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Áthelyezés eljárásba"

#: lazarusidestrconsts.lisextraopts
msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them."
msgstr ""

#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Rendkívül részletes"

#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Külső eszközök"

#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Maximális eszközszám elérve"

#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
#, object-pascal-format
msgid "There is a maximum of %s tools."
msgstr "Az eszközök száma legfeljebb %s lehet."

#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
#, object-pascal-format
msgid "Failed to add %d not unique resource(s)"
msgstr "Nem sikerült hozzáadni %d egyedi erőforrást"

#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
#, object-pascal-format
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Nem sikerült létrehozni az alkalmazásköteget ehhez: %s"

#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Összecsukási állapot betöltése sikertelen"

#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "a makrók feloldása sikertelen"

#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "A fájl mentése nem sikerült."

#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr "Végzetes"

#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Fájl"

#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Fájl:"

#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Programok fájlkiterjesztése"

#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Fájlszűrő"

#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Fájlszűrők"

#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Sor hozzáadása"

#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Sor törlése"

#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Sor beszúrása"

#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Fájlmaszk"

#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Alapértelmezések beállítása"

#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "E fájlszűrők jelennek majd meg a Fájl megnyitása párbeszédben"

#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr "Fájl található"

#: lazarusidestrconsts.lisfilehaschangedsave
#, object-pascal-format
msgid "File \"%s\" has changed. Save?"
msgstr "A(z) \"%s\" fájl megváltozott. Mentés?"

#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "A fájl nem tartozik projekthez"

#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "A fájl egy könyvtár"

#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "A fájl nem futtatható"

#: lazarusidestrconsts.lisfileisvirtual
#, object-pascal-format
msgid "File \"%s\" is virtual."
msgstr "A(z) \"%s\" fájl virtuális."

#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr "Fájlnév stílusa"

#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "A fájl nem található"

#: lazarusidestrconsts.lisfilenotfound3
#, object-pascal-format
msgid "file %s not found"
msgstr "A fájl nem található: %s"

#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "A fájl nem található"

#: lazarusidestrconsts.lisfilenotfound5
#, object-pascal-format
msgid "File not found:%s%s"
msgstr "A fájl nem található:%s%s"

#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, object-pascal-format
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "A(z) \"%s\" fájl nem található.%sLétre szeretné hozni?"

#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "A fájl nem kisbetűs"

#: lazarusidestrconsts.lisfilescountconvertedtotextformat
#, object-pascal-format
msgid "%d files were converted to text format."
msgstr "%d fájl szöveg formátumúvá lett alakítva."

#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Fájl beállítások"

#: lazarusidestrconsts.lisfileshasincorrectsyntax
#, object-pascal-format
msgid "File %s has incorrect syntax."
msgstr "A(z) %s fájl szintaxisa helytelen."

#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
#, object-pascal-format
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Fájlok: %s, melyeknek van Register eljárása: %s, a csomag uses szakaszában: %s"

#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Minden megtalált fájl már a megfelelő kódolást tartalmazza ***"

#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "ASCII vagy UTF-8 kódolású fájlok"

#: lazarusidestrconsts.lisfilesisconvertedtotextformat
#, object-pascal-format
msgid "File %s was converted to text format."
msgstr "A(z) %s fájl szöveg formátumúvá lett alakítva."

#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Nem ASCII vagy UTF-8 kódolású fájlok"

#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
#, fuzzy
#| msgid "file where debug output is written to. If it is not specified, debug output is written to the console."
msgid "File where debug output is written to. Default is write to the console."
msgstr "A fájl, ahová a hibakereső kimenete mentésre kerül. Ha nincs megadva, a hibakereső kimenete a konzolra lesz kiírva."

#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Szűrő"

#: lazarusidestrconsts.lisfilter3
#, object-pascal-format
msgid "Filter: %s"
msgstr "Szűrő: %s"

#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr "Az összes adott típusú üzenet kiszűrése"

#: lazarusidestrconsts.lisfilterallmessagesoftype
#, object-pascal-format
msgid "Filter all messages of type %s"
msgstr "A következő típusú összes üzenet kiszűrése: %s"

#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "A szűrő már létezik"

#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Hibakereső üzenetek és az alábbiak kiszűrése"

#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Tippek és az alábbiak kiszűrése"

#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Tippek forráspozíció nélkül"

#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "Nincs szűrés, ne szűrje ki a zavaró üzeneteket"

#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Nem zavaró üzenetek szűrése"

#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "Megjegyzések és az alábbiak kiszűrése"

#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Szűrő készletek"

#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Az lehetséges beállítások listájának szűrése"

#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Egyéb üzenetek és az alábbiak kiszűrése"

#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Figyelmeztetések és az alábbiak kiszűrése"

#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Keresés ..."

#: lazarusidestrconsts.lisfinddeclarationof
#, object-pascal-format
msgid "Find Declaration of %s"
msgstr "Deklaráció megkeresése: %s"

#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "&Könyvtárak"

#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "Fáj&lmaszk"

#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "Alkönyvtárak belevétele"

#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Többsoros kitöltés"

#: lazarusidestrconsts.lisfindfilereplacementisnotpossible
msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:"
msgstr ""

#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
#, fuzzy
#| msgid "search all files in &project"
msgid "all files in &project"
msgstr "keresés a &projekt minden fájljában"

#: lazarusidestrconsts.lisfindfilesearchallopenfiles
#, fuzzy
#| msgid "search all &open files"
msgid "all &open files"
msgstr "keresés minden megnyit&ott fájlban"

#: lazarusidestrconsts.lisfindfilesearchinactivefile
#, fuzzy
#| msgid "search in &active file"
msgid "&active file"
msgstr "keresés az aktív fájlban"

#: lazarusidestrconsts.lisfindfilesearchindirectories
#, fuzzy
#| msgid "search in &directories"
msgid "&directories"
msgstr "keresés könyvtárakban"

#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
#, fuzzy
#| msgid "search in project &group"
msgid "project &group"
msgstr "keresés a projektcsoportban"

#: lazarusidestrconsts.lisfindfilewhere
#, fuzzy
#| msgid "Where"
msgid "Search location"
msgstr "Hely"

#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Billentyűkombináció megkeresése"

#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Hiányzó unit megkeresése"

#: lazarusidestrconsts.lisfindoption
msgid "Find option"
msgstr ""

#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "Elsőként"

#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr "Első teszt"

#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "LFM fájl javítása"

#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Fókusz tipp"

#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Átnevezés erőltetése"

#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
#, fuzzy
#| msgid "For example show at top the local variables, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr "Például: legfelül jelennek meg a helyi változók, aztán az aktuális osztály és az ősök elemei, majd az aktuális unit és a használt unit-ok elemei."

#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Form"

#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr "macOS esetén (Darwin)"

#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Formátum hiba"

#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr "Windows esetén"

#: lazarusidestrconsts.lisfoundversionexpected
#, object-pascal-format
msgid "Found version %s, expected %s"
msgstr "A talált változat: %s, a szükséges: %s"

#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr "FPC változat egyetlen számként (pl. 20701)"

#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr "FPC üzenetfájl:"

#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr "FPC üzenetek: Melléklet"

#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr "FPC erőforrások (.res)"

#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "FPC források"

#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "Az FPC túl régi"

#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "FPC változat:"

#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "FPC változat (pl. 2.2.2)"

#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "FPDoc szerkesztő"

#: lazarusidestrconsts.lisfpdocerrorwriting
#, object-pascal-format
msgid "Error writing \"%s\"%s%s"
msgstr "Hiba írás közben: \"%s\"%s%s"

#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "FPDoc szintaktikai hiba"

#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "FPDoc csomagnév:"

#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "FPDoc csomagnév. Alapértelmezett a projektfájl neve."

#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
#, object-pascal-format
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "Szintaktikai hiba a(z) \"%s\" FPDoc elemben:%s%s"

#: lazarusidestrconsts.lisfppkgcompilerproblem
msgid "there is a problem with the Free Pascal compiler executable, "
msgstr "probléma van a Free Pascal fordító futtatható állományával."

#: lazarusidestrconsts.lisfppkgconfgenproblems
msgid "Warnings have to be resolved first"
msgstr "Először a figyelmeztetéseket kell megoldani"

#: lazarusidestrconsts.lisfppkgconfiguration
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
msgstr "A beállítási fájl neve általában \"fppkg.cfg\". Ha nem megfeleő akkor előfordulhat, hogy nem sikerül feloldani a Free Pascal csomagok függőségeit. Üresen kell hagyni az alapértelmezett használatához."

#: lazarusidestrconsts.lisfppkgconfigurationfilenotfound
#, object-pascal-format
msgid "Fppkg configuration file not found:%s%s"
msgstr ""

#: lazarusidestrconsts.lisfppkgcreatefilefailed
#, object-pascal-format
msgid "Failed to generate the configuration file \"%s\": %s"
msgstr "Nem sikerült létrehozni a(z) \"%s\" beállítási fájlt: %s"

#: lazarusidestrconsts.lisfppkgfilestobewritten
msgid "Files to be written:"
msgstr "Írandó fájlok:"

#: lazarusidestrconsts.lisfppkgfixconfiguration
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
msgstr "Megpróbálhatja automatikusan helyrehozni a beállítási fájlokat vagy kézzel javítani a beállítási fájlt."

#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
msgstr "Az fpcmkcfg beállítóeszköz változatnak ellenőrzése sikertelen volt."

#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
msgstr "Nem található az fpcmkcfg beállítóeszköz, melyre szükség van a beállítási fájlok létrehozásához."

#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
msgid "An up-to-date version is needed to create the configuration files."
msgstr "Naprakész változatra van szükség a beállítási fájlok létrehozásához."

#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
msgid "It is probably too old to create the configuration files."
msgstr "Valószínűleg túl régi a beállítási fájlok létrehozásához."

#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
#, object-pascal-format
msgid "The fpcmkcfg configuration tool it too old [%s]."
msgstr "Az fpcmkcfg beállítóeszköz túl régi (%s)."

#: lazarusidestrconsts.lisfppkginstallationpath
#, object-pascal-format
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
msgstr "Az FPC telepítési útvonalára szükség van az új Fppkg beállítási fájlok létrehozásához. Ott találhatók például a(z) \"%s\" és/vagy \"%s\" unit-ok"

#: lazarusidestrconsts.lisfppkglibprefix
#, object-pascal-format
msgid "Fpc library prefix: %s"
msgstr "Fpc függvénytár előtag: %s"

#: lazarusidestrconsts.lisfppkgprefix
#, object-pascal-format
msgid "Fpc prefix: %s"
msgstr "Fpc előtag: %s"

#: lazarusidestrconsts.lisfppkgproblem
msgid "Problem with Fppkg configuration"
msgstr "Probléma van az Fppkg beállításaival"

#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
msgstr "Ellenőrizni kell, hogy a legutóbbi változat telepítve van-e és elérhető a PATH változóban megadott útvonalakon vagy a fordító könyvtárában."

#: lazarusidestrconsts.lisfppkgwriteconfexception
#, object-pascal-format
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
msgstr "Hiba az új Fppkg beállítások létrehozása közben: %s"

#: lazarusidestrconsts.lisfppkgwriteconffailed
#, object-pascal-format
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
msgstr "Nem sikerült létrehozni az Fppkg beállításait (%s). Kézzel kell javítani a beállításokat vagy újratelepíteni az Free Pascal-t."

#: lazarusidestrconsts.lisfppkgwriteconfigfile
msgid "Write new configuration files"
msgstr "Új beállítási fájlok írása"

#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Keret"

#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "Keresés visszafelé"

#: lazarusidestrconsts.lisfreeingbufferlines
#, object-pascal-format
msgid "freeing buffer lines: %s"
msgstr "felszabadított puffersorok: %s"

#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Free Pascal Compiler üzenetek"

#: lazarusidestrconsts.lisfreepascalprefix
msgid "Free Pascal compiler prefix"
msgstr "a Free Pascal fordító útvonala"

#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Free Pascal források könyvtára"

#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "Keresés előre"

#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "További fájlok a kereséshez (pl. /útvonal/*.pas;/útvonal2/*.pp)"

#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Azonosító keresése/átnevezése"

#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Hivatkozások keresése"

#: lazarusidestrconsts.lisfriidentifier
#, object-pascal-format
msgid "Identifier: %s"
msgstr "Azonosító: %s"

#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "minden megnyitott csomagban és projektben"

#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "az aktuális unit-ban"

#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "fő projektben"

#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "az aktuális unit-ot birtokló csomagban/projektben"

#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Érvénytelen azonosító"

#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Minden hivatkozás átnevezése"

#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr "Átnevezés"

#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr "Keresés"

#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Keresés a megjegyzésekben is"

#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Teljes"

#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Függvény"

#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Általános"

#: lazarusidestrconsts.lisgeneratefppkgcfg
#, object-pascal-format
msgid "Fppkg configuration: %s"
msgstr "Fppkg beállítások: %s"

#: lazarusidestrconsts.lisgeneratefppkgcompcfg
#, object-pascal-format
msgid "Fppkg compiler configuration: %s"
msgstr "Fppkg fordítói beállítások: %s"

#: lazarusidestrconsts.lisgeneratefppkgconfiguration
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
msgstr "Ez a képernyő használandó új Fppkg beállítási fájlok létrehozására az fpcmkcfg eszközzel."

#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
msgid "Generate new Fppkg configuration files"
msgstr "Új Fppkg beállítási fájlok létrehozása"

#: lazarusidestrconsts.lisgetbuildmodes
msgid "Print a list of build modes in the project. Active mode is listed first."
msgstr ""

#: lazarusidestrconsts.lisgetexpandtext
msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode."
msgstr ""

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "kifejezés lekérdezése a beszúrási jel aktuális helyénél"

#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr "Kifejezés lekérdezése a beszúrási jel aktuális helyénél."

#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr "Általános beállítások"

#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Ugrás adott sorra"

#: lazarusidestrconsts.lisgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<leírás>\n"
"\n"
"Copyright (C) <év> <szerző neve> <kapcsolat>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."

#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Csoport"

#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr "Az automatikusan létrehozott helyi változók csoportosítása"

#: lazarusidestrconsts.lisgroupsfordebugoutput
#, fuzzy
#| msgid "Enable or Disable groups of debug output. Valid Options are:"
msgid "Enable or disable groups of debug output. Valid options are:"
msgstr "Engedélyezi vagy letiltja a hibakereső kimenetének csoportjait. Érvényes beállítások:"

#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Megnövelés a legnagyobbra"

#: lazarusidestrconsts.lisgutterpartmargin
msgid "Margin"
msgstr ""

#: lazarusidestrconsts.lisgutterpartvisible
msgid "Visible"
msgstr ""

#: lazarusidestrconsts.lisgutterpartwidth
msgid "Width"
msgstr ""

#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Van súgója"

#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr "Fejlécek színei"

#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Fejléc megjegyzés az osztályhoz"

#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Súgó bejegyzések"

#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Súgó kiválasztó"

#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Súgó a Free Pascal Compiler üzeneteihez"

#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "Minden tipp és figyelmeztetés elrejtése IDE direktívák beszúrásával {%H-}"

#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "Üzenet elrejtése (itt: %s) IDE direktíva beszúrásával {%H-}"

#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "Üzenet elrejtése IDE direktíva beszúrásával {%H-}"

#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
#, object-pascal-format
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr "Üzenet elrejtése {$warn %s off} beszúrásával a(z) \"%s\" unitban "

#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Keresés elrejtése"

#: lazarusidestrconsts.lishidewindow
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Ablak elrejtése"

#: lazarusidestrconsts.lishidewithpackageoptionvm
#, object-pascal-format
msgid "Hide with package option (-vm%s)"
msgstr "Elrejtés csomagbeállítással (-vm%s)"

#: lazarusidestrconsts.lishidewithprojectoptionvm
#, object-pascal-format
msgid "Hide with project option (-vm%s)"
msgstr "Elrejtés projektbeállítással (-vm%s)"

#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "Tipp"

#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Tipp: Az alapértelmezett érték megadható a feltételes definícióknál."

#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr "A tipp az elem nevénél megjeleníti annak leírását."

#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Tipp: Ellenőrizze, hogy két csomag tartalmaz-e egyforma nevű unit-ot."

#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr "Tipp: Kattintson a \"Beállítások megjelenítése\" lehetőségre a leszármazási útvonalak felderítéséhez."

#: lazarusidestrconsts.lishints
#, object-pascal-format
msgid ", Hints: %s"
msgstr ", Tippek: %s"

#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, object-pascal-format
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Tipp: A \"ResourceString létrehozása\" művelethez egy karakterlánc konstansra van szükség.%sVálassza ki a kifejezést és próbálja újra!"

#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Form-ok megjelenítése"

#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Unit-ok megjelenítése"

#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Adatbázisok"

#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Súgó beállításai"

#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Tulajdonságok:"

#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Megjelenítők"

#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "FPC Doc HTML útvonal"

#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "Vízszintes"

#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr "Vízszintes vonal a tulajdonságok között."

#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "ID"

#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr "Kiegészítés"

#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr "Megnyitás"

#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"

#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "IDE építési beállítások"

#: lazarusidestrconsts.lisidecaptioncustomhint
msgid "Additional info to display in the IDE title"
msgstr ""

#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "Az IDE újra lesz fordítva és indítva a csomagok telepítése/eltávolítása folyamán."

#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
#, object-pascal-format
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Üdvözli a Lazarus!%0:sA megtalált IDE beállításokat korábban egy másik Lazarus telepítés használta.%0:sHa kettő vagy több különálló Lazarus példányt telepített, akkor azok nem osztozhatnak ugyanazon a beállításon. Ez ütközésekhez vezethet és használhatatlanná teheti a Lazarus telepítéseket.%0:s%0:sHa csak egy Lazarus példányt telepített és másolta vagy áthelyezte a Lazarus programot, akkor frissítheti ezen beállításokat.%0:s%1:s%0:s%0:sLehetőségek:%0:s%0:s* Információk frissítése: A beállítások használata és frissítése a Lazarus ezen példányával történő jövőbeni használathoz. A régi telepítés többé nem használja ezt..%0:s* Figyelmen kívül hagyás: Használja ezen beállításokat, de életben tartja a figyelmeztetéseket. Ez ütközésekhez vezethet az másik telepítéssel.%0:s* Megszakítás: Kilépés most. Ezután javíthatja a hibát a Lazarus megfelelő beállításokkal történő indításával.%0:s%0:sTovábbi információk:%0:sEzen beállítások: %2:s%0:sA következő Lazarus telepítéshez tartoznak: %3:s%0:sA jelenlegi IDE innen lett indítva: %4:s%0:s"

#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Információk az IDE-ről"

#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "IDE makrók"

#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr "Az IDE karbantartja az Application.Scaled (Hi-DPI) beállítást a fő unit-ban."

#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "Az IDE karbantartja a címet a fő unit-ban."

#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "azonosító"

#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Azonosító kezdete ..."

#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Azonosító tartalmazza ..."

#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "IDE beállítások:"

#: lazarusidestrconsts.lisidetitlecustom
msgid "Custom IDE title"
msgstr ""

#: lazarusidestrconsts.lisidetitleoptions
msgid "IDE main window and taskbar title"
msgstr ""

#: lazarusidestrconsts.lisidetitlestartswithprojectname
#, fuzzy
#| msgid "IDE title starts with project name"
msgid "Show custom IDE title before built-in IDE title or info"
msgstr "Az IDE címe a projekt nevével kezdődik"

#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "Minden építési mód"

#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Fordító beállításai:"

#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "Jelenlegi építési mód"

#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "Hiba az XML megnyitása közben"

#: lazarusidestrconsts.lisiecoerroropeningxmlfile
#, object-pascal-format
msgid "Error opening XML file \"%s\":%s%s"
msgstr "Hiba a(z) \"%s\" XML fájl megnyitása közben:%s%s"

#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Fordító beállításainak exportálása"

#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Az exportálandó fájl létezik"

#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, object-pascal-format
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Az exportálandó \"%s\" fájl létezik.%sMegnyitja a fájlt és kicseréli csak a fordító beállításait?%s(A többi beállítás megmarad.)"

#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Fordító beállításainak importálása"

#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Beolvasás fájlból"

#: lazarusidestrconsts.lisieconocompileroptionsinfile
#, object-pascal-format
msgid "File \"%s\" does not contain compiler options."
msgstr "A(z) \"%s\" fájl nem tartalmaz fordítóbeállításokat."

#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Mentés fájlba"

#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "Ha nincs kijelölve:"

#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr "Kérdés a mentésről ha csak a munkamenet információ változtak meg."

#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, object-pascal-format
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "Ha különböző Lazarus változatokat akar használni, a második Lazarus-t a primary-config-path vagy a pcp parancssori paraméterrel kell indítani.%sPéldául:"

#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Összes kihagyása"

#: lazarusidestrconsts.lisignoreuseasancestor
#, object-pascal-format
msgid "Ignore, use %s as ancestor"
msgstr "Kihagyás, %s használata ősként"

#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Kövesse az aktuális unit, projekt vagy csomag behúzását"

#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Kidolgozási megjegyzés az osztályhoz"

#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Importálás"

#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr "Fontos"

#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr "Környezet beállításainak importálása"

#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Importálás fájlból"

#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr "Az építési módok importálása nincs támogatva csomagok esetén."

#: lazarusidestrconsts.lisimportpackagelistxml
#, fuzzy
#| msgid "Import package list (*.xml)"
msgid "Import package list"
msgstr "Csomaglista importálása (*.xml)"

#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Nem lehetséges"

#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
#, object-pascal-format
msgid "In a source directory of the package \"%s\"."
msgstr "A(z) \"%s\" csomag forráskódjának egyik könyvtárában."

#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "A projekt forráskódjának egyik könyvtárában. Ellenőrizze a másolatokat!"

#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "include útvonal"

#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Include útvonalak"

#: lazarusidestrconsts.lisincluderecursive
msgid "Include, recursive"
msgstr ""

#: lazarusidestrconsts.lisincompatibleppu
#, object-pascal-format
msgid ", incompatible ppu=%s"
msgstr ", összeférhetetlen ppu=%s"

#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Nem megfelelő beállítási könyvtár található"

#: lazarusidestrconsts.lisincorrectfppkgconfiguration
#, object-pascal-format
msgid "there is a problem with the Fppkg configuration. (%s)"
msgstr "probléma van az Fppkg beállításaival. (%s)"

#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Behúzás pascal forráskódokhoz"

#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Információ"

#: lazarusidestrconsts.lisinformationaboutunit
#, object-pascal-format
msgid "Information about %s"
msgstr "Információk erről: %s"

#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Információk a használt FPC-ről"

#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "Az FPC unit keresési útvonalán. Valószínűleg az FPC csomaggal lett telepítve. Ellenőrizze, hogy a fordító és a ppu fájl egyazon telepítésből származik-e!"

#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Kapcsolódó elé"

#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Származtatott elem"

#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Örökölt paraméterek"

#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Örökölt projekt komponens"

#: lazarusidestrconsts.lisinitialchecks
msgid "Initial Checks"
msgstr ""

#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr "Helyi változó előkészítése"

#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, object-pascal-format
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "Azért, hogy egy tiszta másolat jöhessen létre a projektből/csomagból, a következő könyvtár minden eleme törölve lesz és annak teljes tartalma el fog veszni.%sTörli az összes fájlt a(z) \"%s\" könyvtárból?"

#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Beszúrás"

#: lazarusidestrconsts.lisinsertassignment
#, object-pascal-format
msgid "Insert Assignment %s := ..."
msgstr "Értékadás beszúrása: %s := ..."

#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "dátum beillesztése"

#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "dátum és idő beillesztése"

#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string."
msgstr "Dátum és idő beszúrása. Nem kötelező: formátum karakterlánc."

#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string."
msgstr "Dátum beillesztése. Nem kötelező: formátum karakterlánc."

#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "end beillesztése, ha szükséges"

#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart,          // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName,       // extract/add ClassName.\n"
"WithoutClassName,   // skip classname\n"
"WithoutName,        // skip function name\n"
"WithoutParamList,   // skip param list\n"
"WithVarModifiers,   // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes,  // skip colon, param types and default values\n"
"WithDefaultValues,  // extract default values\n"
"WithResultType,     // extract colon + result type\n"
"WithOfObject,       // extract 'of object'\n"
"WithCallingSpecs,   // extract cdecl; inline;\n"
"WithProcModifiers,  // extract forward; alias; external;\n"
"WithComments,       // extract comments and spaces\n"
"InUpperCase,        // turn to uppercase\n"
"CommentsToSpace,    // replace comments with a single space\n"
"                      //  (default is to skip unnecessary space,\n"
"                      //    e.g 'Do   ;' normally becomes 'Do;'\n"
"                      //    with this option you get 'Do ;')\n"
"WithoutBrackets,    // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon,   // skip semicolon at end\n"
msgstr ""
"Az aktuális eljárás fejlécének beszúrása.\n"
"\n"
"Lehetséges paraméterek (vesszővel elválasztva):\n"
"WithStart,          // eljárás kulcsszó, például 'function', 'class procedure'\n"
"WithoutClassKeyword,// 'class' kulcsszó nélkül\n"
"AddClassName,       // osztálynév hozzáfűzése\n"
"WithoutClassName,   // osztálynév nélkül\n"
"WithoutName,        // eljárásnév nélkül\n"
"WithoutParamList,   // paraméterek listája nélkül\n"
"WithVarModifiers,   // változók módosítóinak hozzáfűzése: 'var', 'out', 'const'\n"
"WithParameterNames, // paraméterek neveinek hozzáfűzése\n"
"WithoutParamTypes,  // paraméterek típusai és alapértelmezett értékek nélkül\n"
"WithDefaultValues,  // alapértelmezett értékek hozzáfűzése\n"
"WithResultType,     // vessző + visszatérési típus hozzáfűzése\n"
"WithOfObject,       // 'of object' hozzáfűzése\n"
"WithCallingSpecs,   // hívási módok hozzáfűzése: cdecl; inline;\n"
"WithProcModifiers,  // eljárás módosítók hozzáfűzése: forward; alias; external;\n"
"WithComments,       // megjegyzések és szóközök hozzáfűzése\n"
"InUpperCase,        // nagybetűssé alakítva\n"
"CommentsToSpace,    // megjegyzések cseréje egy darab szóközre\n"
"                      //  (alapértelmezés szerint a szükségtelen szóközök el lesznek hagyva,\n"
"                      //    például a  'Do   ;' normál esetben 'Do;' lesz,\n"
"                      //    de ezt használva az eredmény 'Do ;')\n"
"WithoutBrackets,    // paraméterlista zárójelei nélkül\n"
"WithoutSemicolon,   // pontosvessző elhagyása a végéről\n"

#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Makró beszúrása"

#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure."
msgstr "Aktuális eljárás nevének beszúrása."

#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "PrintShort címke beszúrása"

#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "eljárás fej beszúrása"

#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "eljárás névének beszúrása"

#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr "Pontosvessző beszúrása szükség esetén"

#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "idő beszúrása"

#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string."
msgstr "Idő beszúrása. Nem kötelező: formátum karakterlánc."

#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "URL címke beszúrása"

#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "Munkamenetben"

#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "telepítve"

#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Telepítés, nekem tetszik a duciság"

#: lazarusidestrconsts.lisinstallpackagesmsg
#, object-pascal-format
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?"
msgstr ""
"A következő csomagok nincsenek telepítve, de elérhetők a fő tárolóban: %s.\n"
"Szeretné telepíteni a hiányzó csomagokat?"

#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Kijelöltek telepítése"

#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Csomagok telepítése/eltávolítása"

#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
#, fuzzy
#| msgid "Instead of compile package create a simple Makefile."
msgid "Instead of compiling a package create a simple Makefile."
msgstr "Csomag fordítása helyett egy egyszerű Makefile létrehozása"

#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr "Elégtelen kódolás"

#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Interaktív"

#: lazarusidestrconsts.lisinternalerror
#, object-pascal-format
msgid "internal error: %s"
msgstr "belső hiba: %s"

#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Érvénytelen törlés"

#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr "Érvénytelen futtatható állomány"

#: lazarusidestrconsts.lisinvalidexecutablemessagetext
#, object-pascal-format
msgid "The file \"%s\" is not executable."
msgstr "A(z) \"%s\" fájl nem futtatható állomány."

#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, object-pascal-format
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Érvénytelen kifejezés.%sTipp: A \"ResourceString létrehozása\" művelethez egy karakterlánc konstansra van szükség egyetlen fájlban. Válassza ki a kifejezést és próbálja újra!"

#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr "Érvénytelen fájlnév"

#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Érvénytelen szűrő"

#: lazarusidestrconsts.lisinvalidlinecolumninmessage
#, object-pascal-format
msgid "Invalid line, column in message%s%s"
msgstr "Érvénytelen sor, oszlop az üzenetben: %s%s"

#: lazarusidestrconsts.lisinvalidmacrosin
#, object-pascal-format
msgid "Invalid macros in \"%s\""
msgstr "Érvényytelen makrók ebben: \"%s\""

#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
#, object-pascal-format
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Érvénytelen makrók \"%s\" a külső eszközben: \"%s\""

#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
#, object-pascal-format
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "Érvénytelen makró: \"%s\". A makró neve csak Pascal azonosító lehet."

#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
#, object-pascal-format
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Érvénytelen makrónév: \"%s\". A név egy kulcsszó."

#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Érvénytelen maszk"

#: lazarusidestrconsts.lisinvalidmode
#, object-pascal-format
msgid "Invalid mode %s"
msgstr "Érvénytelen mód: %s"

#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Érvénytelen többszörös kijelölés"

#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Érvénytelen Pascal azonosító"

#: lazarusidestrconsts.lisinvalidpascalidentifiername
#, object-pascal-format
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr "A(z) \"%s\" név nem egy érvényes Pascal azonosító.%sMindenképpen ezt használja?"

#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Érvénytelen függvény név"

#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Érvénytelen projekt fájlnév"

#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Érvénytelen közzétételi könyvtár"

#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Érvénytelen kijelölés"

#: lazarusidestrconsts.lisinvalidversionin
#, object-pascal-format
msgid "invalid version in %s"
msgstr "Érvénytelen változat a(z) %s fájlban"

#: lazarusidestrconsts.lisisalreadypartoftheproject
#, object-pascal-format
msgid "%s is already part of the Project."
msgstr "%s már része a projektnek."

#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, object-pascal-format
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "A(z) \"%s\" egy érvénytelen projekt név.%sVálasszon egy másikat! (pl. project1.lpi)"

#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
#, object-pascal-format
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s egy %sz.%sEz a körkörös függőség nem megengedett."

#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "Könyvtár nem található"

#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Kiadások"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
#, object-pascal-format
msgid "I wonder how you did that. Error in the %s:"
msgstr "Nahát, ez nagyon furcsa. Hiba itt: %s:"

#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Nahát, ez nagyon furcsa: Hiba az alapkönyvtárban:"

#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "Ugrási előzmények"

#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr "Ugrás a hibára"

#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr "Ha egy azonosító kiegészítésekor hiba kerül elő a forrásban, ugrás oda."

#: lazarusidestrconsts.lisjumptoprocedure
#, object-pascal-format
msgid "Jump to procedure %s"
msgstr "Ugrás az eljárásra: %s"

#: lazarusidestrconsts.liskb
#, object-pascal-format
msgid "%s KB"
msgstr "%s KB"

#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Megtartás"

#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Az átalakított fájlok maradjanak megnyitva a szerkesztőben"

#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "A projekt minden fájlja meg lesz nyitva a szerkesztőben az átalakítás után"

#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Név megtartása"

#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr "Maradjon nyitva"

#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
#, fuzzy
#| msgid "Keep relative indentation of multi line template"
msgid "Keep absolute indentation, regardless of the current cursor indentation in the text."
msgstr "A többsoros sablon viszonylagos behúzásának megtartása"

#: lazarusidestrconsts.liskeepsubindentation
#, fuzzy
#| msgid "Keep indentation"
msgid "Absolute indentation"
msgstr "Behúzás megtartása"

#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Megtartja és folytatás"

#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Billentyű"

#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Saját parancsok"

#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Tervező parancsai"

#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Objektum felügyelő parancsai"

#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Billentyű (vagy 2 billentyű egymás után)"

#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Építés megszakítása"

#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Cím-töréspont hozzáadása"

#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Forráskód-töréspont hozzáadása"

#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Figyelési pont hozzáadása"

#: lazarusidestrconsts.liskmaddwatch
msgctxt "lazarusidestrconsts.liskmaddwatch"
msgid "Add watch"
msgstr "Figyelő hozzáadása"

#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Építés több módban"

#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Projekt/Program építése"

#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Gyorsbillentyű séma hozzáadása"

#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Klasszikus"

#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Tisztítás és építés"

#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Projekt bezárása"

#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "CodeTools beállításszerkesztő"

#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Projekt/Program fordítása"

#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "\"Fájl építés\" beállítása"

#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Egyéni komponensek beállítása"

#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Tartalomérzékeny súgó"

#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Delphi csomag átalakítása Lazarus csomaggá"

#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Delphi projekt Lazarus projekté alakítása ..."

#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Delphi unit Lazarus unit-á alakítása ..."

#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "DFM fájl átalakítása LFM fájllá"

#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected components"
msgstr "Kijelölt komponensek másolása"

#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected components"
msgstr "Kijelölt komponensek kivágása"

#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr "Alapértelmezés macOS rendszerhez igazítva"

#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Utolsó karakter törlése"

#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "Szerkesztett fájlok különbségei"

#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Kódsablonok szerkesztése"

#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Tartalomérzékeny súgó szerkesztése"

#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Kijelölés közrezárása"

#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Kiértékelés/Módosítás"

#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Külső eszközök beállításai"

#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Bővített keresés"

#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to bookmark 0"
msgstr "Ugrás a 0. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to bookmark 1"
msgstr "Ugrás az 1. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to bookmark 2"
msgstr "Ugrás a 2. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to bookmark 3"
msgstr "Ugrás a 3. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to bookmark 4"
msgstr "Ugrás a 4. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to bookmark 5"
msgstr "Ugrás az 5. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to bookmark 6"
msgstr "Ugrás a 6. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to bookmark 7"
msgstr "Ugrás a 7. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to bookmark 8"
msgstr "Ugrás a 8. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to bookmark 9"
msgstr "Ugrás a 9. könyvjelzőhöz"

#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Forráskódszerkesztő 1. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Forráskódszerkesztő 10. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Forráskódszerkesztő 2. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Forráskódszerkesztő 3. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Forráskódszerkesztő 4. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Forráskódszerkesztő 5. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Forráskódszerkesztő 6. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Forráskódszerkesztő 7. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Forráskódszerkesztő 8. lap megnyitása"

#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Forráskódszerkesztő 9. lap megnyitása"

#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Dátum és idő beszúrása"

#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Felhasználónév beszúrása"

#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Megfigyelés"

#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Gyorsbillentyű séma"

#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus default"
msgstr "Lazarus alapértelmezés"

#: lazarusidestrconsts.liskmmacosxapple
msgid "macOS, Apple style"
msgstr "macOS, Apple stílus"

#: lazarusidestrconsts.liskmmacosxlaz
msgid "macOS, Lazarus style"
msgstr "macOS, Lazarus stílus"

#: lazarusidestrconsts.liskmnewpackage
msgid "New package"
msgstr "Új csomag"

#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Új projekt"

#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Új projekt fájlból"

#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Új unit"

#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Megjegyzés: Minden billentyű a kiválaszott séma szerint fog beállítódni"

#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Csomagfájl megnyitása"

#: lazarusidestrconsts.liskmopenrecent
msgctxt "lazarusidestrconsts.liskmopenrecent"
msgid "Open Recent"
msgstr "Legutóbbi megnyitása"

#: lazarusidestrconsts.liskmopenrecentpackage
msgid "Open recent package"
msgstr "Legutóbbi csomag megnyitása"

#: lazarusidestrconsts.liskmopenrecentproject
msgid "Open recent project"
msgstr "Legutóbbi projekt megnyitása"

#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components"
msgstr "Komponensek beillesztése"

#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Program szüneteltetése"

#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Projekt közzététele"

#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Gyors fordítás, nincs összefűzés"

#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Az aktív fájl eltávolítása a projektből"

#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Program futtatása"

#: lazarusidestrconsts.liskmsaveall
#, fuzzy
#| msgid "SaveAll"
msgctxt "lazarusidestrconsts.liskmsaveall"
msgid "Save All"
msgstr "Minden mentése"

#: lazarusidestrconsts.liskmsaveas
#, fuzzy
#| msgid "SaveAs"
msgid "Save As"
msgstr "Mentés másként"

#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Projekt mentése"

#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Projekt mentése másként"

#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Kijelölés a sor végéig"

#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Kijelölés a sor elejéig"

#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Kijelölés az oldal aljáig"

#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Kijelölés az oldal tetejéig"

#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Szó kijelölése balra"

#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Szó kijelölése jobbra"

#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Üres könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker0
msgid "Set bookmark 0"
msgstr "0. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker1
msgid "Set bookmark 1"
msgstr "1. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker2
msgid "Set bookmark 2"
msgstr "2. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker3
msgid "Set bookmark 3"
msgstr "3. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker4
msgid "Set bookmark 4"
msgstr "4. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker5
msgid "Set bookmark 5"
msgstr "5. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker6
msgid "Set bookmark 6"
msgstr "6. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker7
msgid "Set bookmark 7"
msgstr "7. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker8
msgid "Set bookmark 8"
msgstr "8. könyvjelző beállítása"

#: lazarusidestrconsts.liskmsetmarker9
msgid "Set bookmark 9"
msgstr "9. könyvjelző beállítása"

#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Program leállítása"

#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Unit és Form közötti váltás"

#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle bookmark 0"
msgstr "0. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle bookmark 1"
msgstr "1. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle bookmark 2"
msgstr "2. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle bookmark 3"
msgstr "3. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle bookmark 4"
msgstr "4. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle bookmark 5"
msgstr "5. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle bookmark 6"
msgstr "6. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle bookmark 7"
msgstr "7. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle bookmark 8"
msgstr "8. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle bookmark 9"
msgstr "9. könyvjelző ki-/bekacsolása"

#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Assembler megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Töréspontok megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Hívási verem megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Kódtallózó megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Kódböngésző megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Komponens paletta megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Hibakereső eseménynapló megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Hibakereső kimenetének megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Dokumentációszerkesztő megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Előzmények megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "IDE gyorsgombok megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Helyi változók megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewmemviewer
msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer"
msgid "View Mem viewer"
msgstr ""

#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Üzenetek megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Objektum felügyelő megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr "Konzol be- és kimenetének megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Regiszterek megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Keresési eredmények megjelnítése"

#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Forráskódszerkesztő megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Szálak megjelenítése"

#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Figyelők megjelenítése"

#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Ugrási előzmények megjelenítése"

#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Projekt beállításainak megjelenítése"

#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Projekt forráskódjának megjelenítése"

#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Unit infó megjelenítése"

#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr "Legutóbb megnyitva"

#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Alkalmazás futtatása érvénytelen"

#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Cél parancssor futtatása"

#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Lazarus alapértelmezés"

#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Lazarus könyvtára"

#: lazarusidestrconsts.lislazarusdirhint
#, object-pascal-format
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
msgstr ""

#: lazarusidestrconsts.lislazarusdiroverride
#, fuzzy
#| msgid "directory to be used as a basedirectory"
msgid "Directory to be used as a basedirectory."
msgstr "A könyvtár, mely alapkönyvtárként használandó"

#: lazarusidestrconsts.lislazaruseditorv
#, object-pascal-format
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"

#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "Lazarus IDE"

#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Lazarus nyelv azonosító (pl. en, de, br, fi)"

#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Lazarus nyelv neve (pl. english, deutsch)"

#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [beállítások] <projekt-fájlnév>"

#: lazarusidestrconsts.lislazbuild
msgid "lazbuild"
msgstr ""

#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Válasszon kimeneti könyvtárat az IDE futtatható fájljának! "

#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Biztosan törölhető ez az építési profil?"

#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Több építése"

#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Általános beállítások"

#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Megerősítés építés előtt"

#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Törlés megerősítése"

#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "Hibakereső IDE"

#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Definíciók"

#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Definíciók -d nélkül"

#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Definíciók szerkesztése"

#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Az összes profil által használható definíciók szerkesztése"

#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Hiba a fájl írása közben"

#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
#, object-pascal-format
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%sA lazbuild nem interaktív, megszakítás."

#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Építési profilok kezelése"

#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Profilok kezelése"

#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Az aktív profil neve"

#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Új profil hozzáadása"

#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "A jelenlegi építési beállítások hozzá lesznek rendelve ehhez:"

#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "Normál IDE"

#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "Optimalizált IDE"

#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Beállítások:"

#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "A fordítónak átadott beállítások"

#: lazarusidestrconsts.lislazbuildoptionssyntax
msgid "lazbuild [options] <project/package filename or package name>"
msgstr ""

#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Építési profil"

#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Profil átnevezése"

#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "A profil új neve:"

#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Újraíndítás az IDE építése után"

#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "A Lazarus automatikus újraindítása az IDE építése után (nincs hatása más részek építésekor)"

#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Építési profil kiválasztása"

#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Jóváhagyás párbeszédablak megjelenítése az Eszközök menüből történő építéskor"

#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "A parancssori beállítások és definíciók megjelenítése"

#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Cél CPU:"

#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Célkönyvtár:"

#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Cél OS:"

#: lazarusidestrconsts.lislazbuildunabletowritefile
#, object-pascal-format
msgid "Unable to write file \"%s\":%s"
msgstr "A(z) \"%s\" fájl nem írható:%s"

#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "revision.inc frissítése"

#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Revízió infó frissítése a \"Lazarus névjegye\" ablakban"

#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Tisztítás és minden építése"

#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Lazarus változat (pl. 1.2.4)"

#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "LCL vezérlőkészlet típusa"

#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Hivatkozás hozzáadása az öröklötthöz"

#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Másolás öröklöttből"

#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
#, object-pascal-format
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "A(z) %s nem tartalmaz érvényes FPDoc útvonalat.%sNem lehet létrehozni az FPDoc fájlt ehhez: %s"

#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Bejegyzések áthelyezése az öröklöttbe"

#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Nincs érvényes FPDoc útvonal"

#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, object-pascal-format
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "A(z) %s unit nem része csomagnak vagy projektnek.%sAdja hozzá a unit-ot egy csomaghoz vagy projekthez!%sAz FPDoc fájl nem hozható létre."

#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Balra"

#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Bal oldali keret-térköz. Ez az érték hozzáadódik az alap oldaltérközhöz és a vezérlő bal oldalára vonatkozik."

#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Bal oldal horgonyozása"

#: lazarusidestrconsts.lisleftgutter
#, fuzzy
msgctxt "lazarusidestrconsts.lisleftgutter"
msgid "Left"
msgstr "Bal"

#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Ez az a társvezérlő, amelyikhez a bal oldal horgonyzása történik. Hagyja üresen, hogy a szülőhöz történjen Delphi stílusban (a BorderSpacing és a ReferenceSide értéke nem számít)."

#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Bal oldalak egy vonalban"

#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Bal oldali távolságok egyenlően"

#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Kevesebb"

#: lazarusidestrconsts.lislevels
msgctxt "lazarusidestrconsts.lislevels"
msgid "Levels"
msgstr "Szintek"

#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "LFM fájl"

#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "Az LFM ismeretlen tulajdonságokat/osztályokat tartalmaz, melyek nem léteznek az LCL-ben. Ezek lecserélhetők vagy eltávolíthatók"

#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "LFM fájl érvénytelen"

#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "LFM rendben"

#: lazarusidestrconsts.lislgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<leírás>\n"
"\n"
"Copyright (C) <év> <szerző neve> <kapcsolat>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."

#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "függvénytár elérési út"

#: lazarusidestrconsts.lislibraryprogramdescriptor
#, fuzzy
#| msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under MacOS X)."
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
msgstr "Egy Free Pascal megosztott függvénytár (.dll Windows alatt, .so Linux alatt, .dylib MacOS X alatt)."

#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Hivatkozás:"

#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "linker beállítások"

#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Hivatkozási cél"

#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "minden case érték listázása"

#: lazarusidestrconsts.lisloadingfailed
#, object-pascal-format
msgid "Loading %s failed."
msgstr "Hiba %s betöltése közben."

#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Makró betöltése innen:"

#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr "&Helyi"

#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "kisbetűs karakterlánc"

#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter."
msgstr "Paraméterként megadott kisbetűs karakterlánc."

#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
msgid "Maximize compatibility of project files (LPI and LPS)"
msgstr "Projektfájlok maximális kompatibilitása (LPI és LPS)"

#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
msgstr "Ennek bejelölésekor a projekt régi (2.0 vagy korábbi) Lazarus változatokkal is megnyitható lesz."

#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
msgid "Maximize compatibility of package file (LPK)"
msgstr "Csomagfájlok maximális kompatibilitása (LPK)"

#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
msgstr "Ennek bejelölésekor a csomag régi (2.0 vagy korábbi) Lazarus változatokkal is megnyitható lesz."

#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
#, object-pascal-format
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "Az lpk eltűnt a lemezről. Helyettesítve lesz ezzel:%s"

#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "Hiányzó lpk"

#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr "Lazarus beemelhető erőforrás fájlok (.lrs)"

#: lazarusidestrconsts.lismacpreferences
msgid "Preferences..."
msgstr "Beállítások..."

#: lazarusidestrconsts.lismacro
#, object-pascal-format
msgid "Macro %s"
msgstr "Makró: %s"

#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Írjon be adatot"

#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Írja be a futtatási paramétereket"

#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "A fő unit uses szakasza tartalmazza a projekt összes unit-ját"

#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "A fő unit pascal forráskód"

#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr "Pascal feltételezése még akkor is ha nem .pas/.pp az utótag. "

#: lazarusidestrconsts.lismajorchangesdetected
msgid "Major changes detected"
msgstr ""

#: lazarusidestrconsts.lismakecurrent
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "Aktuális"

#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Futtatható fájl készítése"

#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Make nem található"

#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "ResourceString készítése"

#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Hozzáfűzés a szakaszhoz"

#: lazarusidestrconsts.lismakeresstrchooseanothername
#, object-pascal-format
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "A(z) \"%s\" ResourceString már létezik.%sVálasszon másik nevet!%sHasználja a Kihagyás-t, ha mindenképpen hozzá szeretné adni!"

#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Átalakítás beállításai"

#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Egyedi azonosító"

#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Azonosító"

#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Azonosító hossz:"

#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Azonosító előtag:"

#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Beillesztés ábécérendben"

#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Tartalomérzékeny beillesztés"

#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Érvénytelen ResourceString szakasz"

#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Válasszon egy ResourceString szakaszt a listából!"

#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "A ResourceString már létezik"

#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "ResourceString szakasz:"

#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Forrás előnézet"

#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Karakterlánc konstans a forrásban"

#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Azonos értékű karakterláncok:"

#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr "Győződjön meg róla, hogy az egyes csomagok ppu fájljai annak kimeneti könyvtárában találhatók!"

#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Forráskódszerkesztők kezelése ..."

#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr "A párhuzamos fordításhoz engedélyezett szálak száma. Alapértelmezés a 0, ami a rendszerben használt magok számát jelenti."

#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
#, object-pascal-format
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr "Párhuzamos folyamatok maximális száma, a 0 az alapértelmezést jelenti (%s)"

#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
#, object-pascal-format
msgid "%s Maybe you have to recompile the package."
msgstr "%s Talán újra kell fordítani a csomagot."

#: lazarusidestrconsts.lismb
#, object-pascal-format
msgid "%s MB"
msgstr "%s MB"

#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Építés megszakítása"

#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Az FPC adatai"

#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Töréspont hozzáadása"

#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Aktív fájl hozzáadása a csomaghoz ..."

#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Ugrási pont hozzáadása az előzményekhez"

#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Szerkesztett fájl hozzáadása a projekthez"

#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Figyelő hozzáadása ..."

#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Sorok tördelése a kijelölésben"

#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Fájl építése"

#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Lazarus építése az aktuális profillal"

#: lazarusidestrconsts.lismenubuildlazarusprof
#, object-pascal-format
msgid "Build Lazarus with Profile: %s"
msgstr "Lazarus építése a következő profillal: %s"

#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "LFM fájl ellenőrzése a szerkesztőben"

#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Könyvtár tisztítása ..."

#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Tisztítás és építés ..."

#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "Szerkesztett fájl bezárása"

#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Projekt bezárása"

#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "CodeTools beállításszerkesztő ..."

#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Kijelölés megjegyzésbe"

#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Fájlok összehasonlítása ..."

#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr "Fordítás több módban ..."

#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Kód kiegészítése"

#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr "Kód kiegészítése (párbeszéddel)"

#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Fájl építés+futtatás beállítása ..."

#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Egyéni komponensek beállítása ..."

#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Külső eszközök beállítása ..."

#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "\"Lazarus építés\" beállítása ..."

#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Tartalomérzékeny súgó"

#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Delphi csomag Lazarus csomaggá alakítása ..."

#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Delphi projekt Lazarus projektté alakítása ..."

#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Delphi unit Lazarus unittá alakítása ..."

#: lazarusidestrconsts.lismenuconvertdfmtolfm
#, fuzzy
#| msgid "Convert Binary DFM to Text LFM + Check Syntax ..."
msgid "Convert Binary DFM to LFM ..."
msgstr "Bináris DFM átalakítása szöveges LFM fájllá + szintaxis ellenőrzés ..."

#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Projekt/Csomag karakterkódolásának átalakítása ..."

#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Hibakereső ablakok"

#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Delphi átalakítása"

#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "Sz&erkesztés"

#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Kódsablonok ..."

#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Tartalomérzékeny súgó szerkesztése"

#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Csomagok telepítése/eltávolítása ..."

#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
#, object-pascal-format
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr "A hívóbillentyű (&&) megváltoztatása szükséges: \"%s\""

#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr "Új elem hozzáadása a kiválasztott elem fölött"

#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr "Új elem hozzáadása a kiválasztott elem után"

#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr "Új elem hozzáadása a kiválasztott elem előtt"

#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr "Új elem hozzáadása a kiválasztott elem alatt"

#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr "Almenü hozzáadása a kiválasztott elemhez a jobb oldalon"

#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr "Almenü hozzáadása a kiválasztott elem alatt"

#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr "Hozzáadás sablonból ..."

#: lazarusidestrconsts.lismenueditoraddiconfroms
#, object-pascal-format
msgid "Add icon from %s"
msgstr "Ikon hozzáadása innen: %s"

#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr "Képlista ikon hozzáadása"

#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr "Menüelem hozzáadása"

#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr "Új elem hozzáadása fölé"

#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr "Új elem hozzáadása utána"

#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr "Új elem hozzáadása elé"

#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr "Új elem hozzáadása alá"

#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr "OnClick eseménykezelő hozzáadása"

#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr "Elválasztó hozzáadása utána"

#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr "Elválasztó hozzáadása elé"

#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr "Almenü hozzáadása"

#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr "Almenü hozzáadása alá"

#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr "Almenü hozzáadása jobbra"

#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
#, object-pascal-format
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr "Az új menüsablon a(z) \"%s\" leírással mentve lett %s alapján, %d almenüvel"

#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr "S&zerkesztés,Egyszerű szerkesztés menü,&Visszavonás,Ctrl+Z,Új&ra,,-,,Összes ki&jelölése,Ctrl+A,&Kivágás,Ctrl+X,&Másolás,Ctrl+C,&Beillesztés,Ctrl+V,Speciális be&illesztés,,-,,&Keresés,,&Csere,,&Ugrás ...,,"

#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr "&Fájl,Egyszerű fájl menü,Ú&j,,&Megnyitás ...,,M&entés,,Me&ntés másként,,-,,N&yomtatás,,Nyomt&atás beállításai ...,,-,,&Kilépés,,"

#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr "&Súgó,Egyszerű súgó menü,Súgó &tartalom,F1,Súgó tárgy&mutató,,&Hálózati súgó,,-,,&Licenc információk,,&Frissítések keresése,,-,,&Névjegy,,"

#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr "&Ablak,Egyszerű ablak menü,Ú&j ablak,,&Csempés elrendezés,,&Lépcsőzetes elrendezés,,Összes el&rendezése,,-,,&Elrejtés,,&Megjelenítés,,"

#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr "Felirat"

#: lazarusidestrconsts.lismenueditorcaptioneditemss
#, object-pascal-format
msgid "Captioned items: %s"
msgstr "Elemek felirattal: %s"

#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr "A felirat nem lehet üres"

#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
#, object-pascal-format
msgid "Change conflicting accelerator \"%s\""
msgstr "Ütköző hívóbillentyű megváltoztatása: \"%s\""

#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr "Képlista ikon cseréje"

#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
#, object-pascal-format
msgid "Change %s for %s"
msgstr "%s cseréje itt: %s"

#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
#, object-pascal-format
msgid "Change shortcut conflict \"%s\""
msgstr "Ütköző gyorsbillentyű megváltoztatása: \"%s\""

#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
#, object-pascal-format
msgid "Change the shortCut for %s"
msgstr "Gyorsbillentyű cseréje ennél: %s"

#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
#, object-pascal-format
msgid "Change the shortCutKey2 for %s"
msgstr "Második gyorsbillentyű cseréje ennél: %s"

#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr "Törlendő sablon kiválasztása"

#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr "Beszúrandó sablon kiválasztása"

#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr "Egy nem szürke elemre kattintva szerkeszthető annak gyorsbillentyűje vagy a fejlécre kattintva az oszlop alapján rendezhető"

#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr "A komponens nem várt típusú"

#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr "A komponens névtelen"

#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr "<ütközések feloldása befejezve>"

#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
#, object-pascal-format
msgid "Conflicts found initially: %d"
msgstr "Ütközések felderítve: %d"

#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
#, object-pascal-format
msgid "Deepest nested menu level: %s"
msgstr "Legmélyebb beágyazás szintje: %s"

#: lazarusidestrconsts.lismenueditordeleteitem
msgid "&Delete item"
msgstr "Elem törlése"

#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr "Menüsablon törlése ..."

#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr "Mentett menüsablon törlése"

#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr "Kiválasztott menüsablon törlése"

#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr "Ez és alárendelt elemeinek törlése?"

#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr "Előnézet megjelenítése felugró menüként"

#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr "Felirat szerkesztése"

#: lazarusidestrconsts.lismenueditoreditingcaptionofs
#, object-pascal-format
msgid "Editing Caption of %s"
msgstr "%s feliratának szerkesztése"

#: lazarusidestrconsts.lismenueditoreditingsdots
#, object-pascal-format
msgid "To resolve conflict edit %s.%s"
msgstr "Az ütközés feloldásához szerkesztendő: %s.%s"

#: lazarusidestrconsts.lismenueditoreditingsfors
#, object-pascal-format
msgid "Editing %s for %s"
msgstr "%s szerkesztése ehhez: %s"

#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
#, object-pascal-format
msgid "Editing %s.%s - no menuitem selected"
msgstr "%s.%s szerkesztése - nincs menüelem kiválasztva"

#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr "A menü leírása:"

#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
#, object-pascal-format
msgid "Enter a new ShortCut for %s"
msgstr "Gyorsbillentyű megadása ehhez: %s"

#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
#, object-pascal-format
msgid "Enter a new ShortCutKey2 for %s"
msgstr "Második gyorsbillentyű megadása ehhez: %s"

#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr "Létező mentett sablonok"

#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr "További ütköző gyorsbillentyűk"

#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr "Segítség ezen szerkesztő használatával kapcsolatban"

#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr "Bekérés"

#: lazarusidestrconsts.lismenueditorgroupindexd
#, object-pascal-format
msgid "GroupIndex: %d"
msgstr "Csoport (GroupIndex): %d"

#: lazarusidestrconsts.lismenueditorgroupindexvaluess
#, object-pascal-format
msgid "Values in use: %s"
msgstr "Használt értékek: %s"

#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr "Elégtelen leírás"

#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
#, object-pascal-format
msgid "Insert menu template into root of %s"
msgstr "Menüsablon beszúrása a(z) %s gyökerébe"

#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr "Kiválasztott menüsablon beszúrása"

#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr "nincs hozzárendelve"

#: lazarusidestrconsts.lismenueditoritemswithicons
#, object-pascal-format
msgid "Items with icon: %s"
msgstr "Elemek ikonnal: %s"

#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
#, object-pascal-format
msgid "List shortcuts and &accelerators for %s ..."
msgstr "%s gyorsbillentyűinek és hívóbillentyűinek listája ..."

#: lazarusidestrconsts.lismenueditorlistshortcutsfors
#, object-pascal-format
msgid "List shortcuts for %s ..."
msgstr "%s gyorsbillentyűinek listája ..."

#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Menüszerkesztő"

#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr "Menüelem műveletek"

#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
#, object-pascal-format
msgid "Menuitem shortcut conflicts in %s"
msgstr "Ütköző menüelem gyorsbillentyű ebben: %s"

#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr "Elem mozgatása lefelé"

#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr "Elem mozgatása balra"

#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr "Elem mozgatása jobbra"

#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr "Elem mozgatása felfelé"

#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Kijelölt elem mozgatása lefelé"

#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr "A kiválasztott elem mozgatása balra"

#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr "A kiválasztott elem mozgatása jobbra"

#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Kjelölt elem mozgatása felfelé"

#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr "n/a"

#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr "(nincs menü kiválasztva)"

#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr "<nincs>"

#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr "<nincs>,<nincs>"

#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr "<nincsenek ütköző gyorsbillentyűk>"

#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr "Nincsenek felhasználó által megadott sablonok"

#: lazarusidestrconsts.lismenueditorpickaniconfroms
#, object-pascal-format
msgid "Pick an icon from %s"
msgstr "Ikon választása innen: %s"

#: lazarusidestrconsts.lismenueditorpopupassignmentss
#, object-pascal-format
msgid "Popup assignments: %s"
msgstr "Felugró menü hozzárendelések: %s"

#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr "Kiválasztható (RadioItem)"

#: lazarusidestrconsts.lismenueditorremainingconflictss
#, object-pascal-format
msgid "Remaining conflicts: %s"
msgstr "Megmaradt ütközések: %s"

#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr "Minden elválasztó eltávolítása"

#: lazarusidestrconsts.lismenueditorresolvedconflictss
#, object-pascal-format
msgid "Resolved conflicts: %s"
msgstr "Feloldott ütközések: %s"

#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr "Kijelölt ütközés feloldása"

#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr "Gyorsbillentyűk ütközéseinek feloldása ..."

#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr "Mentett sablonok"

#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr "Menü mentése sablonként ..."

#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr "Menü mentése sablonként"

#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr "Menü mentése sablonként jövőbeni használatra"

#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr "Menü megjelenésének mentése sablonként"

#: lazarusidestrconsts.lismenueditorsconflictswiths
#, object-pascal-format
msgid "%s conflicts with %s"
msgstr "A(z) %s ütközik a következővel: %s"

#: lazarusidestrconsts.lismenueditorseparators
msgid "Se&parators"
msgstr "Elválasztók"

#: lazarusidestrconsts.lismenueditorshortcutitemss
#, object-pascal-format
msgid "Shortcut items: %s"
msgstr "Elemek gyorsbillentyűvel: %s"

#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr "A gyorsbillentyű még nincs megváltoztatva"

#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr "Gyorsbillentyűk"

#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr "Gyorsbillentyűk"

#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr "Gyorsbillentyűk és hívóbillentyűk"

#: lazarusidestrconsts.lismenueditorshortcutsd
#, object-pascal-format
msgid "Shortcuts (%d)"
msgstr "Gyorsbillentyűk (%d)"

#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
#, object-pascal-format
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr "Gyorsbillentyűk (%d) és hívóbillentyűk (%d)"

#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr "Gyorsbillentyű,Forrás tulajdonság"

#: lazarusidestrconsts.lismenueditorshortcutsusedins
#, object-pascal-format
msgid "Shortcuts used in %s"
msgstr "Használt gyorsbillentyűk itt: %s"

#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
#, object-pascal-format
msgid "Shortcuts used in %s (%d)"
msgstr "Használt gyorsbillentyűk itt: %s (%d)"

#: lazarusidestrconsts.lismenueditorsins
#, object-pascal-format
msgid "\"%s\" in %s"
msgstr "\"%s\" itt: %s: "

#: lazarusidestrconsts.lismenueditorsisalreadyinuse
#, object-pascal-format
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut."
msgstr ""
"A(z) \"%s\" már használatban van gyorsbillentyűként ebben: %s\n"
"Másik gyorsbillentyűt kell választani."

#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
#, object-pascal-format
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr "Kibővítendő: A(z) \"%s\" nem megfelelő leírás"

#: lazarusidestrconsts.lismenueditorsshortcuts
#, object-pascal-format
msgid "%s: Shortcuts"
msgstr "%s: Gyorsbillentyűk"

#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
#, object-pascal-format
msgid "%s: Shortcuts and accelerator keys"
msgstr "%s: Gyorsbillentyűk és hívóbillentyűk"

#: lazarusidestrconsts.lismenueditorsssonclicks
#, object-pascal-format
msgid "%s.%s.%s - OnClick: %s"
msgstr "%s.%s.%s - OnClick: %s"

#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr "Alapsablonok"

#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr "A sablon leírása:"

#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr "Sablonok"

#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr "Sablon mentve"

#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available."
msgstr ""
"Nincsenek felhasználó által mentett menüsablonok.\n"
"\n"
"Csak az alapértelmezett egyszerű sablonok érhetők el."

#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
#, object-pascal-format
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr "TSCList.GetScanListCompName: a %d érvénytelen index a FScanList számára"

#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
#, object-pascal-format
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict"
msgstr ""
"Meg kell változtatni a gyorsbillentyűt: %s\n"
"az ütközés elkerüléséhez"

#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr "Meg kell adni a felírat szövegét"

#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Közrezárás $IFDEF által ..."

#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Kijelölés közrezárása ..."

#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "Kiértékelés/Módosítás ..."

#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Áthelyezés eljárásba ..."

#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Fájl"

#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Keresés"

#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "Keresés ..."

#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Kód blokk másik végének megkeresése"

#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Kód blokk elejének megkeresése"

#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Beszúrási jel lévő deklaráció keresése"

#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Azonosító hivatkozásainak megkeresése ..."

#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Keresés a fájlokban ..."

#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Következő keresése"

#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Előző keresése"

#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "A használt unit-ra hivatkozások megkeresése"

#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Beállítások ..."

#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Ugrás az Include direktívára"

#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Ugrás adott sorra ..."

#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Rosszul elhelyezett IFDEF/ENDIF keresése"

#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Lezáratlan blokk keresése"

#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Súgó"

#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "IDE belső"

#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Bővített keresés"

#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Behúzás növelése"

#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Változásnapló (ChangeLog) bejegyzés"

#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Beszúrás karaktertáblából ..."

#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "CVS kulcsszó beszúrása"

#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Jelenlegi dátum és idő"

#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Teljes fájlnév beszúrása ..."

#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Általános dolgok beszúrása"

#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "GPL megjegyzés"

#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "GPL megjegyzés (lefordítva)"

#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "LGPL megjegyzés"

#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "LGPL megjegyzés (lefordítva)"

#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "MIT megjegyzés"

#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "MIT megjegyzés (lefordítva)"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Módosított LGPL megjegyzés"

#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Módosított LGPL megjegyzés (lefordítva)"

#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Jelenlegi felhasználónév"

#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "Megf&igyelés ..."

#: lazarusidestrconsts.lismenujumpback
msgctxt "lazarusidestrconsts.lismenujumpback"
msgid "Jump Back"
msgstr "Ugrás vissza"

#: lazarusidestrconsts.lismenujumpforward
msgctxt "lazarusidestrconsts.lismenujumpforward"
msgid "Jump Forward"
msgstr "Ugrás előre"

#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Ugrás ..."

#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Ugrás a kidolgozáshoz"

#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr "Ugrás a kidolgozás uses szakaszához"

#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr "Ugrás az előkészítéshez"

#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr "Ugrás a felülethez"

#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr "Ugrás a felület uses szakaszához"

#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Ugrás a következő könyvjelzőre"

#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Ugrás a következő hibára"

#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Ugrás az előző könyvjelzőre"

#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Ugrás az előző hibára"

#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr "Ugrás az eljárás elejére"

#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr "Ugrás az eljárás fejlécére"

#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Kijelölés kisbetűssé alakítása"

#: lazarusidestrconsts.lismenumacrolistview
#, fuzzy
#| msgid "Editor Macros ..."
msgctxt "lazarusidestrconsts.lismenumacrolistview"
msgid "Editor Macros"
msgstr "Szerkesztő makrók ..."

#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "ResourceString létrehozása ..."

#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr "Beillesztés forráskóddal ..."

#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Új komponens"

#: lazarusidestrconsts.lismenunewcustom
#, object-pascal-format
msgid "New %s"
msgstr "Új %s"

#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Új form"

#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Új ..."

#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Új csomag ..."

#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Új projekt ..."

#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Új projekt fájlból ..."

#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Új unit"

#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Hálózati súgó"

#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "Megnyitás ..."

#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "Beszúrási jel lévő fájl megnyitása"

#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr "Mappa megnyitása..."

#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Betöltött csomag megnyitása ..."

#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Csomagfájl (.lpk) megnyitása ..."

#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Aktuális unit csomagfájljának megnyitása"

#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Projekt megnyitása ..."

#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Legutóbbi megnyitása"

#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Legutóbbi csomag megnyitása"

#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Legutóbbi projekt megnyitása"

#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr "Unit megnyitása ..."

#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "&Csomag"

#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Csomag fa"

#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Csomag hivatkozások ..."

#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Beillesztés a vágólapról"

#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Új csomag komponens"

#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Eljáráslista ..."

#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "&Projekt"

#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Projektfelügyelő"

#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Projekt beállításai ..."

#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "F&uttatás"

#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Projekt közzététele ..."

#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Gyors fordítás"

#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Gyors szintaxis ellenörzés"

#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Gyors szintaxis ellenőrzés rendben"

#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Eltávolítás a projektből ..."

#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Azonosító átnevezése ..."

#: lazarusidestrconsts.lismenurenamelowercase
msgid "Rename Unit Files to LowerCase ..."
msgstr ""

#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Hiba jelentése"

#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr "Form-ok újramentése i18n támogatással"

#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Az FPC forráskönyvtárak ellenőrzése"

#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Hibakereső visszaállítása"

#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Visszaállítás"

#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "F&uttatás"

#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Fájl futtatása"

#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "Futtatási paraméterek ..."

#: lazarusidestrconsts.lismenuruntocursor
#, fuzzy
#| msgid "Step over to &Cursor"
msgctxt "lazarusidestrconsts.lismenuruntocursor"
msgid "Run to Cursor"
msgstr "Átlépni a beszúrási jelig"

#: lazarusidestrconsts.lismenurunwithdebugging
msgid "Run with Debugging"
msgstr ""

#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr "Futtatás hibakeresés nélkül"

#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "Menté&s"

#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Mentés másként ..."

#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Projekt mentése"

#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Projekt mentése másként ..."

#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "&Keresés"

#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Kijelölés"

#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Összes kijelölése"

#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Kód blokk kijelölése"

#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Sor kijelölése"

#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Bekezdés kijelölése"

#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Zárójelezett rész kijelölése"

#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Szó kijelölése"

#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Üres könyvjelző beállítása"

#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "Futási pont megjelenítése"

#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr "Tartalomérzékeny súgó"

#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Kijelölés rendezése ..."

#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "F&orráskód"

#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Kis- és nagybetűk váltása a kijelölésben"

#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Tab-ok szóközzé alakítása a kijelölésben"

#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "Névjegy"

#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Kijelölés megjegyzésbe/vissza"

#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "Es&zközök"

#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Kijelölés megjegyzésből kivétele"

#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Behúzás csökkentése"

#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Kijelölés nagybetűssé alakítása"

#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Unit hozzáadása a uses szakaszhoz ..."

#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Nézet"

#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Horgonyszerkesztő"

#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Kódtallózó"

#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Kódböngésző"

#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Komponens paletta"

#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "Komponensek"

#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Eseménynapló"

#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Hibakeresési kimenet"

#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Form-ok ..."

#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "Előzmények"

#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "Ugrási előzmények"

#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Helyi változók"

#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Üzenetek"

#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Objektum felügyelő"

#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "Projekt forráskódjának megjelenítése"

#: lazarusidestrconsts.lismenuviewpseudoterminal
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr "Konzol be- és kimenete"

#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Regiszterek"

#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Korlátozás böngésző"

#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Keresési eredmények"

#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Forráskódszerkesztő"

#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Tab sorrend"

#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Szálak"

#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Form/Unit megjelenítés váltása"

#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Unit függőségek"

#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Unit információ ..."

#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Unit-ok ..."

#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Figyelt elemek"

#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Amit építeni kell"

#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "&Ablak"

#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Egyéb lapok"

#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Üzenetszerkesztő"

#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Üzenetek ablaka"

#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Metódus osztálya nem található"

#: lazarusidestrconsts.lismissingdirectory
#, object-pascal-format
msgid "missing directory \"%s\""
msgstr "hiányzó könyvtár: \"%s\""

#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Hiányzó események"

#: lazarusidestrconsts.lismissingexecutable
#, object-pascal-format
msgid "missing executable \"%s\""
msgstr "hiányzó futtatható állomány: \"%s\""

#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Hiányzó azonosítók"

#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Hiányzó csomagok"

#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "A lehetőségek:"

#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Megjegyzésbe"

#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Csak Delphi esetén"

#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Legyenek megjegyzésben a kijelölt unit-ok."

#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) A unitok csak Delphi esetén legyenek használva"

#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Unit-ok keresése. A talált útvonalak a projekt beállításai közé kerülnek."

#: lazarusidestrconsts.lismissingunitsinfo3
#, fuzzy
#| msgid "3) Abort now, install packages or fix paths and try again."
msgid "3) Leave these units in uses sections as they are."
msgstr "3) Megszakítás most, csomagok telepítése vagy útvonalak javítása és újra próbálkozás."

#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Unit útvonal keresése"

#: lazarusidestrconsts.lismissingunitsskip
#, fuzzy
#| msgid "Skip this Unit"
msgctxt "lazarusidestrconsts.lismissingunitsskip"
msgid "Skip"
msgstr "A unit kihagyása"

#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
"<leírás>\n"
"\n"
"Copyright (c) <év> <szerzői jog tulajdonosai>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."

#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Kiegészítések és felülbírálások"

#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Egyéni beállítások hozzáadása:"

#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Önkényes FPC beállítások hozzáadása, pl.  -O1 -ghtl -dFlag"

#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Alkalmazás minden csomagra."

#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Alkalmazás minden csomagra és projektre."

#: lazarusidestrconsts.lismmapplytoallpackagesmatching
#, object-pascal-format
msgid "Apply to all packages matching name \"%s\""
msgstr "Alkalmazás minden illeszkedő nevű csomagra \"%s\""

#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Alkalmazás a projektre."

#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Új beállításcsoport létrehozása"

#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Egyéni beállítás"

#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "A kiválasztott cél vagy beállítás törlése"

#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "Nem adja hozzá az egyéni beállításokat:"

#: lazarusidestrconsts.lismmdoesnothaveidemacro
#, object-pascal-format
msgid "Does not have IDE Macro %s:=%s"
msgstr "Nincs ilyen IDE makró: %s:=%s"

#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "Nem bírálja felül az OutDir (-FU) értékét"

#: lazarusidestrconsts.lismmexcludeallpackagesmatching
#, object-pascal-format
msgid "Exclude all packages matching name \"%s\""
msgstr "Minden erre illeszkedő nevű csomag kizárása: \"%s\""

#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
#, object-pascal-format
msgid "expected \":=\" after macro name but found \"%s\""
msgstr "a makrónév után \":=\" szükséges, de \"%s\" található"

#: lazarusidestrconsts.lismmexpectedmacronamebutfound
#, object-pascal-format
msgid "expected macro name but found \"%s\""
msgstr "makrónév szükséges, de \"%s\" található"

#: lazarusidestrconsts.lismmfromto
#, object-pascal-format
msgid "From %s to %s"
msgstr "Innen: %s ide: %s"

#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "IDE makró"

#: lazarusidestrconsts.lismmidemacro2
#, object-pascal-format
msgid "IDE Macro %s:=%s"
msgstr "IDE Makró %s:=%s"

#: lazarusidestrconsts.lismminvalidcharacterat
#, object-pascal-format
msgid "invalid character \"%s\" at %s"
msgstr "érvénytelen karakter \"%s\" itt: %s"

#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
#, object-pascal-format
msgid "invalid character in macro value \"%s\""
msgstr "érvénytelen karakter a makró értékében: \"%s\""

#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "hiányzó makró név"

#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Kijelölt elem mozgatása lefelé"

#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Kijelölt elem mozgatása felfelé"

#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Új cél"

#: lazarusidestrconsts.lismmoverrideoutdirfu
#, object-pascal-format
msgid "Override OutDir (-FU): %s"
msgstr "OutDir felülbírálása (-FU): %s"

#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Kimeneti könyvtár felülbírálása (-FU)"

#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "A cél kimeneti könyvtárának felülbírálása -FU"

#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Legutóbb visszavont művelet megismétlése e rácsban"

#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Egy IDE makró beállítása, pl. LCLWidgetType:=win32"

#: lazarusidestrconsts.lismmsets
#, object-pascal-format
msgid "Set \"%s\""
msgstr "\"%s\" beállítása"

#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Tárolva az IDE-ben (environmentoptions.xml)"

#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Tárolva a projektben (.lpi)"

#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Tárolva a projekt munkamenetében (.lps)"

#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Célok:"

#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Legutóbbi változtatás visszavonása e rácsban"

#: lazarusidestrconsts.lismmvalues
#, object-pascal-format
msgid "Value \"%s\""
msgstr "Érték: \"%s\""

#: lazarusidestrconsts.lismmwas
#, object-pascal-format
msgid "(was \"%s\")"
msgstr "(\"%s\" volt)"

#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr "A vezérlőkészlet megváltoztatása csak LCL projektek esetén lehetséges"

#: lazarusidestrconsts.lismode
#, object-pascal-format
msgid ", Mode: %s"
msgstr ", Mód: %s"

#: lazarusidestrconsts.lismodifiedlgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<leírás>\n"
"\n"
"Copyright (C) <év> <szerző neve> <kapcsolat>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."

#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Továbbiak"

#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Továbbiak"

#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Áthelyezés"

#: lazarusidestrconsts.lismovedown
msgid "Move Down"
msgstr "Mozgatás lefelé"

#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Fájlok áthelyezése"

#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "Fájlok áthelyezése?"

#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, object-pascal-format
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "%s fájl áthelyezése innen: %s%s ide:%s%smely a(z) %s könyvtára?"

#: lazarusidestrconsts.lismoveonepositiondown
#, object-pascal-format
msgid "Move \"%s\" one position down"
msgstr "Mozgatás \"%s\" pozícióval lejjebb"

#: lazarusidestrconsts.lismoveonepositionup
#, object-pascal-format
msgid "Move \"%s\" one position up"
msgstr "Mozgatás \"%s\" pozícióval feljebb"

#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "Fájlok áthelyezése vagy másolása?"

#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
#, object-pascal-format
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "%s fájl áthelyezése vagy másolása innen: %s%s ide:%s%smely a(z) %s könyvtára?"

#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Lap mozgatása"

#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "A kijelölt elem mozgatása lefelé (Ctrl+Le)"

#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "A kijelölt elem mozgatása felfelé (Ctrl+Fel)"

#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Mozgatás ide: "

#: lazarusidestrconsts.lismoveup
msgid "Move Up"
msgstr "Mozgatás felfelé"

#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Ezen unitok áthelyezése törést okoz a uses szakaszokban. Lásd az Üzenetek ablakát a részletekért!"

#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr "C stílus: \" => \\\""

#: lazarusidestrconsts.lismpescapequotes
msgid "Escape &quotes"
msgstr "Idézőjelek átalakítása"

#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr "Beillesztés forráskóddal"

#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr "Pascal stílus: ' => ''"

#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr "Beillesztés beállításai"

#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr "Előnézet"

#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr "Szöveg minden sor után"

#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr "Szöveg minden sor előtt"

#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr "Vágólap tartalmának rövidítése"

#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr "Üzenetek színei"

#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr "Több könyvtárat pontosvesszővel kell elválasztani"

#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ", többpéldányos csomagok: "

#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Üzenetek szöveges fájlba (*.txt) mentése"

#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Név"

#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Név ütközés"

#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Jelenlegi építési mód neve"

#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Új eljárás neve"

#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Új"

#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Új osztály"

#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Új konzolos alkalmazás"

#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
#, object-pascal-format
msgid "Create a new editor file.%sChoose a type."
msgstr "Új fájl létrehozása a szerkesztőben.%sVálasszon egy típust!"

#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Új üres szövegfájl létrehozása."

#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
#, object-pascal-format
msgid "Create a new project.%sChoose a type."
msgstr "Új projekt létrehozása.%sVálasszon egy típust!"

#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
#, object-pascal-format
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Új alapcsomag létrahozása.%sA csomag unit-ok és komponensek gyűjteménye."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Új adatmodul-t tartalmazó unit létrehozása."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Új keretet tartalmazó unit létrehozása."

#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Új LCL Form-ot tartalmazó unit létrehozása."

#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Öröklés egy projekt form-ból vagy egy komponensből"

#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Nincs elem kiválasztva"

#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Először válasszon egy elemet!"

#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Új kódolás:"

#: lazarusidestrconsts.lisnewmacroname
#, object-pascal-format
msgid "Macro %d"
msgstr "Makró %d"

#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Új makrónév"

#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr "Az új metódusok kidolgozásai az adott osztály létező metódusai közé kerülnek. Ez történhet ábécérend szerint, utolsóként vagy a deklaráció sorrendjében."

#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr "Az új metódusok és tagok beszúrása a class..end szakaszba ábécérend szerint vagy a lista végére történjen."

#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Új lap"

#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(új projekt)"

#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Újonnan rögzített makró. Nem kell menteni"

#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "Új unit-ok hozzáadása a uses szakaszhoz"

#: lazarusidestrconsts.lisnoautosaveactivedesktop
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
msgstr "'Az aktív felület automatikus mentése' lehetőség ki van kapcsolva, az aktuális felületet kézzel kell menteni."

#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Nincsenek biztonsági mentés fájlok"

#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Nincs kijelölve profil az építéshez."

#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Nincs változás"

#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Nincs kijelölt kód"

#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Nincsenek öröklött fordítóbeállítások."

#: lazarusidestrconsts.lisnofppkgprefix
msgid "empty Free Pascal compiler prefix."
msgstr "üres a Free Pascal fordító útvonala."

#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "Nincs tipp"

#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Nincs kiválaszott IDE ablak."

#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Nincs LFM fájl"

#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Nincs kiválasztva makró"

#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr "(nincs kijelölve üzenet)"

#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "névtelen"

#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "nincs, kattintson a választáshoz"

#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr "(Nincs kijelölve semmi)"

#: lazarusidestrconsts.lisnonewfilefound
msgid "No new file found"
msgstr ""

#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "nincs csomópont kiválasztva"

#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "Nincs pascal fájl"

#: lazarusidestrconsts.lisnoprogramfilesfound
#, object-pascal-format
msgid "No program file \"%s\" found."
msgstr "A(z) \"%s\" programfájl nem található."

#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "ResourceString szakasz nem található"

#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Általában a szűrő egy reguláris kifejezés. Az egyszerű szintaxisban a . egy normális karakter, a * jelentése bármi, a ? jelentése bármely karakter, a vessző és a pontosvessző pedig elválasztja az alternatívákat. Például: a *.pas, *.pp egyszerű szintaxis megfelelője ez: ^(.*\\.pas|.*\\.pp)$"

#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Karakterlánc konstans nem található"

#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "Nem tervezési csomag"

#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Nem telepítő csomag"

#: lazarusidestrconsts.lisnotavalidfppkgprefix
msgid "Free Pascal compiler not found at the given prefix."
msgstr "a Free Pascal fordító nem található a megadott útvonalon."

#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr "Megjegyzés"

#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Lent"

#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Balra"

#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Jobbra"

#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Fent"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "MEGJEGYZÉS: Nem hozható létre definíció sablon a Free Pascal forrásokhoz"

#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "MEGJEGYZÉS: Nem hozható létre definíció sablon a Lazarus forrásokhoz"

#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "nincs kiválasztva sablon"

#: lazarusidestrconsts.lisnothingtodo
msgid "Nothing to do"
msgstr ""

#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "Nincs telepítve"

#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr "Nem telepített csomagok"

#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Most ne"

#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Betöltve: "

#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Új projekt létrehozása"

#: lazarusidestrconsts.lisnumberoffilestoconvert
#, object-pascal-format
msgid "Number of files to convert: %s"
msgstr "Átalakítandó fájlok száma: %s"

#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr "Az Objektum felügyelő láthatóvá válik egy komponens kijelölésekor a tervezőben"

#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - alapértelmezett"

#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "objektum elérési út"

#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Váltás az Objektum felügyelő Kedvencek lapjára"

#: lazarusidestrconsts.lisofpackage
#, object-pascal-format
msgid " of package %s"
msgstr " a(z) %s csomagban"

#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr " a Projektfelügyelőben"

#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Hozzáadás a kedvenc tulajdonságokhoz"

#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
#, object-pascal-format
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Válasszon egy alap osztályt a(z) \"%s\" kedvenc tulajdonság számára!"

#: lazarusidestrconsts.lisoifclassnotfound
#, object-pascal-format
msgid "Class \"%s\" not found."
msgstr "A(z) \"%s\" osztály nem található"

#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Eltávolítás a kedvenc tulajdonságok közül"

#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "automatikusan telepítendő dinamikusan"

#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "automatikusan telepítendő statikusan"

#: lazarusidestrconsts.lisoipdescription
msgid "Description:  "
msgstr "Leírás:"

#: lazarusidestrconsts.lisoipdescriptiondescription
#, object-pascal-format
msgid "%sDescription:  %s"
msgstr "%sLeírás:  %s"

#: lazarusidestrconsts.lisoipfilename
#, object-pascal-format
msgid "Filename:  %s"
msgstr "Fájlnév:  %s"

#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "dinamikusan telepítve"

#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "statikusan telepítve"

#: lazarusidestrconsts.lisoiplicenselicense
#, object-pascal-format
msgid "%sLicense:  %s"
msgstr "%sLicenc: %s"

#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "hiányzó"

#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "módosított"

#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Betöltött csomag megnyitása"

#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Csomag név"

#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Válasszon egy csomagot!"

#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "csak olvasható"

#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Állapot"

#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, object-pascal-format
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%sEz a csomag telepítve van, de a .lpk fájl nem található"

#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Régi osztály"

#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "Sortöréskor (azaz Return vagy Enter billenyű)"

#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr "elérhető a fő tárolóban"

#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr "csak 32bit"

#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr "Csak Windows rendszeren érhető el. Az eszköz rejtve fut."

#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr "Csak Windows rendszeren érhető el. Az eszköz új konzolban fut."

#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr "Csak ezen reguláris kifejezéshez illeszkedő üzenetek:"

#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr "Csak ezen FPC azonosítókhoz illeszkedő üzenetek (vesszővel elválasztva):"

#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr "Csak regisztrálja a Lazarus csomagfájlokat (.lpk). Ne legyen építés."

#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Csak egész szavakra keresés"

#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "Vágólapról történő beillesztéskor"

#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Megnyitás"

#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Megnyitás XML fájlként"

#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Tervező megnyitása unit megnyitásakor"

#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr "A form betöltésre kerül a tervezőbe a forrás-unit megnyitásakor."

#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Létező fájl megnyitása"

#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Fájl megnyitása"

#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Fájl megnyitása"

#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr "Beszúrási jel lévő fájl megnyitása"

#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr "Megnyitás fájlkezelőben"

#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr "A célkönyvtár megnyitása fájlkezelőben."

#: lazarusidestrconsts.lisopenlfm
#, object-pascal-format
msgid "Open %s"
msgstr "%s Megnyitása"

#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Megnyitja a csomagot?"

#: lazarusidestrconsts.lisopenpackage2
#, object-pascal-format
msgid "Open package %s"
msgstr "%s csomag megnyitása"

#: lazarusidestrconsts.lisopenpackage3
msgid "Open Package"
msgstr ""

#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Csomagfájl megnyitása"

#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Megnyitja a projektet?"

#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Projekt megnyitása"

#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Projekt megnyitása újra"

#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Projektfájl megnyitása"

#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Fájl megnyitása normál forrásként"

#: lazarusidestrconsts.lisopenthepackage
#, object-pascal-format
msgid "Open the package %s?"
msgstr "Megnyitja a(z) %s csomagot?"

#: lazarusidestrconsts.lisopentheproject
#, object-pascal-format
msgid "Open the project %s?"
msgstr "Megnyitja a(z) %s projektet?"

#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr "Eszközbeállítások megnyitása"

#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr "Unit megnyitása"

#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr "URL megnyitása"

#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "XML megnyitása"

#: lazarusidestrconsts.lisoptions
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Beállítások"

#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr "kihagyva"

#: lazarusidestrconsts.lisos
#, object-pascal-format
msgid ", OS: %s"
msgstr ", OS: %s"

#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
#, object-pascal-format
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr "A(z) \"%s\" csomag egyéb források útvonala tartalmazza a(z) \"%s\" könyvtárat, mely már megtalálható a unit keresési útvonalak között."

#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
#, object-pascal-format
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr "a(z) %s kimeneti könyvtára Pascal unit forráskódját tartalmazza: \"%s\""

#: lazarusidestrconsts.lisoutputfilenameofproject
msgid "Output filename of project"
msgstr "A projekt kimeneti fájljának neve"

#: lazarusidestrconsts.lisoverridelanguage
#, fuzzy
#| msgid "Override language. For example --language=de. For possible values see files in the languages directory."
msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"."
msgstr "Nyelv felülbírálása. Például --language=de. A lehetséges értékekért nézze meg a languages könyvtárat."

#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr "A függvények által visszaadott karakterlánctípusok behelyettesítése az első paraméterben megadott kifejezés típusával."

#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
#, fuzzy
#| msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml"
msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml."
msgstr "%sAz alapértelmezett fordító felülbírálása. Pl. ppc386, ppcx64, ppcppc stb. Az alapértelmezett az environmentoptions.xml van tárolva"

#: lazarusidestrconsts.lisoverridetheprojectbuildmode
#, fuzzy
#| msgid "%soverride the project or IDE build mode."
msgid "Override the project or IDE build mode."
msgstr "%sA projekt vagy az IDE építési módjának felülbírálása"

#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, object-pascal-format, fuzzy, badformat
#| msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s"
msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s."
msgstr "%sA projekt cél CPU beállításának felülbírálása. Pl. i386, x86_64, powerpc, powerpc_64 stb. Alapértelmezett: %s"

#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, object-pascal-format, fuzzy, badformat
#| msgid "%soverride the project operating system. e.g. win32 linux. default: %s"
msgid "Override the project operating system. For example: win32 linux. Default: %s."
msgstr "%sA projekt cél operációs rendszerének felülbírálása.pl. win32 linux. alapértelmezett: %s"

#: lazarusidestrconsts.lisoverridetheprojectsubtarg
msgid "Override the project subtarget."
msgstr ""

#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
#, object-pascal-format, fuzzy, badformat
#| msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s"
msgid "Override the project widgetset. For example: gtk gtk2 qt win32 carbon. Default: %s."
msgstr "%sA projekt vezérlőkészletének felülbírálása. pl. gtk gtk2 qt win32 carbon. alapértelmezett: %s"

#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "Az 'Owner'-t már használja a TReader/TWritter. Válasszon másik nevet!"

#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Csomag"

#: lazarusidestrconsts.lispackage2
#, object-pascal-format
msgid "package %s"
msgstr "%s csomag"

#: lazarusidestrconsts.lispackage3
#, object-pascal-format
msgid ", package %s"
msgstr ", %s csomag"

#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Csomag infó"

#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
#, object-pascal-format
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
msgstr "A(z) \"%s\" egy tervezési csomag, ezért csak az IDE-be kell belefordítani, és ezt nem szükséges a projekt beállításaival megtenni.%sHasználja a \"Telepítés\" vagy az \"Eszközök / Lazarus építése\" lehetőséget az IDE csomagjainak építéséhez."

#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Csomagnév kezdete ..."

#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Csomagnév tartalmazza ..."

#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr "A csomag számára meg kell adni a kimeneti könyvtárat."

#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "A csomagot telepíteni kell"

#: lazarusidestrconsts.lispackageoption
#, object-pascal-format
msgid "Package \"%s\" Option"
msgstr "\"%s\" csomagbeállítás"

#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Csomagok kimeneti könyvtárai"

#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Csomagok forrásainak könyvtárai"

#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
#, object-pascal-format
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr "csomagok=%s/%s unit-ok=%s/%s azonosítók=%s/%s sorok=%s bájtok=%s"

#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "csomag unit"

#: lazarusidestrconsts.lispage
msgctxt "lazarusidestrconsts.lispage"
msgid "Page"
msgstr "Lap"

#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr "Lap neve"

#: lazarusidestrconsts.lispagenamealreadyexists
#, object-pascal-format
msgid "Page name \"%s\" already exists. Not added."
msgstr "Már létezik \"%s\" nevű lap. Nem lett hozzáadva."

#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr "Pánik"

#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", elemezve: "

#: lazarusidestrconsts.lisparser
#, object-pascal-format
msgid "parser \"%s\": %s"
msgstr "\"%s\" elemző: %s"

#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr "Elemzők:"

#: lazarusidestrconsts.lispassingquiettwotimeswillp
msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler."
msgstr ""

#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "vágólap beillesztése"

#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Beillesztés a vágólapról."

#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr "Pasztellszínek"

#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Útvonal"

#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Tallózás"

#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Érvénytelen útvonalak törlése"

#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Útvonal mozgatása lefelé"

#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Útvonal mozgatása felfelé"

#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Új útvonal hozzáadása a listához"

#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "A kiválasztott útvonal törlése"

#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "A nem létező (szürke) útvonalak eltávolítása a listából"

#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "A kiválasztott útvonal cseréje egy újra"

#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Sablon hozzáadása a listához"

#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Útvonal sablonok"

#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Keresési útvonalak:"

#: lazarusidestrconsts.lispathisnodirectory
msgid "is not a directory"
msgstr "nem egy könyvtár"

#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "az instantfpc gyorsítótár útvonala"

#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "A make eszköz útvonala"

#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "A sikertelen példány útvonala:"

#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Szünet"

#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Törölje a csomag nevének használatához"

#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "I18N kikapcsolása az lfm-ben"

#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr "Fájlok hozzáadása a fájlrendszerből"

#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Hozzáadás a projekthez?"

#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Változások elfogadása"

#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr "(hálózaton elérhető)"

#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
#, object-pascal-format
msgid "Call %sRegister%s procedure of selected unit"
msgstr "A kiválasztott unit %sRegister%s eljárásának hívása"

#: lazarusidestrconsts.lispckeditcheckavailabilityonline
msgid "Check availability online"
msgstr ""

#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Függőségek tisztítása ..."

#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Törölje a függőség alapértelmezett / előnyben részesített fájlnevét"

#: lazarusidestrconsts.lispckeditcommonoptions
msgid "Common"
msgstr "Általános"

#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Mindent lefordít?"

#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Csomag lefordítása"

#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "fpmake.pp létrehozása"

#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Makefile készítése"

#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Függőség tulajdonságai"

#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit general options"
msgstr "Általános beállítások szerkesztése"

#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Fájl tulajdonságok"

#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Telepítés"

#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Érvénytelen legnagyobb változatszám"

#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Érvénytelen legkisebb változatszám"

#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Legnagyobb változatszám:"

#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Legkisebb változatszám:"

#: lazarusidestrconsts.lispckeditmodified
#, object-pascal-format
msgid "Modified: %s"
msgstr "Módosítva: %s"

#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Függőség mozgatása lefelé"

#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Függőség mozgatása felfelé"

#: lazarusidestrconsts.lispckeditoptionsforpackage
#, object-pascal-format
msgid "Options for Package %s"
msgstr ""

#: lazarusidestrconsts.lispckeditpackage
#, object-pascal-format
msgid "Package %s"
msgstr "%s csomag"

#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, object-pascal-format
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "A(z) \"%s\" csomag megváltozott.%sElmenti a csomagot?"

#: lazarusidestrconsts.lispckeditpackagenotsaved
#, object-pascal-format
msgid "package %s not saved"
msgstr "%s csomag nincs elmentve"

#: lazarusidestrconsts.lispckeditpage
#, object-pascal-format
msgid "%s, Page: %s"
msgstr "%s, Lap: %s"

#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Függőség újra hozzáadása"

#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Fájl újra hozzáadása"

#: lazarusidestrconsts.lispckeditreadonly
#, object-pascal-format
msgid "Read Only: %s"
msgstr "Csak olvasható: %s"

#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Minden szükséges újrafordítása"

#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Újrafordítás tisztán"

#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Újrafordítja minden szükséges csomaggal együtt?"

#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Bejegyzett bővítmények"

#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Unit regisztrálása"

#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Függőség eltávolítása"

#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, object-pascal-format
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Eltávolítja a(z) \"%s\"%s függőséget a(z) \"%s\" csomagból?"

#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Eltávolított fájlok"

#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Eltávolított szükséges csomagok"

#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Fájl eltávolítása"

#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Eltávolítja a fájlt?"

#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, object-pascal-format
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Eltávolítja a(z) \"%s\"%s fájlt a(z) \"%s\" csomagból?"

#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Kijelölt elem eltávolítása"

#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Szükséges csomagok"

#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Csomag mentése"

#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Tárolja a fájl nevét a függőség alapértelmezett neveként"

#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Tárolja a fájl nevét a függőség előnyben részesített neveként"

#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "A(z) \"%s\" legnagyobb változatszám érvénytelen csomag változatszám.%s(jó példa: 1.2.3.4)"

#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "A(z) \"%s\" legkisebb változatszám érvénytelen csomag változatszám.%s(jó példa: 1.2.3.4)"

#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Eltávolítás"

#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Csomag forrásának megjelenítése"

#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "Alapvető, nem törölhető"

#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Telepítve"

#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Telepítés a következő indításkor"

#: lazarusidestrconsts.lispckexplstate
#, object-pascal-format
msgid "%sState: "
msgstr "%sÁllapot: "

#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Eltávolítás következő indításnál (kivéve ha szükséges egy telepített csomaghoz)"

#: lazarusidestrconsts.lispckexpluninstallpackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Csomag eltávolítása: %s"

#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Beállítások hozzáadása a függő csomagokhoz és projektekhez"

#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Útvonalak hozzáadása a függő csomagokhoz és projektekhez"

#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Szerző"

#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Automatikus újraépítés szükség esetén"

#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Automatikus újraépítés minden újraépítéskor"

#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Egyéni"

#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Leírás / Összefoglalás"

#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Tervezési"

#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Tervezési és futásidejű"

#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Beépülés az IDE-be"

#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Include"

#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Érvénytelen csomag típus"

#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Függvénytár"

#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Licenc"

#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Linker"

#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Fő"

#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Kézi fordítás (sosem automatikus)"

#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Al"

#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Objektum"

#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Csomag típus"

#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Szolgáltatások"

#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Kiadás"

#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Futásidejű"

#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, object-pascal-format
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "A(z) \"%s\" csomagnak van auto install kapcsolója.%sEz azt jelenti, hogy telepítve lesz az IDE-be.%sA telepítendő csomagoknak tervezési csomagoknak kell lenniük."

#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Ez a csomag ugyanazt nyújtja, mint az alábbi csomagok:"

#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Frissítés / Újraépítés"

#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Használat"

#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Csomag:"

#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Az fodoc xml fájlok keresési útvonala. Több útvonalat pontosvesszővel kell elválasztani."

#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Szükségtelen függőségek megjelenítése"

#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "Amikor a form mentésre kerül, az IDE el tudja tárolni a TTranslateString tulajdonságokat a csomag po fájljába. Ehhez engedélyezni kell az I18N-at a csomaghoz, megadni a po kimeneti könyvtárat és jelöletlenül hagyni ezt a lehetőséget."

#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Megszakítás"

#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Folyamat"

#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Könyvtár összecsukása"

#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Ütközés található"

#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Vitruális unit szerkesztése"

#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Könyvtár kibontása"

#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Fájlnév:"

#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Fájlnév betűméretének javítása"

#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Érvénytelen unit fájlnév"

#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Érvénytelen unit-név"

#: lazarusidestrconsts.lispemissingfilesofpackage
#, object-pascal-format
msgid "Missing files of package %s"
msgstr "A(z) %s csomag hiányzó fájljai"

#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Nincs új fájl a beemelhető fájlok útvonalán"

#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Nincs hiányzó fájl. Minden fájl létezik."

#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Fájlok eltávolítása"

#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Csomag visszaállítása"

#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Csomag mentése másként ..."

#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Könyvtárszerkezet megjelenítése"

#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Hiányzó fájlok megjelenítése"

#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Fájlok végleges rendezése"

#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Fájlok rendezése ábécé szerint"

#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, object-pascal-format
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "A(z) \"%s\" fájl jelenleg nem szerepel a csomag include útvonalai között.%sHozzáadja az include útvonalakhoz ezt: \"%s\"?"

#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Unit-név:"

#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Minden unit használata a könyvtárban"

#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Ne használjon unit-okat a könyvtárból"

#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Csomag függőségeinek tisztítása"

#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Kijelölés törlése"

#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Függőségek törlése"

#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, object-pascal-format
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Eldobja a(z) %s csomag minden változását és fájlból újra beolvassa?"

#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Az új unit nem a unit elérési útban van"

#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Csomag közzététele"

#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Visszaállítája a csomagot?"

#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, object-pascal-format
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "A(z) \"%s\" fájl%sjelenleg nem szerepel a csomag unit útvonalai között.%s Hozzáadja a unit útvonalakhoz ezt: \"%s\"?"

#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr "További műveletek a csomaggal"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, object-pascal-format
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sÚj függőség hozzáadása a(z) %s csomaghoz: %s csomag"

#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, object-pascal-format
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sÚj függőség hozzáadása a(z) %s projekthez: %s csomag"

#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr "Unit hozzáadása a csomag fő fájljának uses szakaszához. Ezt csak azoknál a unit-oknál kapcsolja ki, amelyeket nem kell minden esetben lefordítani."

#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Megtévesztő unit-ok találhatók"

#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Automatikusan telepített csomagok"

#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
#, object-pascal-format
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sMindkét csomag csatolva van. Ez azt jelenti, hogy mindegyik csomag használja a másikat, vagy mindkettőt használja egy harmadik."

#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Megszakadt függőség"

#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Körkörös függőség észlelve"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Törli a régi csomag fájlt?"

#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, object-pascal-format
msgid "Delete old package file \"%s\"?"
msgstr "Törli a(z) \"%s\" régi csomagfájlt?"

#: lazarusidestrconsts.lispkgmangdependencywithoutowner
#, object-pascal-format
msgid "Dependency without Owner: %s"
msgstr "Függőség tulajdonos nélkül: %s"

#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Hiba a csomag olvasása közben"

#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Hiba a csomag írása közben"

#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "A fájl már szerepel a csomagban"

#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "A fájl a projektben van"

#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "A fájlnév eltér a csomagnévtől"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "A fájlnevet egy másik csomag használja"

#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "A fájlnevet egy projekt használja"

#: lazarusidestrconsts.lispkgmangfilenotfound
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "A(z) \"%s\" fájl nem található."

#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "A fájl nincs mentve"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
#, object-pascal-format
msgid "Installing the package %s will automatically install the package:"
msgstr "A(z) %s csomag automatikusan telepíti a következő csomagot:"

#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
#, object-pascal-format
msgid "Installing the package %s will automatically install the packages:"
msgstr "A(z) %s csomag telepítése automatikusan telepíti ezeket a csomagokat:"

#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Érvénytelen fájlkiterjesztés"

#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Érvénytelen csomagfájl-kiterjesztés"

#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Érvénytelen csomag fájlnév"

#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Érvénytelen csomag név"

#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Érvénytelen csomag név"

#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, object-pascal-format
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "A(z) %s csomag betöltése eltávolítja a(z) %s%s csomagot a(z) %s fájlból.%sA régi csomag megváltozott.%sMenti a régi %s csomagot?"

#: lazarusidestrconsts.lispkgmangpackage
#, object-pascal-format
msgid "Package: %s"
msgstr "Csomag :%s"

#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Csomag ütközés"

#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "A csomag nem tervezési csomag"

#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "A csomag szükséges"

#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "A csomagnév már létezik"

#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "A csomagoknak .lpk kiterjesztésűnek kell lenniük"

#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Először fordítsa le a csomagot!"

#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Mentse a fájlt mielőtt hozzáadja egy csomaghoz!"

#: lazarusidestrconsts.lispkgmangproject
#, object-pascal-format
msgid "Project: %s"
msgstr "Projekt: %s"

#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Újraépíti a Lazarus-t?"

#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "A fájl átnevezése kisbetűsre?"

#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, object-pascal-format
msgid "Replace existing file \"%s\"?"
msgstr "Kicseréli a létező \"%s\" fájlt?"

#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Fájl cseréje"

#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Egy vagy több szükséges csomag nem található. Lásd a Csomag-fát a részletekért!"

#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
#, object-pascal-format
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name."
msgstr ""
"A(z) %s csomag már meg van nyitva az IDE-ben.\n"
"Nem lehet csomagot menteni ugyanezzel a névvel."

#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Menti a csomagot?"

#: lazarusidestrconsts.lispkgmangsavepackagelpk
#, object-pascal-format
msgid "Save Package %s (*.lpk)"
msgstr "A(z) %s csomag mentése (*.lpk)"

#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, object-pascal-format
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "A fájlnév átnevezhető kisbetűsre a következőképpen:%s\"%s\"?"

#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "E csomag átugrása"

#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "A(z) \"%s\"%s fájl már benne van a(z) %s csomagban."

#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus package."
msgstr "A(z) \"%s\" fájl nem Lazarus csomag."

#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, object-pascal-format
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "A(z) \"%s\" fájlnév nem egyezik meg a(z) \"%s\" csomagnévvel a fájlban.%sMegváltoztatja a csomagnevet erre: \"%s\"?"

#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, object-pascal-format
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "A(z) \"%s\" fájl része a jelenlegi projektnek.%sA projektek és a csomagok nem oszthatnak meg fájlokat egymás között."

#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, object-pascal-format
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "A(z) \"%s\" fájlnevet%sa(z) \"%s\" csomag használja%sa(z) \"%s\" fájlban."

#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "A következő csomag betöltése sikertelen:"

#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "A következő csomagok betöltése sikertelen:"

#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, object-pascal-format
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sA következő unit-ok hozzá lesznek adva a(z) %s%s uses szakaszához:%s%s"

#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, object-pascal-format
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "A(z) \"%s\" csomag fájlnév%sa(z) \"%s\" fájlban érvénytelen Lazarus csomagnév."

#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, object-pascal-format
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "A(z) %s csomag csak futásidejű.%sCsak futásidejű csomagok nem telepíthetők az IDE-be."

#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, object-pascal-format
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "A(z) \"%s\" csomag fordítása automatikus és a kimeneti könyvtára már szerepel a fordító alapértelmezett unit keresési útvonalai között: \"%s\". A csomag más csomagokat használ, melyek szintén használják a fordító alapértelmezett unit keresési útvonalát. Ez végtelen ciklust eredményez.%sJavítható az útvonal eltávolításával a fordító beállításai közül (pl. fpc.cfg)%svagy a csomag automatikus frissítésének kikapcsolásával vagy függőségek törlésével."

#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, object-pascal-format
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "A(z) \"%s\" csomag telepítésre van jelölve, de nem található.%sEltávolítja a függőséget a csomagok telepítési listájából?"

#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, object-pascal-format
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "A(z) %s csomag függősége a(z) %s csomagnak, ami meg van jelölve telepítéshez.%sLásd a Csomag-fát!"

#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, object-pascal-format
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "A(z) \"%s\" csomagnév érvénytelen.%sVálasszon egy másik nevet! (pl. csomag1.lpk)"

#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, object-pascal-format
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "A(z) \"%s\" csomagnév%sa(z) \"%s\" fájlban érvénytelen."

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "A(z) \"%s\" csomag meg lett jelölve.%sJelenleg csak statikusan csatolt csomagokat támogat a Lazarus. A valódi eltávolításhoz újra kell építeni és újra kell indítani a Lazarus-t.%sÚjra szeretné fordítani a Lazarus-t most?"

#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "A(z) \"%s\" csomag meg lett jelölve telepítésre.%sJelenleg csak statikusan csatolt csomagokat támogat a Lazarus. A valódi telepítéshez újra kell építeni és újra kell indítani a Lazarus-t.%sÚjra szeretné fordítani a Lazarus-t most?"

#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, object-pascal-format
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "A projekthez szükséges a(z)\"%s\" csomag.%sDe ez nem található. Ellenőrizze a Projekt -> Projektfelügyelőben."

#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, object-pascal-format
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Van két azonos nevű unit:%s1. \"%s\" innen: %s%s2. \"%s\" innen: %s"

#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "A csomagok között körkörös függés áll fenn. Lásd a Csomag-fát!"

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, object-pascal-format
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Létezik egy FPC unit ugyanazzal a névvel, mint a következő csomag:%s\"%s\""

#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, object-pascal-format
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Van egy FPC unit ugyanolyan névvel, mint ez:%s\"%s\" innen %s"

#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, object-pascal-format
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Már létezik egy csomag ezzel a névvel: \"%s\".%sÜtköző csomag: \"%s\"%sFájl: \"%s\""

#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, object-pascal-format
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Már be van töltve egy \"%s\" nevű csomag%se fájlból: \"%s\".%sLásd: Csomag -> Csomag fa.%sA csere nem lehetséges."

#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Van egy nem mentett csomag a szükséges csomagok között. Lásd a Csomag-fát!"

#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, object-pascal-format
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Van egy unit ugyanazzal a névvel, mint egy csomag:%s1. \"%s\" innen: %s%s2. \"%s\""

#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Ez egy virtuális csomag. Még nincs forrása. Először mentse a csomagot!"

#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, object-pascal-format
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Ezen Lazarus célkönyvtár létrehozása nem lehetséges:%s\"%s\".%sEz a könyvtár szükséges az új, megváltozott Lazarus IDE-hez, amely már tartalmazza az egyéni csomagjait."

#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, object-pascal-format
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "A(z) \"%s\" csomag írása%sa(z) \"%s\" fájlba nem lehetséges.%sHiba: %s"

#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Eltávolítja a csomagot?"

#: lazarusidestrconsts.lispkgmanguninstallpackage2
#, object-pascal-format
msgid "Uninstall package %s?"
msgstr "Eltávolítja a(z) %s csomagot?"

#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Nem mentett csomag"

#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Unit használata"

#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, object-pascal-format
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Figyelmeztetés: A(z) \"%s\"%sfájl a jelenlegi projekthez tartozik."

#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "megtartás"

#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "új"

#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "eltávolítás"

#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Válasszon egy csomagot"

#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr "A következő függőségekre nincs szükség, a csomagfüggőségek automatikus átvitele miatt."

#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, object-pascal-format
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "A projekt felülbírálja a következő csomagok kimeneti könyvtárát.%sLásd:  Projekt / Projekt beállításai (fordító beállításai szakasz) / Kiegészítések és felülbírálások%s%s"

#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Ez a fájl nincs benne egyik betöltött csomagban sem."

#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
#, object-pascal-format
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "A(z) \"%s\" csomagfájl nem olvasható.%sHiba: %s"

#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Indítás"

#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Globális"

#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr "Hálózaton"

#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr "A hálózati csomagok nem törölhetők"

#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Csomag hivatkozások"

#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr "Globális hivatkozások itt: "

#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr "Hálózati hivatkozások megjelenítése"

#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr "Felhasználói hivatkozások itt: "

#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr "Néhány csomag nem törölhető"

#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Felhasználói"

#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr "Javítsa a hibát ami az üzenetablakban látható, ez alapértelmezetten a forráskódszerkesztő alatt található!"

#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Nyisson meg egy unit-ot futtatás előtt!"

#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Jelöljön ki kódot, amit új eljárásba/metódusba helyezhet!"

#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Minden>"

#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Betűtípus megváltoztatása"

#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Metódus nevének másolása a vágólapra"

#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Szűrés: egyezés a metódus nevének bármely részén"

#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Szűrés: egyezés a metódus nevének elején"

#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Ugrás a kijelölthöz"

#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Semmi>"

#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Objektumok"

#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Eljáráslista"

#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Típus"

#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Válasszon .po fájl könyvtárat!"

#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Ne mentsen semmilyen információt a munkamenetről"

#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr "Mentés .lps fájlba az IDE beállításainak könyvtárában"

#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Mentés .lpi fájlba"

#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Mentés .lps fájlba, a projekt könyvtárba"

#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Munkamenet információk mentése ide:"

#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr "Az .lpi a projekt fő információs fájlja, az .lps egy különálló fájl csak a munkamenet adatai számára."

#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr "Elhelyezés"

#: lazarusidestrconsts.lispositionoutsideofsource
#, object-pascal-format
msgid "%s (position outside of source)"
msgstr "%s (a pozíció a forráson kívül van)"

#: lazarusidestrconsts.lisppuinwrongdirectory
#, object-pascal-format
msgid "ppu in wrong directory=%s."
msgstr "ppu egy nem megfelelő könyvtárban: \"%s\""

#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
#, object-pascal-format
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr "A(z) %s.ppu nem található. Ellenőrizze az fpc.cfg fájlt!"

#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Megelőző szó"

#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
#, object-pascal-format, fuzzy, badformat
#| msgid "primary config directory where Lazarus stores its config files. Default is "
msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"."
msgstr "Elsődleges beállítások könyvtára, ahol a Lazarus a beállítási fájlokat tárolja. Alapértelmezett:"

#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Elsődleges beállítások útvonala"

#: lazarusidestrconsts.lisprior
#, object-pascal-format
msgid "prior %s"
msgstr "%s előtti"

#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Prioritás"

#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Private"

#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "\"Private\" metódus"

#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, object-pascal-format
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Valószínűleg telepíteni kell néhány csomagot a folytatás előtt.%sFigyelmeztetés:%sA projekt a következő tervezési csomagokat használja, melyek szükségesek lehetnek a form tervezőben történő megnyitásához. Ha folytatja, hiányzó komponensekre figyelmeztető hibaüzeneteket kaphat és a form betöltésének végeredménye nem lesz kellemes.%sAjánlott félbehagyni a műveletet és először telepíteni ezen csomagokat."

#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Eljárás"

#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Eljárás felület deklarációval"

#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Program"

#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Program található"

#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Egy parancssoros Free Pascal program néhány hasznos beállítással kiegészítve."

#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "A program forrásnak pascal kiterjesztésűnek kell lennie, úgy mint .pas, .pp vagy .lpr"

#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "A függőség már létezik"

#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Megnyitott fájl hozzáadása"

#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Érvénytelen legkisebb-legnagyobb változat"

#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Érvénytelen változat"

#: lazarusidestrconsts.lisprojaddlocalpkg
#, object-pascal-format
msgid "Local (%s)"
msgstr "Helyi (%s)"

#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Legnagyobb változat (nem kötelező):"

#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Legkisebb változat (nem kötelező):"

#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr "Új FPMake követelmény"

#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Új követelmény"

#: lazarusidestrconsts.lisprojaddonlinepkg
#, object-pascal-format
msgid "Online (%s)"
msgstr "Hálózati (%s)"

#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Csomagnév:"

#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Csomag nem található"

#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr "Csomag típusa:"

#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, object-pascal-format
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "A(z) \"%s\" függőség nem található.%sVálasszon egy létező csomagot!"

#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "A(z) \"%s\" legnagyobb változatszám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "A legnagyobb változatszám kisebb, mint a legkisebb változatszám."

#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "A(z) \"%s\" legkisebb változatszám érvénytelen.%sHasználja a fő.al.kiadás.építés formátumot!%sPéldául: 1.0.20.10"

#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, object-pascal-format
msgid "The project has already a dependency for the package \"%s\"."
msgstr "A projektnek már függősége a(z) \"%s\" csomag."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "A(z) \"%s\" unit-név már létezik a projektben%sa(z) \"%s\" fájllal."

#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "A(z) \"%s\" unit-név már létezik a kijelölésben%sa(z) \"%s\" fájllal."

#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "A unit-név már létezik"

#: lazarusidestrconsts.lisproject
#, object-pascal-format
msgid "Project %s"
msgstr "Projekt: %s"

#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Projekt:"

#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "projekt"

#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "A projekt megváltozott"

#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "A projekt megváltozott a lemezen"

#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Projekt könyvtár"

#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Projektfájl neve"

#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Projekt beemelhető fájljainak útvonala"

#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Projekt információs fájl törölve"

#: lazarusidestrconsts.lisprojectinspectorshowprops
msgid "Show properties pane in Project Inspector"
msgstr ""

#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "A projekt futtatható"

#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr "Futtatható bináris állomány létrehozása."

#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Projekt"

#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Projekt-makró tulajdonságok"

#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr "Projekt névterei"

#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Projekt beállítás"

#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Projekt kimeneti könyvtára (pl. a .ppu könyvtár)"

#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Projekt kimeneti könyvtára"

#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "A könyvtár, ahol a projekt fő fájljának lenni kell"

#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Projekt munkamenet"

#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "A projekt munkamenet megváltozott"

#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Projekt forráskönyvtárai"

#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
#, object-pascal-format
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s a következő címen: %1:x"

#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
#, object-pascal-format
msgid "Project %s raised exception class '%s'."
msgstr "A(z) %s projekt '%s' osztályú kivételt okozott."

#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
#, object-pascal-format
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "A(z) %s projekt '%s' osztályú kivételt okozott a következő üzenettel:%s%s"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s a(z) '%1:s' fájlban, a következő címen: %2:x"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s a(z) '%1:s' fájlban, a következő sorban: %2:d"

#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:s a(z) '%1:s' fájlban, a következő sorban: %2:d:%0:s%3:s"

#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Projekt forrás útvonala"

#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "projekt unit"

#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Projekt unit elérési útja"

#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Projekt varázsló"

#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Függőség törlésének megerősítése"

#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Fájl eltávolításának megerősítése"

#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, object-pascal-format
msgid "Delete dependency for %s?"
msgstr "Törli a függőséget: %s?"

#: lazarusidestrconsts.lisprojinspprojectinspector
#, object-pascal-format
msgid "Project Inspector - %s"
msgstr "Projektfelügyelő - %s"

#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Eltávolított szükséges csomagok"

#: lazarusidestrconsts.lisprojinspremovefilefromproject
#, object-pascal-format
msgid "Remove file %s from project?"
msgstr "Eltávolítja a projektből ezt: %s?"

#: lazarusidestrconsts.lisprojinspremoveitemsf
#, object-pascal-format
msgid "Remove %s items from project?"
msgstr "%s elem eltávolítása a projektből?"

#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Építés mindig (még ha nem is történt változás)"

#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr "Szükséges lehet ha hiba van a függőségek ellenőrzésekor, jó esetben nem szükséges."

#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Hiba"

#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
#, object-pascal-format
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Az automatikusan létrehozandó form-ok listájának megváltoztatása nem lehetséges a program forrásában.%sElőször javítsa a hibákat!"

#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Érték bekérése"

#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Tulajdonságok (csere vagy eltávolítás)"

#: lazarusidestrconsts.lisproperty
#, object-pascal-format
msgid "%s property"
msgstr "%s tulajdonság"

#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protected"

#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "\"Protected\" metódus"

#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "\"Public\" metódus"

#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "\"Published\" metódus"

#: lazarusidestrconsts.lispublishedto
#, object-pascal-format
msgid "Published to %s"
msgstr "Közzétéve itt: %s"

#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr "A projekthez/csomaghoz tartozó fájlok automatikusan beemelésre kerülnek."

#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Projekt könyvtár közzététele"

#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Projekt közzététele"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr ".lrs fájlok mentése a kimenti könyvtárba"

#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr "Az erőforrás elérhető lesz az FPC számára."

#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "A pascal unit-oknak .pp vagy .pas kiterjesztésűeknek kell lenniük"

#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Virtuális unit szerkesztése"

#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Már létezik egy unit ezzel a névvel.%sFájl: %s"

#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "A unit neve nem érvényes pascal azonosító"

#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "A unit-név és a fájlnév nem egyezik.%sHelyes példa: unit1.pas és Unit1"

#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "&Delphi projekt átalakítása"

#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "Új projekt"

#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "Projekt megnyitása"

#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Legutóbbi projekt megnyitása"

#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Példa projektek megjelenítése"

#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
msgid "Quick check Fppkg configuration at start"
msgstr ""

#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "QuickFix hiba"

#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Gyors javítás"

#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Azonosító keresése"

#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Kilépés"

#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "Kilépés a Lazarus-ból"

#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Valóban törölhető?"

#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Legutóbbi lapok"

#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Rögzítés"

#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Rögzítve"

#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Újra"

#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Reguláris kifejezés"

#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Relatív"

#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Eltávolítás"

#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Eltávolítás?"

#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Minden érvénytelen tulajdonság eltávolítása"

#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Minden üzenettípus-szűrő eltávolítása"

#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Minden unit eltávolítása"

#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Az üzenetelrejtő fordítóbeállítás eltávolítása"

#: lazarusidestrconsts.lisremovedependenciesfrompackage
#, object-pascal-format
msgid "Remove %s dependencies from package \"%s\"?"
msgstr "%s függőség eltávolítása a(z) \"%s\" csomagból?"

#: lazarusidestrconsts.lisremovedpropertys
#, object-pascal-format
msgid "Removed property \"%s\"."
msgstr "Tulajdonság eltávolítása: \"%s\""

#: lazarusidestrconsts.lisremovefilesfrompackage
#, object-pascal-format
msgid "Remove %s files from package \"%s\"?"
msgstr "%s fájl eltávolítása a(z) \"%s\" csomagból?"

#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Eltávolítás a projektből"

#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Eltávolítás a keresési útvonalból"

#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Include útvonal eltávolítása?"

#: lazarusidestrconsts.lisremovelocalvariable3
#, object-pascal-format
msgid "Remove local variable \"%s\""
msgstr "Helyi változó eltávolítása: %s"

#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Üzenettípus-szűrő eltávolítása"

#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Nem létező fájlok eltávolítása"

#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Kijelölt unit-ok eltávolítása"

#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Eltávolítja őket"

#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Útvonalak eltávolítása az \"Egyéb források\" közül"

#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Unit útvonal eltávolítása?"

#: lazarusidestrconsts.lisremoveuses
#, object-pascal-format
msgid "Remove uses \"%s\""
msgstr "Ne használja ezt: \"%s\""

#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Átnevezés"

#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Átnevezés ..."

#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Átnevezi a fájlt?"

#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "A fájl átnevezése sikertelen"

#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Az átnevezett azonosítók listájának megjelenítése"

#: lazarusidestrconsts.lisrenameto
#, object-pascal-format
msgid "Rename to %s"
msgstr "Átnevezés erre: %s"

#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Átnevezés kisbetűsre"

#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Projek újra megnyitása"

#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Újra megnyitás másik kódolással"

#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Ismétlés"

#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Csere"

#: lazarusidestrconsts.lisreplacedpropertyswiths
#, object-pascal-format
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "A(z) \"%s\" tulajdonság ki lett cserélve erre: \"%s\""

#: lazarusidestrconsts.lisreplacedtypeswiths
#, object-pascal-format
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "A(z) \"%s\" típus ki lett cserélve erre: \"%s\""

#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Csere"

#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Helyettesítő eljárások"

#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Cserék"

#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Az ismeretlen tulajdonságok és típusok javítása"

#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Teljes azonosító cseréje"

#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Kijelölés cseréje sikertelen."

#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report/hu"

#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Frissítés"

#: lazarusidestrconsts.lisreset
msgctxt "lazarusidestrconsts.lisreset"
msgid "Reset"
msgstr "Alaphelyzet"

#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Az összes fájlszűrő visszaállítása az alapértelmezettre?"

#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "Visszaállítja a kiválasztott komponens Left, Top, Width, Height tulajdonságait az ősük értékeire?"

#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr "Az erőforrás nevének egyedinek kell lennie."

#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Forrás mentési hiba"

#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "A projekt erőforrástípusa"

#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Újraindítás"

#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Eredmény:"

#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
msgstr ""
"A paraméter által mutatott sorszámú szót adja vissza a beszúrási jel előtt az aktuális sorban.\n"
"\n"
"Egy sorban a szavak számozása 1,2,3,... balról jobbra, de az utolsó szó,\n"
"ami mindig egy kiterjesztendő makró parancs, a 0 sorszámot viseli, vagyis a $PrevWord(0)\n"
"mindig az aktuális makrót jelenti.\n"
"\n"
"Példa:\n"
"i 0 count-1 forb|\n"
"A példában $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"Egy sablon végén a $PrevWord(-1) használata javasolt, mely üres karakterláncot ad vissza, de egy fontos műveletet is végrehajt: törli az összes $PrevWords értéket. Továbbá álljon még itt egy reguláris kifejezés, melyet a szavak keresésére használ ez a makró: [\\w\\-+*\\(\\)\\[\\].^@]+"

#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent    // the case list will be generated without extra indentation"
msgstr ""
"A \"case\" változó összes értékének listáját adja vissza a változó elé.\n"
"\n"
"Lehetséges paraméterek (vesszővel elválasztva):\n"
"WithoutExtraIndent    // az értékek listája a behúzás növelése nélkül lesz elkészítve"

#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Visszaállítás sikertelen"

#: lazarusidestrconsts.lisrevision
msgid "Revision: "
msgstr ""

#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Jobbra"

#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Jobb oldal horgonyozása"

#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Jobb oldali keret-térköz. Ez az érték hozzáadódik az alap oldaltérközhöz és a vezérlő jobb oldalára vonatkozik."

#: lazarusidestrconsts.lisrightgutter
#, fuzzy
msgctxt "lazarusidestrconsts.lisrightgutter"
msgid "Right"
msgstr "Jobb"

#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Ez az a társvezérlő, amelyikhez a jobb oldal horgonyzása történik. Hagyja üresen, hogy a szülőhöz történjen Delphi stílusban (a BorderSpacing és a ReferenceSide értéke nem számít)."

#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Jobb oldalak egy vonalban"

#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Jobb oldali távolságok egyenlően"

#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Futtatás"

#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "A \"Futásidejű és tervezési\" csomagok nincsenek korlátozva"

#: lazarusidestrconsts.lisrunning
#, object-pascal-format
msgid "%s (running ...)"
msgstr "%s (fut ...)"

#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "A fájl nem futtatható"

#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, object-pascal-format
msgid "The host application \"%s\" is not executable."
msgstr "A(z) \"%s\" külső alkalmazás nem futtatható."

#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "Futtatás"

#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Csak futásidejű, nem telepíthető az IDE-be"

#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "A \"Csak futásidejű\" csomagok csak projektekhez használhatók. Nem telepíthetők az IDE-be, még közvetve sem."

#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr "A \"Futásidejű\" csomagokat használhatják a projektek. Nem telepíthetők az IDE-be, kivéve ha a tervezési csomagoknak szükségük van rájuk."

#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Adott pontig futtatás sikertelen"

#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Absztrakt metódusok - még felülbírálatlan"

#: lazarusidestrconsts.lissamabstractmethodsof
#, object-pascal-format
msgid "Abstract methods of %s"
msgstr "%s absztrakt metódusai"

#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "A beszúrási jel nem egy osztály deklarációjában van"

#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "Az IDE dolgozik"

#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
#, object-pascal-format
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "A(z) %s egy absztrakt osztály, %s absztrakt metódusa van."

#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Nem találhatók absztrakt metódusok"

#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Minden kijelölt felülírása"

#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Első kijelölt felülírása"

#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Kijelölés megszüntetése"

#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
#, object-pascal-format
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "%s absztrakt felülírandó metódus van.%sVálassza ki a metódusokat, amelyekhez csonkokat kell létrehozni:"

#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Nem maradt több felülírandó absztrakt metódus."

#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Ez a metódus nem írható felül, mert a jelenlegi osztályban van definiálva"

#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Nem lehet megjeleníteni a jelenlegi osztály absztrakt metódusait, mert"

#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Mentés"

#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Mindet menti"

#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Minden kijelölt mentése"

#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Minden megváltozott fájl mentése"

#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Összes/Eredeti üzenetek mentése fájlba ..."

#: lazarusidestrconsts.lissaveandexitdialog
#, fuzzy
#| msgid "Save and exit dialog"
msgid "Only Save"
msgstr "Mentés és bezárás"

#: lazarusidestrconsts.lissaveandrebuildide
#, fuzzy
#| msgid "Save and rebuild IDE"
msgid "Rebuild IDE"
msgstr "Mentés és IDE újraépítése"

#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Megváltozott fájlok mentése?"

#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Elmenti a változásokat?"

#: lazarusidestrconsts.lissavechangestoproject
#, object-pascal-format
msgid "Save changes to project %s?"
msgstr "Menti a(z) %s projekt változásait?"

#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "A jelenleg szerkesztett fájl mentése"

#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "Mentve az IDE beállításokkal"

#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Mentve a projekt munkamenettel"

#: lazarusidestrconsts.lissavefilebeforeclosingform
#, object-pascal-format
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Menti a(z) \"%s\" fájlt%s a(z) \"%s\" form bezárása előtt?"

#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Makró mentése mint"

#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Üzenetek mentése"

#: lazarusidestrconsts.lissaveproject
#, object-pascal-format
msgid "Save project %s (*%s)"
msgstr "Projekt mentése: %s (%s)"

#: lazarusidestrconsts.lissavesessionchangestoproject
#, object-pascal-format
msgid "Save session changes to project %s?"
msgstr "Menti a(z) %s projekt munkamenetének változásait?"

#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Összecsukási infó mentése"

#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr "A kód szerkesztő támogatja a blokkok összecsukását (ideiglenes elrejtését)."

#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Ugrási előzmények mentése"

#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr "A ctrl-kattintás egy azonosítón a kód szerkesztőben az ugrási előzményekben tárolódik."

#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Beállítások mentése"

#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Megjelenített üzenetek mentése fájlba ..."

#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Mentés "

#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
#, object-pascal-format
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr "A(z) \"%s\" fájl mentése \"%s\"-ként karaktervesztéssel jár a(z) %s sor %s oszlopában."

#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Nagyítás:"

#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr "Fájlok keresése a szülő könyvtárban"

#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr "Forrásfájlok keresése a testvér könyvtárakban (a szülőkönyvtár és gyermekei)"

#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Ellenőrzés"

#: lazarusidestrconsts.lisscanning2
#, object-pascal-format
msgid "%s. Scanning ..."
msgstr "%s. Ellenőrzés ..."

#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Szülő könyvtár ellenőrzése"

#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Keresési útvonalak"

#: lazarusidestrconsts.lissearchunit
#, object-pascal-format
msgid "Search Unit \"%s\""
msgstr "Unit keresése: \"%s\""

#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
#, object-pascal-format, fuzzy, badformat
#| msgid "secondary config directory where Lazarus searches for config template files. Default is "
msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"."
msgstr "Másodlagos beállítások könyvtára, ahol a Lazarus keresi a beállítási sablon fájlokat. Alapértelmezett:"

#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Másodlagos beállítások útvonala"

#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr "Második teszt"

#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Nézze meg az üzeneteket."

#: lazarusidestrconsts.lisseeprojectprojectinspector
#, object-pascal-format
msgid "%sSee Project -> Project Inspector"
msgstr "%sLásd Projekt -> Projektfelügyelő"

#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Válaszonegy súgó elemet:"

#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Válasszon egy csomópontot"

#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr "Másik LCL vezérlőkészlet választása (makró: LCLWidgetType)"

#: lazarusidestrconsts.lisselectbuildmode
msgid "Select build mode"
msgstr ""

#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Válasszon Delphi form fájlokat (*.dfm)"

#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Kijelölve"

#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr "Kiválasztott kiegészítés:"

#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "A kiválasztott és a gyermek vezérlők"

#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(kijelölt alsó szomszéd)"

#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "A kiválasztott parancs társítása"

#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "kijelölve telepítésre"

#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "kijelölve eltávolításra"

#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(kijelölt bal oldali szomszéd)"

#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr "Az üzenetek ablakában kiválasztott üzenet:"

#: lazarusidestrconsts.lisselectedmodeswerecompiled
#, object-pascal-format
msgid "Selected %d modes were successfully compiled."
msgstr "A fordítás %d kiválasztott módban sikeres volt."

#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(kijelölt jobb oldali szomszéd)"

#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(kijelölt felső szomszéd)"

#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Válassza ki a fájlt"

#: lazarusidestrconsts.lisselectfpcpath
msgid "Select the path where FPC is installed"
msgstr "Az FPC telepítési útvonalának kiválasztása"

#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "A(z) FPC forráskód könyvtárának kiválasztása"

#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr "Keret választása"

#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "A kijelölés meghaladja a karakterlánc konstanst"

#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Kijelölés eszköz"

#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "A Lazarus forráskód könyvtárának kiválasztása"

#: lazarusidestrconsts.lisselectpathto
#, object-pascal-format
msgid "Select path to %s"
msgstr "Útvonal kiválasztása ehhez: %s"

#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "Célkönyvtár választása"

#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Minden szín beállítása:"

#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Alapértelmezés beállítása"

#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr "Állítsa be ezt a fordító üzeneteinek más nyelvre történő lefordításához (nem angol). Például: Német: $(FPCSrcDir)/compiler/msg/errordu.msg."

#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Alapértelmezett behúzás beállítása)"

#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Rövidítés:"

#: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar
msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty."
msgstr ""

#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Rövid, nincs útvonal"

#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
#, object-pascal-format
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr "A(z) \"%s\" komponens automatikusan létre legyen hozva amikor az alkalmazás elindul?"

#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Megjelenítés"

#: lazarusidestrconsts.lisshowabstractmethodsof
#, object-pascal-format
msgid "Show abstract methods of \"%s\""
msgstr "\"%s\" absztrakt metódusainak megjelenítése"

#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Komponensfa megjelenítése"

#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr "Konzol megjelenítése"

#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Deklaráció tippek megjelenítése"

#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "A módok közötti különbségek megjelenítése ..."

#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Üres unit-ok/csomagok megjelenítése"

#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr "A \"lefordított sorok\" FPC üzenet megjelenítése"

#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Ikonok megjelenítése"

#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Hasábköz megjelenítése"

#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Súgó megjelenítése"

#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Tippek megjelenítése"

#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Azonosítók megjelenítése"

#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Információs ablak megjelenítése"

#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Üzenettípus azonosítójának megjelenítése"

#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr "Megjelenítés több sorban"

#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Csak a megváltoztatott megjelenítése"

#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr "Csak egy gomb jelenjen meg a tálcán az egész IDE számára, az ablakonkénti egy helyett. Néhány Linux ablakkezelő (mint a Cinnamon) nem támogatja ezt és mindig külön gombot jelenít meg az ablakoknak."

#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr "Kimenet megjelenítése"

#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview gutter"
msgstr "Áttekintő hasábköz megjelenítése"

#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Csomagok megjelenítése"

#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Váltás a forráskódbeli helyzetére"

#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
msgid "Show property filter"
msgstr "Tulajdonságszűrő megjelenítése"

#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "A legutóbb használt azonosítók megjelenítése felül"

#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Relatív útvonalak megjelenítése"

#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr "Minden vezérlő megjelenítése a fa-szerkezetben"

#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr "Lent egy keretben megjelenik a kiválasztott tulajdonság leírása."

#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
#, fuzzy
#| msgid "Show setup dialog for most important settings"
msgid "Show setup dialog for most important settings."
msgstr "Beállítás párbeszéd megjelenítése a legfontosabb beállításokhoz"

#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Különleges karakterek megjelenítése"

#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Állapotsáv megjelenítése"

#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Unit-ok megjelenítése"

#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr "Előkészítő/befejező szakaszt tartalmazó unit-ok megjelenítése"

#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr "Ezen unit-ok a program/alkalmazás által használt globális adatokat készíthetnek elő. Körültekintően távolítandók el."

#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Nem használt unitok megjelenítése ..."

#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Érték-tippek megjelenítése hibakeresés közben"

#: lazarusidestrconsts.lisshowversionandexit
#, fuzzy
#| msgid "show version and exit"
msgid "Show version and exit."
msgstr "Változatszám megjelenítése és kilépés"

#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Zsugorítás legkisebbre"

#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Társ"

#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Egyszerű program"

#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "A legegyszerűbb parancssoros Free Pascal program."

#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Egyszerű szintaxis"

#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Hibák átugrása"

#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Fájl kihagyása"

#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Fájl kihagyása és a betöltés folytatása"

#: lazarusidestrconsts.lisskiploadinglastproject
#, fuzzy
#| msgid "Skip loading last project"
msgid "Skip loading last project."
msgstr "Legutóbbi projekt betöltésének kihagyása"

#: lazarusidestrconsts.lisskipstartupchecks
msgid "Skip selected checks at startup. Valid options are:"
msgstr ""

#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr "Lassabb, de pontosabb."

#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Inkább kisebb, mint gyorsabb"

#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Találatok"

#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Sajnáljuk, ez a típus egyelőre nincs megvalósítva"

#: lazarusidestrconsts.lissorthistorylimit
msgid "History items limit"
msgstr ""

#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr "Rendezés"

#: lazarusidestrconsts.lissortorderalphabetic
msgid "Alphabetic"
msgstr ""

#: lazarusidestrconsts.lissortorderdefinition
msgid "Definition (Scoped)"
msgstr ""

#: lazarusidestrconsts.lissortorderscopedalphabetic
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
msgid "Alphabetic (Scoped)"
msgstr ""

#: lazarusidestrconsts.lissortordertitle
msgid "Order by"
msgstr ""

#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "Növekvő"

#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "Kis/nagybetűre érzékeny"

#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "Csökkenő"

#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Tartomány"

#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Szóköz kihagyása"

#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Sorok"

#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Beállítások"

#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Bekezdések"

#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Előnézet"

#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Elfogadás"

#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Kijelölés rendezése"

#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Kifejezések"

#: lazarusidestrconsts.lissourceanddestinationaresame
#, object-pascal-format
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr "A forrás \"%s\"%sés a cél \"%s\"%s ugyanaz a könyvtár. Másik könyvtárak kell választani."

#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, object-pascal-format
msgid "Source directory \"%s\" does not exist."
msgstr "A(z) \"%s\" forrás könyvtár nem létezik."

#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Forráskódszerkesztő ablakainak kezelője"

#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Forrás módosítva"

#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, object-pascal-format
msgid "Source of page \"%s\" has changed. Save?"
msgstr "A(z) \"%s\" lap forrása megváltozott. Mentés?"

#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
#, object-pascal-format
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "A lapok forrásai megváltoztak. Menti a(z) \"%s\" lapot? (és %d továbbit)"

#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Forrás útvonalak"

#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Azonos távolságra"

#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Forrás OS"

#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Keresés"

#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Szöveg keresése"

#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Átalakítás kezdése"

#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "IDE indítása"

#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Induljon új projekttel"

#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr "Az állapotsor megjeleníti a tulajdonság nevét és az osztályt amelyben közzé lett téve."

#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Leállítás"

#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Leállítja a jelenleg futó hibakeresést és újraépíti a projektet?"

#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Leállítja a hibakeresést?"

#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Leállítja a hibakeresést?"

#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Kivételek esetén leállítás"

#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Leállítja a hibakeresést?"

#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Az útvonal-elválasztók \\ és / tárolása:"

#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Adatfolyam hiba"

#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Al-eljárás"

#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Al-eljárás azonos szinten"

#: lazarusidestrconsts.lissubtarget
msgid "Subtarget"
msgstr ""

#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Sikerült"

#: lazarusidestrconsts.lissuccessfullyexported
#, object-pascal-format
msgid "Successfully exported to \"%s\"."
msgstr "Sikeresen exportálva ide: \"%s\""

#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
#, object-pascal-format
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr "%d építési mód sikeresen exportálva ide: \"%s\""

#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
#, object-pascal-format
msgid "Successfully exported compiler options to \"%s\"."
msgstr "Fordítóbeállítások sikeresen exportálva ide: \"%s\""

#: lazarusidestrconsts.lissuccessfullyimported
#, object-pascal-format
msgid "Successfully imported from \"%s\"."
msgstr "Sikeresen importálva innen: \"%s\""

#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
#, object-pascal-format
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr "%d építési mód sikeresen importálva innen: \"%s\""

#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
#, object-pascal-format
msgid "Successfully imported compiler options from \"%s\"."
msgstr "Fordítóbeállítások sikeresen importálva innen: \"%s\""

#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Az új fájl alapértelmezett nevét kisbetűvel ajánlja fel"

#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Gyanús include útvonal"

#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Gyanús unit útvonal"

#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Érvénytelen változónév"

#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, object-pascal-format
msgid "\"%s\" is not a valid identifier."
msgstr "Érvénytelen azonosító: \"%s\""

#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Rendszerváltozó felülbírálása"

#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Szűrőbeállítások váltása"

#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr "Váltás a Kedvencek lapra komponensnév kérése után."

#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Szintaxis mód"

#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "A system.ppu nem található. Ellenőrizze az fpc.cfg fájlt!"

#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Tab"

#: lazarusidestrconsts.listaborderconfirmsort
#, object-pascal-format
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Rendezze \"%s\" gyermekeinek Tab sorrendjét azok helyzete alapján"

#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "A kijelölt vezérlő mozgatása lefelé a Tab sorrendben"

#: lazarusidestrconsts.listaborderof
#, object-pascal-format
msgid "Tab Order of %s"
msgstr "%s Tab sorrendje"

#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr "Tab sorrend újraszámítása rekurzívan a gyermek vezérlők számára"

#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr "Rekurzívan"

#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Számítsa ki a Tab sorrendet a vezérlők X- és Y- helyzete alapján"

#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "A kijelölt vezérlő mozgatása felfelé a Tab sorrendben"

#: lazarusidestrconsts.listabsfor
#, object-pascal-format
msgid "Tabs for %s"
msgstr "%s lapjai"

#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Cél:"

#: lazarusidestrconsts.listarget2
#, object-pascal-format
msgid ", Target: %s"
msgstr ", Cél: %s"

#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Cél CPU"

#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "A Célfájl neve (-o, üres = a unitok kimeneti könyvtára)"

#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "A célfájl neve (-o):"

#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Projekt cél fájlneve"

#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Cél fájlnév + paraméterek"

#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "A cél csak olvasható"

#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Cél OS"

#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Szerkeszthető cella"

#: lazarusidestrconsts.listemplateeditparamcellhelp
#, object-pascal-format
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s  while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "Szerkeszthető cella beszúrása. A cellák között a TAB billenytűvel lehet navigálni.%0:sA \"param\" makró vesszővel elválasztott argumentumlistát igényel.%0:sAz első argumentum az alapértelmezett érték.%0:sA második argumentum (esetleges) használatával egy egy másik cellához csatolható (szinkronszerkesztés)%0:s%0:s  while param(\"foo\") do param(foo);%0:sKét különálló cellát szúr be, mindkettő alapértelmezett szövege \"foo\" lesz%0:sAz idézőjel tetszőleges%0:s%0:s  if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sKét csatolt cellát szúr be, az egyik szerkesztése a másikat is megváltoztatja%0:sAz \"1\" érték a másik \"param()\" helyzetére hivatkozik, ezért ha több \"param\" is van:%0:s  if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sA második és a harmadik csatolva van egymáshoz. (a harmadik a \"2\"-ra hivatkozik) %0:s%0:sA \"sync\" lerövidíthető \"s\"-re:%0:s  if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s  if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sA második és a harmadik csatolva van egymáshoz.%0:sMegjegyzés: A \"sync\" nem található és nincs \"=\" jel sem, ezért a csatolás az előző olyan cellával jön létre, melynek ugyanaz az alapértelmezett szövege (ez esetben \"foo\")"

#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "Sablonfájl"

#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Teszt könyvtár"

#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "URL tesztelése"

#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
#, object-pascal-format
msgid "The Application Bundle was created for \"%s\""
msgstr "Az alkalmazásköteg létre lett hozva ehhez: \"%s\""

#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, object-pascal-format
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "A(z) \"%s\" osztály egy TControl és nem illeszthető egy nem-vezérlő elemre.%sA beillesztés nem lehetséges."

#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
#, object-pascal-format
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "A fordítófájl \"%s\" nem tűnik megfelelőnek:%s%s"

#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, object-pascal-format
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "A(z) %s komponens nem törölhető, mert annak birtokosa nem nem a(z) %s birtokolja."

#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "A(z) \"%s\" osztály komponensszerkesztője a következő hibát okozta:%s\"%s\""

#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, object-pascal-format
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "A(z) \"%s\" osztály komponensszerkesztője,%sami a #%s \"%s\" paranccsal lett meghívva,%sa következő hibát okozta:%s\"%s\""

#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "A(z) %s komponens a(z) %s leszármazottja.%sEgy származtatott komponens törléséhez nyissa meg az őst, és törölje ott."

#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "A(z) %s komponens ebből lett származtatva: %s.%sEgy származtatott komponens átnevezéséhez meg kell nyitni az őst és ott átnevezni."

#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "A form-on / adatmodulban minden komponens nevének egyedinek kell lennie. A nevek összehasonlítása kis-/nagybetűre érzéketlen, mint a Pascal azonosítók esetén."

#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "A beállítások visszafejlesztésre/átalakításra kerülnek."

#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, object-pascal-format
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "A(z) %s egy nem létező könyvtárat tartalmaz:%s%s"

#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, object-pascal-format
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "A(z) %s egy * karaktert tartalmaz.%sA Lazarus ezt normál karakterként használja és nem úgy értékeli mint fájlnévmaszkot."

#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "A jelenlegi FPC nem rendelkezik beállítási fájllal. Valószínűleg hiányolni fog néhány unit-ot. Ellenőrizze az FPC telepítést!"

#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, object-pascal-format
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "A hibakereső \"%s\"%snem létezik vagy nem futtatható.%sLásd: Eszközök -> Beállítások -> Hibakereső beállításai"

#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "Az alapértelmezett módot a projektben kell tárolni és nem a munkamenetben."

#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, object-pascal-format
msgid "The destination directory%s\"%s\" does not exist."
msgstr "A célkönyvtár nem létezik:%s\"%s\""

#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
#, object-pascal-format
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "A(z) \"%s\" könyvtár már nem tartalmaz projekt include fájlt. Eltávolítja ezt a könyvtárat a projekt include keresési útvonalai közül?"

#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
#, object-pascal-format
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "A(z) \"%s\" könyvtár már nem tartalmaz projekt unit-ot. Eltávolítja ezt a könyvtárat a projekt unit keresési útvonalai közül?"

#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, object-pascal-format
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "A(z) \"%s\" könyvtár többé nem szükséges a unit elérési útban.%sEltávolítja?"

#: lazarusidestrconsts.listhefile
#, object-pascal-format
msgid "The file \"%s\""
msgstr "A(z) \"%s\" fájl"

#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "A fájlindex szükséges az olyan műveletekhez mint a deklaráció keresése. Átvizsgálás közben szerkesztheti a forrásokat és fordíthat, de az olyan műveletek mint a deklaráció keresése a \"unit nem található\" hibát fogja megjeleníteni. Ez akár egy percig is tarthat."

#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "A(z) \"%s\" fájl nem egy Lazarus projekt.%sÚj projekt létrehozása ehhez: \"%s\"?"

#: lazarusidestrconsts.listhefilemaskisinvalid
#, object-pascal-format
msgid "The file mask \"%s\" is invalid."
msgstr "A fájlmaszk érvénytelen: \"%s\""

#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
#, object-pascal-format
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "A fájlmaszk nem egy szabályos reguláris kifejezés: \"%s\""

#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, object-pascal-format
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "A(z) \"%s\" fájl egy programnak tűnik.%sBezárja a jelenlegi projektet és létrehoz egy új Lazarus projektet ehhez a programhoz?%sHa a \"Nem\"-et választja normál forrásként tölti be a fájlt."

#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, object-pascal-format
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "A(z) %s fájl egy létező Lazarus projekt program fájljának tűnik."

#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, object-pascal-format
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "A(z) \"%s\" fájl nem található.%sMegkeresi kézzel?"

#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, object-pascal-format
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort  will stop the loading."
msgstr "A(z) \"%s\" fájl nem található.%sA \"Kihagyás\" folytatja a projekt betöltését,%sA \"Megszakítás\" leállítja a betöltést."

#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, object-pascal-format
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "A következő metódusok, melyeket a(z) %s használ, nincsenek a forrásban:%s%s%s%s%sEltávolítja a függő hivatkozásokat?"

#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "Az FPC források könyvtára \"%s\" nem tűnik megfelelőnek:%s%s"

#: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect
#, object-pascal-format
msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s"
msgstr ""

#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
#, object-pascal-format
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "A Free Pascal fordítóprogram neve általában \"%s\". Használható még célfüggő fordító is mint a(z) \"%s\". Meg kell adni a fájl teljes útvonalát."

#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr "Az IDE még épít."

#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Az azonosító egy unit. Használja a Fájl -> Mentés másként menüpontot unit átnevezéshez!"

#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, object-pascal-format
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "A(z) %s billentyű már hozzá van rendelve a(z) %s%s művelethez.%s%sEltávolítja a régebbi hozzárendelést és hozzárendeli a billentyűt az %s művelethez?"

#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, object-pascal-format
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "A(z) %s alkalmazásköteg,%sami a futtatáshoz szükséges, nem létezik vagy nem futtatható.%sLétre szeretne hozni egyet?%sEllenőrizze a Projekt -> Projekt beállításai -> Alkalmazás lapon."

#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, object-pascal-format
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "A(z) \"%s\"%sfuttató alkalmazás nem létezik, vagy nem futtatható.%sEllenőrizze a Futtatás -> Futtatási paraméterek -> Helyi lapon."

#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
#, object-pascal-format
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "A Lazarus könyvtára tartalmazza az IDE forrásait, az LCL csomagok fájljait, és sok alapvető csomagot. Tartalmazza például az \"ide%slazarus.lpi\" fájlt. A fordítások fájljai is ott találhatók."

#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "A Lazarus könyvtára \"%s\" nem tűnik megfelelőnek:%s%s"

#: lazarusidestrconsts.listhelazarussourcesuse
#, object-pascal-format
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
msgstr ""

#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "Az LFM (Lazarus form) fájl érvénytelen tulajdonságokat tartalmaz. Ez azt jelenti, hogy tartalmaz például néhány tulajdonságot/osztályt, amely nem létezik a jelenlegi LCL-ben. Az általános megoldás erre, a tulajdonságok eltávolítása, és a Pascal kód saját kezű kijavítása."

#: lazarusidestrconsts.listhemacrodoesnotbeginwith
#, object-pascal-format
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "A(z) \"%s\" makró nem ezzel kezdődik: \"%s\"."

#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
#, object-pascal-format
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "A \"make\" program neve általában \"%s\". Szükség van rá az IDE építéséhez. Meg kell adni a fájl teljes útvonalát."

#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, object-pascal-format
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Az új beemelhető fájl nem az beemelhető fájlok keresési útvonalon található.%sA(z) %s könyvtár hozzáadása?"

#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, object-pascal-format
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Az új unit nem a unit keresési útvonalon található.%sA(z) %s könyvtár hozzáadása?"

#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "A régi beállítások frissítve lesznek."

#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
#, object-pascal-format
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "Az \"Egyéb források\" tartalmaz egy könyvtárat, mely már megtalálható az \"Egyéb unit fájlok\" között.%s%s"

#: lazarusidestrconsts.listheoutputdirectoryismissing
#, object-pascal-format
msgid "The output directory \"%s\" is missing."
msgstr "A(z) \"%s\" kimeneti könyvtár hiányzik."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
#, object-pascal-format
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "A(z) %s kimeneti könyvtára fel van sorolva a(z) %s include keresési útvonalai között."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "A(z) %s kimeneti könyvtára fel van sorolva a(z) %s öröklött include keresési útvonalai között."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "A(z) %s kimeneti könyvtára fel van sorolva a(z) %s öröklött unit keresési útvonalai között."

#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
#, object-pascal-format
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "A(z) %s kimeneti könyvtára fel van sorolva a(z) %s unit keresési útvonalai között."

#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr "A kimeneti könyvtárnak egy különálló könyvtárnak kellene lennie, amely nem tartalmaz semmilyen forrás fájlt."

#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "A tulajdonos osztálynak ez a neve"

#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "A tulajdonosnak ez a neve"

#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "A(z) %s csomag hozzáadja a(z) \"%s\" útvonalat a IDE include útvonalaihoz.%sEz valószínűleg egy helytelen beállítás a csomagban."

#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "A(z) %s csomag hozzáadja a(z) \"%s\" útvonalat a IDE unit útvonalaihoz.%sEz valószínűleg egy helytelen beállítás a csomagban."

#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "A csomag már tartalmaz egy ilyen nevű unit-ot."

#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, object-pascal-format
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr "A(z) %s csomag nem telepíthető, mert igényli a(z) \"%s\" csomagot, ami egy csak futásidejű csomag."

#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, object-pascal-format
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr "A(z) %s csomag nem távolítható el, mert szükséges az IDE működéséhez."

#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, object-pascal-format
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "A(z) %s csomagnak nincs \"Register\" eljárása, ami általában azt jelenti, hogy nem biztosít IDE bővítményt. Telepítése valószínűleg csak növeli az IDE méretét és bizonytalanná teszi a működését.%sJavaslat: Ha szükség van egy csomagra a projektben akkor a \"Hozzáadás a projekthez\" menüelem használandó."

#: lazarusidestrconsts.listhepackageisalreadyinthelist
#, object-pascal-format
msgid "The package %s is already in the list"
msgstr "A(z) %s csomag már szerepel a listában"

#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
#, object-pascal-format
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "A(z) %s csomag nem tervezési csomag. Nem telepíthető az IDE-be."

#: lazarusidestrconsts.listhepackageisusedby
#, object-pascal-format
msgid "The package \"%s\" is used by"
msgstr ""

#: lazarusidestrconsts.listhepathofmakeisnotcorrect
#, object-pascal-format
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "A \"make\" útvonala helytelen: \"%s\""

#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, object-pascal-format
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "A \"make\" program nem található.%sEz az eszköz szükséges a Lazarus építéséhez."

#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "A projekt fordítóbeállításai és a direktívák a fő forrásban eltérnek. Az új unit-hoz a projekt módbeállítása és karakterlánctípusa lesz használva:"

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
msgid "Running your application with debugger"
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
msgid "Run with no debugger"
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
#, object-pascal-format
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
msgid "Choose Debug Information format"
msgstr ""

#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, object-pascal-format
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "A projekt nem használja az LCL \"interfaces\" unit-ját, amelyre szükség van az LCLBase-hez.%sKülönös összefűzési hibák jelentkeznek az LCL \"interfaces\" unit nélküli használatkor."

#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
#, object-pascal-format
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
msgstr ""

#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "A projektnek nincs fő forrásfájlja."

#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, object-pascal-format
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "A projekt információs fájl \"%s\"%smegegyezik a projekt fő forrás fájljával!"

#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
#, object-pascal-format
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "A projekt információs fájlja \"%s\"%smegváltozott a lemezen."

#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, object-pascal-format
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Építés előtt menteni kell a projektet.%sHa a Teszt könyvtár be van állítva az IDE beállításai között%sakkor a létrehozott projektek azonnal építhetők.%sProjekt mentése?"

#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr "A projekt FPC erőforrásokat használ, amihez legalább FPC 2.4 szükséges"

#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, object-pascal-format
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "A projekt %s cél OS-t és %s cél CPU-t használ.%sA system.ppu ehhez a célhoz nem található az FPC bináris könyvtáraiban.%sGyőződjön meg róla, hogy az FPC megfelelően lett telepítve ehhez a célhoz, és az fpc.cfg a helyes könyvtárakat tartalmazza."

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
#, object-pascal-format
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr "A projekt hibakeresési szimbólumai külső fájlba kerülnek. A(z) \"%s\" csak a futtatható állományban található szimbólumokat támogatja."

#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
#, object-pascal-format
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr "A projekt a futtatható állományba írja a hibakeresési szimbólumokat külső fájl helyett. A(z) \"%s\" csak a külső fájlban található szimbólumokat támogatja."

#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
#, object-pascal-format
msgid "%sThere are additional notes for this message on%s"
msgstr "%sTovábbi megjegyzések találhatók ezen üzenethez:%s"

#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr "Nincsenek ütköző billentyű beállítások."

#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
#, object-pascal-format
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "Más fájlok is vannak a könyvtárban ugyanezzel a névvel,%samelyek csak betűméretben térnek el:%s%s%sTörli őket?"

#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, object-pascal-format
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "Van egy fájl ugyanilyen névvel és hasonló kiterjesztéssel a meghajtón%sFájl: %s%sMegtévesztő fájl: %s%sTörli a megtévesztő fájlt?"

#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Már létezik építési mód ezzel a névvel."

#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
#, object-pascal-format
msgid "There is already a component class with the name %s."
msgstr "Már létezik egy komponens-osztály ezzel a névvel: %s"

#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Már létezik egy komponens ezzel a névvel"

#: lazarusidestrconsts.listhereisalreadyafilein
#, object-pascal-format
msgid "There is already a file%s%s%sin %s"
msgstr "Már van egy %s%s%s fájl ebben: %s"

#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
#, object-pascal-format
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr "Már van egy \"%s\" fájl ebben: %s%sRégi: %s%sÚj: %s%s%sFolytatás?"

#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, object-pascal-format
msgid "There is already a form with the name \"%s\""
msgstr "Már létezik egy form \"%s\" névvel."

#: lazarusidestrconsts.listhereisalreadyamacrowiththename
#, object-pascal-format
msgid "There is already a macro with the name \"%s\"."
msgstr "Már létezik egy makró \"%s\" névvel."

#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
#, object-pascal-format
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Már létezik egy IDE makró \"%s\" névvel"

#: lazarusidestrconsts.listhereisalreadyapackageinthelist
#, object-pascal-format
msgid "There is already a package %s in the list"
msgstr "Már létezik egy %s nevű csomag a listában"

#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
#, object-pascal-format
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr "Már megtalálható egy \"%s\" unit ebben: %s%sRégi: %s%sÚj: %s%sBiztosítani kell, hogy a unit-ok keresési útvonalai csak az egyet tartalmazzanak közülük.%s%s Folytatás?"

#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, object-pascal-format
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Már létezik \"%s\" nevű unit. A Pascal azonosítóknak egyedinek kell lenniük."

#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, object-pascal-format
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Létezik \"%s\" nevű unit a projektben.%sVálasszon egy eltérő nevet!"

#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
#, object-pascal-format
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr "Nincs fpc.exe a(z) %s könyvtárában. Általában a make program együtt van telepítve az FPC fordítóval."

#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
#, object-pascal-format
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
msgstr ""

#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Legalább egy építési módnak lennie kell."

#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, object-pascal-format
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "A(z) \"%s\" osztály leszármazottja ennek: \"%s\". Lehetséges, hogy ez csak a TForm elgépelése."

#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
#, object-pascal-format
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Hiba történt a kijelölt %s komponens írása közben:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
#, object-pascal-format
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Hiba történt a kijelölt %s komponens bináris folyamának átalakítása közben:%s:%s%s"

#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
#, object-pascal-format
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Hiba történt a komponens folyam vágólapra másolása közben:%s%s"

#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "A fő komponens nem törölhető."

#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "E fájlok törölve lesznek"

#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Ezen beállítások a projekttel együtt vannak tárolva."

#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "E unit-ok nem találhatók:"

#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
#, object-pascal-format
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "A Free Pascal csomag forrásaira szükség van a böngészéshez és a kódkiegészítéshez. Az tartalmazza például a(z) \"%s\" fájlt."

#: lazarusidestrconsts.listhetargetdirectoryisafile
#, object-pascal-format
msgid "The target directory is a file:%s"
msgstr "A célkönyvtár neve egy fájlra mutat:%s"

#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr "A célfájl neve egy könyvtárra mutat."

#: lazarusidestrconsts.listhetargetisnotwritable
#, object-pascal-format
msgid "The target %s is not writable."
msgstr "A(z) %s cél nem írható."

#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
#, object-pascal-format
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "A teszt könyvtár nem található:%s\"%s\"%s(Lásd az IDE beállításait)"

#: lazarusidestrconsts.listheunitalreadyexists
#, object-pascal-format
msgid "The unit \"%s\" already exists."
msgstr "A(z) \"%s\" unit már létezik."

#: lazarusidestrconsts.listheunitbelongstopackage
#, object-pascal-format
msgid "The unit belongs to package %s."
msgstr "A unit a következő csomaghoz tartozik: %s"

#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, object-pascal-format
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "A(z) %s unit kétszer is létezik a(z) %s unit elérési útjában:"

#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "A unit-nak ez a neve"

#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, object-pascal-format
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "A(z) \"%s\" unit fájlneve nem kisbetűs.%sA Free Pascal fordító nem keres minden betűmérettel. Ajánlott csak kisbetűk használata a fájlnévben.%sÁtnevezi kisbetűsre?"

#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
#, object-pascal-format
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "A(z) %s unit az FPC forrásainak része, de a megfelelő FPDoc xml fájl nincs meg.%sVagy az fpcdocs könyvtár nem lett hozzáadva a keresési útvonalakhoz vagy a unit még nincs dokumentálva.%sAz FPC forrásainak FPDoc fájljai letölthetők innen: %s%sAdja meg a könyvtárat az FPDoc szerkesztő beállításai között.%sÚj fájl létrehozásához a könyvtárnak írhatónak kell lennie."

#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
#, object-pascal-format
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "A(z) %s unit-ot más fájlok is használjak.%sFrissíti a hivatkozásokat automatikusan?"

#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, object-pascal-format
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "A unit-nak magának már ez a neve: \"%s\". A Pascal azonosítóknak egyedinek kell lenniük."

#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, object-pascal-format
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "A(z) \"%s\" unit keresési útvonala tartalmazza a(z) \"%s\" könyvtárat, ami a(z) %s csomag forrás könyvtára"

#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, object-pascal-format
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "A(z) \"%s\" munkakönyvtár nem létezik.%sEllenőrizze a munkakönyvtárat a menüben itt: Futtatás -> Futtatási paraméterek"

#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
#, object-pascal-format
msgid "This component already contains a class with the name %s."
msgstr "Ez a komponens már tartalmaz egy osztályt %s névvel."

#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Ehhez a művelethez szükség van egy megnyitott .lfm fájlra a forráskódszerkesztőben."

#: lazarusidestrconsts.listhishelpmessage
#, fuzzy
#| msgid "this help message"
msgid "This help message."
msgstr "Ez a súgó üzenet"

#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr "Ez egy teszt-projekt tervezési csomagokhoz, az IDE-n kívüli tesztelésre."

#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, object-pascal-format
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Ez egy pascal fájlnak tűnik.%sAjánlott kisbetűs fájlneveket használni, hogy a problémák elkerülhetők legyenek egyes fájlrendszereken és különböző fordítókkal.%sÁtnevezés kisbetűsre?"

#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Ez a projekt nem tartalmaz fő forrásfájlt "

#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Ez a projekt csak az alapértelmezett építési módot tartalmazza."

#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, object-pascal-format
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "A Lazarus építésének ezen beállításai nincsenek támogatva e telepítésben.%sA(z) \"%s\" könyvtár nem írható.%sLásd a telepítés egyéb módjait a Lazarus weblapján."

#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, object-pascal-format
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Ez állomány nem helyezhető át.%sJelöljön ki kódot, amit új eljárásba/metódusba helyezhet!"

#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr "Ez lehetővé teszi az összes építési mód egyidejű megváltoztatását. Még nincs kidolgozva."

#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Ez körkörös függést hoz létre."

#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
#, object-pascal-format
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "Ez sok szöveget (%s) tesz a vágólapra.%sFolytatás?"

#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "Cím"

#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
#, fuzzy
#| msgid "Title in taskbar shows for example: project1.lpi - Lazarus"
msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus."
msgstr "A cím a tálcán így jelenik meg: project1.lpi - Lazarus"

#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Cím (üres = alapértelmezett)"

#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Útvonal:"

#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr "Eszköztár beállítása"

#: lazarusidestrconsts.listoolhasnoexecutable
#, object-pascal-format
msgid "tool \"%s\" has no executable"
msgstr "a(z) \"%s\" eszköz nem tartalmaz futtatható állományt"

#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "Eszköz-fejléc: Sikertelen"

#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "Eszköz-fejléc: Fut"

#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "Eszköz-fejléc: Felgördítve"

#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "Eszköz-fejléc: Sikerült"

#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "az eszköz kilépési kóddal állt le: %s. A helyi menüből további információ érhető el."

#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr "az eszköz a következő adatokkal állt le: ExitCode 0 és ExitStatus %s. A helyi menüt használva további információk érhetők el."

#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Fent"

#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Felső oldal horgonyozása"

#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Felső keret-térköz. Ez az érték hozzáadódik az alap oldaltérköz értékéhez és a vezérlő feletti térközre vonatkozik."

#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Procedure hint"
msgstr "Osztály/Eljárás tipp megjelenítése"

#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Felső oldalak egy vonalban"

#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Ez az a társvezérlő, amelyikhez a felső oldal horgonyzása történik. Hagyja üresen, hogy a szülőhöz történjen Delphi stílusban (a BorderSpacing és a ReferenceSide értéke nem számít)."

#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Felső oldali távolságok egyenlően"

#: lazarusidestrconsts.listotalpages
#, object-pascal-format
msgid "Total Pages: %s"
msgstr "Összes lap: %s"

#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "Az angol üzenetek lefordítása"

#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Frissíteni kell a fát"

#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
#, object-pascal-format
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Két áthelyezett fájlnak ugyanaz lesz a neve:%s%s%s%s%sitt: %s"

#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Típusok (nincsenek eltávolítva ha nincs csere)"

#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "További könyvtárak:"

#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Minden unit a csomagban"

#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Minden unit a szerkesztőben"

#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Minden unit"

#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "Alapértelmezés szerint csak a projekt és a forráskódszerkesztő unit-jai vannak átnézve. Itt lehet hozzáadni további átnézendő könyvtárakat, pontosvesszővel elválasztva."

#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Minden csomópont összecsukása"

#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Minden csomópont kinyitása"

#: lazarusidestrconsts.lisudfile
#, object-pascal-format
msgid "File: %s"
msgstr "Fájl: %s"

#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Szűrő)"

#: lazarusidestrconsts.lisudimplementationuses
#, object-pascal-format
msgid "Implementation Uses: %s"
msgstr "Kidolgozás használja: %s"

#: lazarusidestrconsts.lisudimplementationuses2
#, object-pascal-format
msgid "implementation uses: %s"
msgstr "kidolgozás használja: %s"

#: lazarusidestrconsts.lisudinterfaceuses
#, object-pascal-format
msgid "Interface Uses: %s"
msgstr "Felület használja: %s"

#: lazarusidestrconsts.lisudinterfaceuses2
#, object-pascal-format
msgid "interface uses: %s"
msgstr "felület használja: %s"

#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Projektek és csomagok"

#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Ellenőrzés ..."

#: lazarusidestrconsts.lisudscanningunits
#, object-pascal-format
msgid "Scanning: %s units ..."
msgstr "Ellenőrzés: %s unit ..."

#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Keresés)"

#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "A kifejezés következő előfordulásának keresése"

#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "A kifejezést tartalmazó következő unit keresése"

#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "A kifejezés előző előfordulásának keresése"

#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "A kifejezést tartalmazó előző unit keresése"

#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Kijelölt unit-ok"

#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Könyvtár-csomópontok megjelenítése"

#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "A projekt és a csomagok csomópontjainak megjelenítése"

#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Unit-ok"

#: lazarusidestrconsts.lisudunits2
#, object-pascal-format
msgid "Units: %s"
msgstr "Unit-ok: %s"

#: lazarusidestrconsts.lisudusedbyimplementations
#, object-pascal-format
msgid "Used by Implementations: %s"
msgstr "Kidolgozások által használva: %s"

#: lazarusidestrconsts.lisudusedbyimplementations2
#, object-pascal-format
msgid "used by implementations: %s"
msgstr "kidolgozások által használva: %s"

#: lazarusidestrconsts.lisudusedbyinterfaces
#, object-pascal-format
msgid "Used by Interfaces: %s"
msgstr "Felületek által használva: %s"

#: lazarusidestrconsts.lisudusedbyinterfaces2
#, object-pascal-format
msgid "used by interfaces: %s"
msgstr "felületek által használva: %s"

#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Ne mutassa újra ezt az üzenetet."

#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Hiba a reguláris kifejezésben"

#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Betűtípus UTF-8 nélkül."

#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Sorra ugrás:"

#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"

#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Nem található"

#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, object-pascal-format
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Kicseréli a(z) \"%s\" ezen előfordulását%s erre: \"%s\"?"

#: lazarusidestrconsts.lisuesearching
#, object-pascal-format
msgid "Searching: %s"
msgstr "Keresés: %s"

#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Keresés folytatása az elejétől?"

#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Keresés folytatása a végétől?"

#: lazarusidestrconsts.lisuesearchstringnotfound
#, object-pascal-format
msgid "Search string '%s' not found!"
msgstr "A keresett '%s' nem található!"

#: lazarusidestrconsts.lisuethecurre
#, object-pascal-format
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "A szerkesztő jelenlegi betűkészlete nem támogatja az UTF-8 kódolást, azonban úgy tűnik a rendszer azt használja.%sEz azt jelenti, hogy a nem ASCII karakterek valószínűleg helytelenül jelennek majd meg.%sA szerkesztő beállításai között másik betűkészlet választható."

#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Include gyorsítótár törlése"

#: lazarusidestrconsts.lisuidbytes
#, object-pascal-format
msgid "%s bytes"
msgstr "%s byte"

#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Használat ebben:"

#: lazarusidestrconsts.lisuidinproject
msgid "In project:"
msgstr "Ebben a projektben:"

#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Sorok:"

#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Név:"

#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "nem"

#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Méret:"

#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Típus:"

#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "igen"

#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "CodeTools értékeinek megjelenítése"

#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Bináris folyam átalakítása szöveggé nem lehetséges"

#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Komponensek vágólapra másolása nem lehetséges"

#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, object-pascal-format
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Erőforrás fejléc megjegyzés hozzáadása nem lehetséges a(z) %s\"%s\" erőforrás fájlhoz.%sTalán szintaktikai hiba."

#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, object-pascal-format
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "A T%s:FORMDATA erőforrás nem adható hozzá a(z) %s\"%s\" erőforrás fájlhoz.%sTalán szintaktikai hiba."

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
#, object-pascal-format
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr "Nem lehet hozzáadni a(z) %s függőséget, mert a(z) %s csomag már függ ettől: %s"

#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
#, object-pascal-format
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr "Nem lehet hozzáadni a(z) %s függőséget, mert ez körkörös függőséget okozna. Függőség: %s"

#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
#, object-pascal-format
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Nem lehetséges a(z) %s hozzáadása a projekthez, mert már van egy ilyen nevű unit a projektben."

#: lazarusidestrconsts.lisunabletobackupfileto
#, object-pascal-format
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Nem készíthető biztonsági mentés erről: \"%s\" ide: \"%s\"!"

#: lazarusidestrconsts.lisunabletochangeclassofto
#, object-pascal-format
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sA(z) %s osztálya nem módosítható erre: %s"

#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
#, object-pascal-format
msgid "Unable to change project scaled in source.%s%s"
msgstr "Nem változtatható meg a projekt méretezése a forrásban.%s%s"

#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
#, object-pascal-format
msgid "Unable to change project title in source.%s%s"
msgstr "Nem változtatható meg a projekt címe a forrásban.%s%s"

#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Cél könyvtár tisztítása nem lehetséges"

#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, object-pascal-format
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "A(z) \"%s\" nem tisztítható.%sEllenőrizze a jogosultságokat!"

#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
#, object-pascal-format
msgid "Unable to convert component text into binary format:%s%s"
msgstr "A komponens szövegének átalakítása bináris formátumra nem lehetséges:%s%s"

#: lazarusidestrconsts.lisunabletoconvertfileerror
#, object-pascal-format
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "A fájl nem alakítható át: \"%s\"%sHiba: %s"

#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, object-pascal-format
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "A fájl szövegadata nem alakítható át bináris adatfolyammá:%s\"%s\"%s(%s)"

#: lazarusidestrconsts.lisunabletoconverttoencoding
#, object-pascal-format
msgid "Unable to convert to encoding \"%s\""
msgstr "Nem lehet átalakítani \"%s\" kódolásra"

#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file because there is already a directory with this name."
msgstr "Nem hozható létre az új fájl, mert már létezik egy könyvtár ezzel a névvel."

#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Átmeneti .lfm puffer létrehozása nem lehetséges."

#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, object-pascal-format
msgid "Unable to delete ambiguous file \"%s\""
msgstr "A megtévesztő fájl nem törölhető: \"%s\""

#: lazarusidestrconsts.lisunabletoexecute
#, object-pascal-format
msgid "unable to execute: %s"
msgstr "nem futtatható: %s"

#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Nem található ResourceString szakasz ebben, vagy bármelyik használt unit-ban."

#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, object-pascal-format
msgid "Unable to find a valid classname in \"%s\""
msgstr "Nem található érvényes osztálynév ebben: \"%s\""

#: lazarusidestrconsts.lisunabletofindfile
#, object-pascal-format
msgid "Unable to find file \"%s\"."
msgstr "A fájl nem található: \"%s\"."

#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, object-pascal-format
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "A(z) \"%s\" fájl nem található.%sHa az Ön projektjéhez tartozik, ellenőrizze a keresési útvonalat:%sProjekt -> Fordító beállításai -> Keresési útvonalak -> Egyéb unit fájlok! Ha egy csomaghoz tartozik, ellenőrizze a csomag fordítóbeállításait! Ha a Lazarus-hoz tartozik hajtson végre tiszta fordítást! Ha az FPC-hez tartozik ellenőrizze az fpc.cfg fájlt! Ha bizonytalan, ellenőrizze itt: Projekt ->  Projekt beállításai -> Teszt"

#: lazarusidestrconsts.lisunabletofindinlfmstream
#, object-pascal-format
msgid "Unable to find %s in LFM Stream."
msgstr "%s nem található az LFM folyamban."

#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "A metódus nem található."

#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, object-pascal-format
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "Nem található pascal unit (.pas, .pp) az .lfm fájlhoz: %s\"%s\""

#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
#, object-pascal-format
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "Nem található a komponensosztály: \"%s\".%sNem lett regisztrálva a RegisterClass által és nem található lfm fájl sem.%sA következő unit igényli:%s%s"

#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "A szerkesztőben történt változások begyűjtése nem lehetséges."

#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "A tervező forrásának megszerzése nem lehetséges."

#: lazarusidestrconsts.lisunabletoloadfile2
#, object-pascal-format
msgid "unable to load file %s: %s"
msgstr "Nem tölthető be a fájl %s: %s"

#: lazarusidestrconsts.lisunabletoloadpackage
#, object-pascal-format
msgid "Unable to load package \"%s\""
msgstr "A csomag nem tölthető be: \"%s\""

#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, object-pascal-format
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "A(z) \"%s\" komponens osztály betöltése nem lehetséges, mert saját magától függ."

#: lazarusidestrconsts.lisunabletoopen
#, object-pascal-format
msgid "Unable to open \"%s\""
msgstr "Nem nyitható meg: \"%s\""

#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Ős komponens megnyitása nem lehetséges"

#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
#, object-pascal-format
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "A tervező megnyitása nem lehetséges.%sA(z) %s osztály nem olyan szerkeszthető osztálytól származik, mint a TForm vagy TDataModule."

#: lazarusidestrconsts.lisunabletoread
#, object-pascal-format
msgid "Unable to read %s"
msgstr "A(z) %s olvasása nem lehetséges"

#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "Nem olvasható a folyamat kilépési állapota (ExitStatus)"

#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, object-pascal-format
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Nem törölhető a régi biztonsági mentés fájl: \"%s\"!"

#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
#, object-pascal-format
msgid "Unable to remove project scaled from source.%s%s"
msgstr "Nem lehet eltávolítani a projekt méretezését a forrásból.%s%s"

#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
#, object-pascal-format
msgid "Unable to remove project title from source.%s%s"
msgstr "Nem lehet eltávolítani a projekt címét a forrásból.%s%s"

#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, object-pascal-format
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "A megtévesztő fájl nem nevezhető át erről: \"%s\"%serre: \"%s\""

#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Nem nevezhető át a form a forrásban."

#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Metódus átnevezése nem lehetséges. Javítsa az üzenet ablakban található hibát!"

#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Változó átnevezése a forrásban nem lehetséges."

#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Futtatás nem lehetséges"

#: lazarusidestrconsts.lisunabletorun2
#, object-pascal-format
msgid "Unable to run \"%s\""
msgstr "Futtatás nem lehetséges: \"%s\""

#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "AnchorSide vezérlő beállítása nem lehetséges"

#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "A metódus nem jeleníthető meg."

#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "A kijelölt elemek adatfolyammá alakítása nem lehetséges"

#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "A kijelölt elemek adatfolyammá alakítása nem lehetséges."

#: lazarusidestrconsts.lisunabletostreamt
#, object-pascal-format
msgid "Unable to stream %s:T%s."
msgstr "A(z) %s adatfolyammá alakítása nem lehetséges:T%s."

#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
#, object-pascal-format
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "A(z) %s:T%s bináris komponens adatfolyamának szövegre alakítása nem lehetséges."

#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "A CreateForm állomány frissítése nem lehetséges a projekt forrásban"

#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Kijelölések megszüntetése"

#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Visszavonás"

#: lazarusidestrconsts.lisuninstall
#, object-pascal-format
msgid "Uninstall %s"
msgstr "%s eltávolítása"

#: lazarusidestrconsts.lisuninstallfail
msgid "Uninstall failed"
msgstr ""

#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Az eltvolítás nem lehetséges"

#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Kijelölés eltávolítása"

#: lazarusidestrconsts.lisuninstallthemtoo
msgid "Uninstall them too"
msgstr ""

#: lazarusidestrconsts.lisunithaschangedsave
#, object-pascal-format
msgid "Unit \"%s\" has changed. Save?"
msgstr "A(z) \"%s\" unit megváltozott. Mentés?"

#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "A unit-azonosító létezik"

#: lazarusidestrconsts.lisunitinpackage
#, object-pascal-format
msgid "%s unit %s in package %s"
msgstr "%s unit %s a(z) %s csomagban"

#: lazarusidestrconsts.lisunitmustsavebeforeinherit
#, object-pascal-format
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
msgstr ""

#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "A unit-név már szerepel a projektben"

#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Unit-név kezdete ..."

#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Unit-név tartalmazza ..."

#: lazarusidestrconsts.lisunitnotfound
#, object-pascal-format
msgid "unit %s not found"
msgstr "a(z) %s unit nem található"

#: lazarusidestrconsts.lisunitnotfoundatnewposition
#, object-pascal-format
msgid "unit %s not found at new position \"%s\""
msgstr "a %s unit nem található az új helyen: \"%s\""

#: lazarusidestrconsts.lisunitnotfoundinfile
#, object-pascal-format
msgid "A unit not found in file %s"
msgstr ""

#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Unit kimeneti könyvtár"

#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "unit útvonal"

#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Unit útvonalak"

#: lazarusidestrconsts.lisunitrequirespackage
#, object-pascal-format
msgid "unit %s requires package %s"
msgstr "a(z) %s unit igényli a(z) %s csomagot"

#: lazarusidestrconsts.lisunitsnotfoundinfile
#, object-pascal-format
msgid "Units not found in file %s"
msgstr ""

#: lazarusidestrconsts.lisunusedunitsof
#, object-pascal-format
msgid "Unused units of %s"
msgstr "%s nem használt unit-jai"

#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Szokásos fordító-fájlnév. Általában így kezdődik: fpc, ppc vagy ppcross"

#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr "A pas2js fordító fájlneve nem szokványos. A név eleje általában pas2js."

#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Fel"

#: lazarusidestrconsts.lisupdateapplicationcreateform
msgid "Update Application.CreateForm statements in main unit"
msgstr "Application.CreateForm állományok frissítése a fő unit-ban"

#: lazarusidestrconsts.lisupdateapplicationscaledstatement
msgid "Update Application.Scaled statement in main unit"
msgstr "Application.Scaled állományok frissítése a fő unit-ban"

#: lazarusidestrconsts.lisupdateapplicationtitlestatement
msgid "Update Application.Title statement in main unit"
msgstr "Application.Title állományok frissítése a fő unit-ban"

#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Infó frissítése"

#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Csak betűméret változása esetén frissítse az eljárás többi begépelését"

#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Frissíti a hivatkozásokat?"

#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Frissítés"

#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Beállítások frissítése"

#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "nagybetűs karakterlánc"

#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter."
msgstr "Paraméterként megadott nagybetűs karakterlánc."

#: lazarusidestrconsts.lisurlonwikithebaseurlis
#, object-pascal-format
msgid "URL on wiki (the base url is %s)"
msgstr "URL a wiki-n (az alap url: %s)"

#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Használati útmutató (-h kapcsoló)"

#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr "Használat"

#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "ANSI karakterláncok használata"

#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Jelölőnégyzet a Boolean értékekhez"

#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Megjegyzések használata az egyéni beállításoknál"

#: lazarusidestrconsts.lisusedby
#, object-pascal-format
msgid " used by %s"
msgstr ", melyet a(z) %s használ"

#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Tervezési csomagok használata"

#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr "Automatikusan létrehozott form-okhoz használatos."

#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr "Szűrő használata további fájlok beemeléséhez"

#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Azonosító használata"

#: lazarusidestrconsts.lisuseidentifierinat
#, object-pascal-format
msgid "Use identifier %s in %s at %s"
msgstr "A(z) %s azonosító használata ebben: %s, itt: %s"

#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Alkalmazás futtatása"

#: lazarusidestrconsts.lisusepackageinpackage
#, object-pascal-format
msgid "Use package %s in package %s"
msgstr "A(z) %s csomag használata a(z) %s csomagban"

#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "A csomag használata csomagban"

#: lazarusidestrconsts.lisusepackageinproject
#, object-pascal-format
msgid "Use package %s in project"
msgstr "A(z) %s csomag használata projektben"

#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Csomag használata projektben"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
#, object-pascal-format
msgid "Add to list \"%s\""
msgstr "Hozzáadás a listához: \"%s\""

#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Felhasználói szövegkiemelés"

#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
#, object-pascal-format
msgid "Remove from list \"%s\""
msgstr "Eltávolítás a listából: %s"

#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
#, object-pascal-format
msgid "Toggle on list \"%s\""
msgstr "Váltás a listán: \"%s\""

#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Felhasználó saját könyvtára"

#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Unit hozzáadása a uses szakaszhoz"

#: lazarusidestrconsts.lisuseunitinunit
#, object-pascal-format
msgid "Use unit %s in unit %s"
msgstr "%s unit használata %s unit-ban"

#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 BOM-mal"

#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Érték"

#: lazarusidestrconsts.lisvalue2
#, object-pascal-format
msgid "Value%s"
msgstr "Érték%s"

#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Érték:"

#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Értékek"

#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr "Az alapértelmezettről megváltoztatott értékek az .lfm fájlban lesznek tárolva és másképp jelennek meg az Objektum felügyelőben."

#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Változó"

#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr "Egyéb"

#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Metódushívások ellenőrzése"

#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Változat"

#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Eltérő változat"

#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "Függőleges"

#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Változat információ másolása a vágólapra"

#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "Nagyon részletes"

#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Forrás megjelenítése (.lfm)"

#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Figyelmeztetés:"

#: lazarusidestrconsts.liswarnings
#, object-pascal-format
msgid ", Warnings: %s"
msgstr ", Figyelmeztetések: %s"

#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
#, object-pascal-format
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sFigyelem! Ez a fő unit. A új fő unit  ez lesz: %s.pas."

#: lazarusidestrconsts.liswelcometolazaruside
#, object-pascal-format
msgid "Welcome to Lazarus IDE %s"
msgstr "Üdvözli a Lazarus IDE %s"

#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
#, object-pascal-format
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Üdvözöljük! Ez a Lazarus %s%sLétezik már egy beállítás a(z) %s változathoz itt: %s%s"

#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Amit építeni kell"

#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Amikor egy unit átnevezésre kerül frissítse a hivatkozásokat"

#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr "Amikor engedélyezve van az aktuális beállítások a sablonba lesznek mentve, amely új projektek létrehozásakor használatos"

#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr "Ha csak egy lehetséges kiegészítés van az azonnal be lesz illesztve, a kiegészítés doboz megjelenítése nélkül"

#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "Amikor a beszúrási jel mozog a forráskódszerkesztőben, az aktuális csomópont jelenjen meg a Kódböngészőben"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr "Az Ablak menü a tervezett form nevét jeleníti meg a címe helyett"

#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr "Különösen hasznos ha a cím üresen maradt."

#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr "Az ablak legfelül marad"

#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", az include fájlokkal "

#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Megfelelő fordító nélkül a kód böngészése és a fordítás csalódást fog okozni."

#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr "Megfelelő hibakereső nélkül a hibakeresés csalódást fog okozni."

#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "A megfelelő Lazarus könyvtár nélkül rengeteg figyelmeztetés jelenik majd meg."

#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr "Megfelelő \"make\" program nélkül az IDE fordítása nem lehetséges."

#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "A megfelelő FPC forráskódok nélkül a kód böngészése és kiegészítése erősen korlátozott lesz. "

#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "Szükséges csomagokkal"

#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Beszúrási jelnél lévő kifejezés az aktuális szerkesztőben"

#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Munkakönyvtár az építéshez"

#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Munkakönyvtár a futtatáshoz"

#: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters
msgid "Write config instead of command line parameters"
msgstr ""

#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr "A csomaginformációs fájl írása nem sikerült."

#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr "A projektinformációs fájl írása nem sikerült."

#: lazarusidestrconsts.liswritewhatpackagefilesares
msgid "Write what package files are searched and found."
msgstr ""

#: lazarusidestrconsts.liswrongversionin
#, object-pascal-format
msgid "wrong version in %s: %s"
msgstr "a(z) %s rossz változatot tartalmaz: %s"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Ez letiltható az egyes form-ok esetén a Csomagszerkesztőben"

#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Ez letiltható az egyes form-ok esetén a helyi menüben vagy a Projektfelügyelőben"

#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr "Az FPC és az FPC forráskódjai letölthetők innen: http://sourceforge.net/projects/lazarus/?source=directory"

#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "A Lazarus nem építhető fordítás vagy hibakeresés közben."

#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr "Fordítás közben nem változtatható meg az építési mód."

#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr "Az elemek egyszerűen kiválaszthatók az aláhúzott betűk lenyomásával"

#: lazarusidestrconsts.lis_all_
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Minden>"

#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Forráskódszerkesztő"

#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr "Kijelölt törlése"

#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr "érvénytelen"

#: lazarusidestrconsts.lrspldlpkfileinvalid
#, object-pascal-format
msgid "lpk file invalid (%s)"
msgstr "Érvénytelen lpk fájl (%s)"

#: lazarusidestrconsts.lrspldlpkfilevalid
#, object-pascal-format
msgid "lpk file valid (%s)"
msgstr "Érvényes lpk fájl (%s)"

#: lazarusidestrconsts.lrspldunabletodeletefile
#, object-pascal-format
msgid "Unable to delete file \"%s\""
msgstr "Nem törölhető a fájl: \"%s\""

#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr "érvényes"

#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr "lpl fájlok ellenőrzése"

#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
msgid "Add horizontal spacing between columns"
msgstr "Vízszintes távolság növelése az oszlopok között"

#: lazarusidestrconsts.lvlgraphaddverticalspacingar
msgid "Add vertical spacing around nodes"
msgstr "Függőleges távolság növelése a csomópontok között"

#: lazarusidestrconsts.lvlgraphextraspacing
msgid "Extra spacing (x/y)"
msgstr "Extra térköz (x/y)"

#: lazarusidestrconsts.lvlgraphnamesabovenode
msgid "Names above node"
msgstr "Nevek a csomópontok felett"

#: lazarusidestrconsts.lvlgraphoptabsolutelimi
msgid "Absolute limit for height of levels"
msgstr "Abszolút magasságkorlát a szintek számára"

#: lazarusidestrconsts.lvlgraphoptcrossings
msgid "Crossings"
msgstr "Kereszteződések"

#: lazarusidestrconsts.lvlgraphoptedgelen
msgid "Edge len"
msgstr "Élek hossza"

#: lazarusidestrconsts.lvlgraphoptedges
msgid "Edges"
msgstr "Élek"

#: lazarusidestrconsts.lvlgraphoptinfo
msgid "Info"
msgstr "Infó"

#: lazarusidestrconsts.lvlgraphoptlevels
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
msgid "Levels"
msgstr "Szintek"

#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
msgid "Limit height of Levels"
msgstr "Szintek magasságának korlátozása"

#: lazarusidestrconsts.lvlgraphoptlimitrelativ
#, object-pascal-format
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
msgstr "A korlát a csomópontok szintenkénti számától függ.%0sKorlat = min(3, val*sqrt(CsomopontokSzama))"

#: lazarusidestrconsts.lvlgraphoptsplitpoints
msgid "Splitpoints"
msgstr "Elágazások"

#: lazarusidestrconsts.lvlgraphreducebackedges
msgid "Reduce backedges"
msgstr "Kevesebb visszamutató él"

#: lazarusidestrconsts.lvlgraphshapecalculatelay
msgid "Calculate layout from high-edge"
msgstr "Elrendezés számítása a legfelső éltől"

#: lazarusidestrconsts.lvlgraphshapecurved
msgid "Curved"
msgstr "Ívelt"

#: lazarusidestrconsts.lvlgraphshapeedgesshape
msgid "Edges shape"
msgstr "Élek alakja"

#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
msgid "Edges split mode"
msgstr "Élek elágazásának módja"

#: lazarusidestrconsts.lvlgraphshapeminimizeedge
msgid "Minimize edges len"
msgstr "Élek hosszának minimalizálása"

#: lazarusidestrconsts.lvlgraphshapenodes
msgid "Nodes"
msgstr "Csomópontok"

#: lazarusidestrconsts.lvlgraphshapestraight
msgid "Straight"
msgstr "Egyenes"

#: lazarusidestrconsts.lvlgraphsplitmergeathighe
msgid "Merge at highest"
msgstr "Egyesítés a legfelsőnél"

#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
msgid "Merge at source"
msgstr "Egyesítés a forrásnál"

#: lazarusidestrconsts.lvlgraphsplitmergeattarge
msgid "Merge at target"
msgstr "Egyesítés a célnál"

#: lazarusidestrconsts.lvlgraphsplitnone
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
msgid "None"
msgstr "Semmi"

#: lazarusidestrconsts.lvlgraphsplitseparate
msgid "Separate"
msgstr "Külön"

#: lazarusidestrconsts.lvlgraphstraightengraph
msgid "Straighten graph"
msgstr "Síkba rajzolható gráf"

#: lazarusidestrconsts.optdispgutterchanges
msgid "Changes"
msgstr ""

#: lazarusidestrconsts.optdispgutterfolding
msgid "Folding"
msgstr ""

#: lazarusidestrconsts.optdispguttermarks
msgid "Marks"
msgstr ""

#: lazarusidestrconsts.optdispgutternocurrentlinecolor
msgid "No current line color"
msgstr ""

#: lazarusidestrconsts.optdispgutterseparator
msgid "Separator"
msgstr ""

#: lazarusidestrconsts.optdispgutterusecurrentlinecolor
msgid "Use current line color"
msgstr ""

#: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor
msgid "Use current line number color"
msgstr ""

#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Csomag unit hozzáadása a uses szakaszhoz"

#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Hozzáadás negáltan"

#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr "Új kifejezés hozzáadása"

#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Jellemzők"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Építésszám automatikus növelése"

#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr "A projekt minden fordításakor eggyel növelve lesz."

#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "Építés:"

#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Karakterkészlet:"

#: lazarusidestrconsts.rscloseall
msgid "Close all pages"
msgstr "Összes lap bezárása"

#: lazarusidestrconsts.rsclosecurrentpage
#, fuzzy
#| msgid "Close current page"
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
msgstr "Aktuális lap bezárása"

#: lazarusidestrconsts.rscloseleft
msgid "Close page(s) on the left"
msgstr "Lapok bezárása a bal oldalon"

#: lazarusidestrconsts.rscloseothers
msgid "Close other page(s)"
msgstr "Többi lap bezárása"

#: lazarusidestrconsts.rscloseright
msgid "Close page(s) on the right"
msgstr "Lapok bezárása a jobb oldalon"

#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Feltételes definíciók"

#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Új definíció létrehozása"

#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "i18n engedélyezése"

#: lazarusidestrconsts.rsfilterthelistwithstring
#, fuzzy
#| msgid "Filter the lines in list with a string"
msgid "Filter the lines in list with a string (Ctrl+F)"
msgstr "A lista sorainak szűrése egy karakterlánc alapján"

#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found but not listed here: "
msgstr "Megtalálható, de itt nincs felsorolva:"

#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr "Kizárva"

#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr "PO fájlok frissítésének kényszerítése a következő építéskor"

#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr "Azonosítók:"

#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "i18n beállítások"

#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr "Eredeti szövegek:"

#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr "A változatinformáció tárolva lesz a programban ha a formátuma támogatja azt."

#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Változat adatok tárolása a programban"

#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Nyelvi beállítások"

#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Nyelv kiválasztása:"

#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "Főváltozat:"

#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "Alváltozat:"

#: lazarusidestrconsts.rsnewsearchwithsamecriteria
msgid "New search with same criteria (Ctrl+N)"
msgstr ""

#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Egyéb információk"

#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "PO kimenti könyvtár:"

#: lazarusidestrconsts.rsrefreshthesearch
msgid "Refresh the search (F5)"
msgstr ""

#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Erőforrás"

#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "Minden erőforrás törlése?"

#: lazarusidestrconsts.rsresourcefilename
msgctxt "lazarusidestrconsts.rsresourcefilename"
msgid "File name"
msgstr "Fájl neve"

#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Típus"

#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "Revízió:"

#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Minden öröklött bejegyzés kijelölése"

#: lazarusidestrconsts.rsshowabspath
msgid "Absolute path"
msgstr ""

#: lazarusidestrconsts.rsshowfilename
#, fuzzy
msgctxt "lazarusidestrconsts.rsshowfilename"
msgid "File name"
msgstr "Fájl neve"

#: lazarusidestrconsts.rsshowpathmode
msgid "Path display mode (Ctrl+P)"
msgstr ""

#: lazarusidestrconsts.rsshowrelpath
msgid "Relative path"
msgstr ""

#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Változatszámozás"

#: lazarusidestrconsts.showoptions
msgid "Show options"
msgstr "Beállítások megjelenítése"

#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Súgó menü parancsai"

#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Utasító parancsok"

#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "CodeTools parancsok"

#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Szöveg oszlopkijelölési parancsok"

#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Beszúrási jelet mozgató parancsok"

#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Szöveg szerkesztési parancsok"

#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Fájl menü parancsai"

#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Szöveg összecsukási parancsok"

#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Makrók"

#: lazarusidestrconsts.srkmcatmarker
msgid "Text bookmark commands"
msgstr "Könyvjelző parancsok"

#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr "Többszörös beszúrási jel parancsai"

#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Csomag menü parancsai"

#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Projekt menü parancsai"

#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Futtatás menü parancsai"

#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Szöveg keresés és csere parancsai"

#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Szöveg kijelölés parancsai"

#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Forráskódszerkesztő parancsai"

#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Egyidejű szerkesztés"

#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Egyidejű szerkesztés (beszúrási jel a cellán kívül)"

#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Egyidejű szerkesztés (kijelölés közben)"

#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Sablon szerkesztése"

#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Sablon szerkesztése (beszúrási jel a cellán kívül)"

#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Eszközök menü parancsai"

#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Nézet menü parancsai"

#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Parancs:"

#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Ütközés"

#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "építés megszakítása"

#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Absztrakt metódusok ..."

#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "cím-töréspont hozzáadása"

#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "forráskód-töréspont hozzáadása"

#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "figyelési pont hozzáadása"

#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Ugrási pont hozzáadása"

#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "Figyelő hozzáadása"

#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Csatolás programhoz "

#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Kódsablon kiegészítése"

#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Blokk másolása"

#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Blokk törlése"

#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Ugrás blokk kezdetéhez"

#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Ugrás blokk végéhez"

#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Blokk elrejtése"

#: lazarusidestrconsts.srkmecblockindent
#, fuzzy
#| msgid "Indent block"
msgid "Indent line/block"
msgstr "Blokk behúzás növelése"

#: lazarusidestrconsts.srkmecblockindentmove
msgid "Indent line/block (move columns)"
msgstr ""

#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Blokk mozgatása"

#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Blokk kezdetének beállítása"

#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Blokk végének beállítása"

#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Blokk megjelenítése"

#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Blokk átkapcsolása"

#: lazarusidestrconsts.srkmecblockunindent
#, fuzzy
#| msgid "Unindent block"
msgid "Unindent line/block"
msgstr "Blokk behúzás csökkentése"

#: lazarusidestrconsts.srkmecblockunindentmove
msgid "Unindent line/block (move columns)"
msgstr ""

#: lazarusidestrconsts.srkmecbreakpointproperties
msgid "show breakpoint properties"
msgstr ""

#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "program/projekt építése"

#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "fájl építése"

#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Lazarus építése"

#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr "építés több módban"

#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Char"

#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr "tisztítás és építés"

#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Teljes szöveg törlése"

#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Minden könyvjelző törlése"

#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "E fájl könyvjelzőinek törlése"

#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Oszlopkijelölés lefelé"

#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Oszlopkijelölés a legvégéig"

#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Oszlopkijelölés a legelejéig"

#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Oszlopkijelölés balra"

#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Oszlopkijelölés a sor végéig"

#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Oszlopkijelölés a sor elejéig"

#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Oszlopkijelölés a szöveg elejéig a sorban"

#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Oszlopkijelölés az oldal aljáig"

#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Oszlopkijelölés egy oldalnyit lefelé"

#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Oszlopkijelölés az oldal tetejéig"

#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Oszlopkijelölés egy oldalnyit felfelé"

#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Oszlopkijelölés jobbra"

#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Oszlopkijelölés felfelé"

#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Oszlopkijelölés a szó bal oldali részére"

#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Oszlopkijelölés a szó jobb oldali részére "

#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Oszlop kijelölési mód"

#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "program/projekt fordítása"

#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "építés fájl konfigurálása"

#: lazarusidestrconsts.srkmeccopy
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Másolás"

#: lazarusidestrconsts.srkmeccopyadd
msgid "Copy (Add to Clipboard)"
msgstr "Másolás (Hozzáadás a vágólaphoz)"

#: lazarusidestrconsts.srkmeccopyaddcurrentline
msgid "Copy current line (Add to Clipboard)"
msgstr "Aktuális sor másolása (Hozzáadás a vágólaphoz)"

#: lazarusidestrconsts.srkmeccopycurrentline
msgid "Copy current line"
msgstr "Aktuális sor másolása"

#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Szerkesztő új ablakba másolása"

#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Szerkesztő másolása a következő üres ablakba"

#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Szerkesztő másolása az előző üres ablakba"

#: lazarusidestrconsts.srkmeccut
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Kivágás"

#: lazarusidestrconsts.srkmeccutadd
msgid "Cut (Add to Clipboard)"
msgstr "Kivágás (Hozzáadás a vágólaphoz)"

#: lazarusidestrconsts.srkmeccutaddcurrentline
msgid "Cut current line (Add to Clipboard)"
msgstr "Aktuális sor kivágása (Hozzáadás a vágólaphoz)"

#: lazarusidestrconsts.srkmeccutcurrentline
msgid "Cut current line"
msgstr "Aktuális sor kivágása"

#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Törlés sor kezdetéig"

#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Karakter törlése a beszúrási jelnél"

#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Törlés a sor végéig"

#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Utolsó karakter törlése"

#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Törlés kifejezés kezdetéig"

#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Aktuális sor törlése"

#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Törlés kifejezés végéig"

#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Leválasztás programról"

#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Diff"

#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "Beszúrási jel mozgatása lefelé"

#: lazarusidestrconsts.srkmecduplicateline
msgid "Duplicate line (or lines in selection)"
msgstr "Sor (vagy kijelölt sorok) duplikálása"

#: lazarusidestrconsts.srkmecduplicateselection
msgid "Duplicate selection"
msgstr "Kijelölés megkettőzése"

#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Beszúrási jel mozgatása a legvégére"

#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Beszúrási jel mozgatása a legelejére"

#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Üres metódusok ..."

#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "IDE beállítások"

#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "kiértékelés/módosítás"

#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Áthelyezés eljárásba"

#: lazarusidestrconsts.srkmecexttool
#, object-pascal-format
msgid "External tool %d"
msgstr "Külső eszköz %d"

#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Külső eszközök beállításai"

#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Szöveg keresése"

#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Blokk másik végének megkeresése"

#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Blokk kezdetének megkeresése"

#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Deklaráció &keresése"

#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Azonosító hivatkozásainak megkeresése"

#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Keresés a fájlokban"

#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Következő keresése"

#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Következő előfordulás megkeresése"

#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr "Felülbírálások keresése"

#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr "Felülbírálások keresése ..."

#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Előző keresése"

#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Előző előfordulás megkeresése"

#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Eljárás definíció keresése"

#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr "Eljárás metódus keresése"

#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Összecsukás a beszúrási jelnél"

#: lazarusidestrconsts.srkmecfoldlevel
#, object-pascal-format
msgid "Fold to Level %d"
msgstr "Összecsukás a(z) %d. szinting"

#: lazarusidestrconsts.srkmecgotoeditor
#, object-pascal-format
msgid "Go to editor %d"
msgstr "Ugrás a(z) %d. szerkesztőre"

#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Ugrás a beemelt fájl include direktívájára"

#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Ugrás sorszámhoz"

#: lazarusidestrconsts.srkmecgotomarker
#, object-pascal-format
msgid "Go to bookmark %d"
msgstr "Ugrás a(z) %d. könyvjelzőhöz"

#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Ugrás XY-hoz"

#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Rosszul elhelyezett $IFDEF keresése"

#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr "Beszúrási jel mozgatása rész-szóval balra (pl. CamelCase)"

#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr "Beszúrási jel mozgatása rész-szóval jobbra (pl. CamelCase)"

#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"

#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "ChangeLog bejegyzés beszúrása"

#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Beszúrás karater táblából"

#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "CVS Szerző kulcsszó beszúrása"

#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "CVS Dátum kulcsszó beszúrása"

#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "CVS Fejléc kulcsszó beszúrása"

#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "CVS Azonosító kulcsszó beszúrása"

#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "CVS Napló kulcsszó beszúrása"

#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "CVS Név kulcsszó beszúrása"

#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "CVS Revízió kulcsszó beszúrása"

#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "CVS Forrás kulcsszó beszúrása"

#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Jelenlegi dátum és idő beszúrása"

#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Teljes fájlnév beszúrása"

#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "GPL megjegyzés beszúrása"

#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr "GPL megjegyzés beszúrása (lefordítva)"

#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "GUID beszúrása"

#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "LGPL megjegyzés beszúrása"

#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr "LGPL megjegyzés beszúrása (lefordítva)"

#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Sortörés, beszúrási jel helyben hagyása"

#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr "MIT megjegyzés beszúrása"

#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr "MIT megjegyzés beszúrása (lefordítva)"

#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Beszúrási mód"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Módosított LGPL megjegyzés beszúrása"

#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr "Módosított LGPL megjegyzés beszúrása (lefordítva)"

#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Jelenlegi felhasználó nevének beszúrása"

#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "vizsgálat"

#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Hozzárendelés megfordítása"

#: lazarusidestrconsts.srkmeckeymapleft
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Balra"

#: lazarusidestrconsts.srkmeckeymapright
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Jobbra"

#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "Beszúrási jel mozgatása balra"

#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Sortörés és a beszúrási jel elmozdítása"

#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Beszúrási jel mozgatása a sor végére"

#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Sor kijelölési mód"

#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Beszúrási jel mozgatása a sor elejére"

#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Beszúrási jel mozgatása a sor szövegének elejére"

#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Szerkesztő zárolása"

#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "ResourceString létrehozása"

#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Ugrás a zárójel ellendarabjára"

#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Lapfül mozgatása balra"

#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Lapfül mozgatása a bal szélre"

#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Szerkesztő áthelyezése új ablakba"

#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Szerkesztő áthelyezése a következő üres ablakba"

#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Szerkesztő áthelyezése az előző üres ablakba"

#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Lapfül mozgatása jobbra"

#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Lapfül mozgatása a jobb szélre"

#: lazarusidestrconsts.srkmecmovelinedown
msgid "Move line down"
msgstr "Sor mozgatása lefelé"

#: lazarusidestrconsts.srkmecmovelineup
msgid "Move line up"
msgstr "Sor mozgatása felfelé"

#: lazarusidestrconsts.srkmecmoveselectdown
msgid "Move selection down"
msgstr "Kijelölés mozgatása lefelé"

#: lazarusidestrconsts.srkmecmoveselectleft
msgid "Move selection left"
msgstr "Kijelölés mozgatása balra"

#: lazarusidestrconsts.srkmecmoveselectright
msgid "Move selection right"
msgstr "Kijelölés mozgatása jobbra"

#: lazarusidestrconsts.srkmecmoveselectup
msgid "Move selection up"
msgstr "Kijelölés mozgatása felfelé"

#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr "Beillesztés forráskóddal"

#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Következő könyvjelző"

#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Következő lapfülre ugrás"

#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr "Váltás az következő szerkesztőre az előzmények között"

#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Váltás a következő szerkesztőre ugyanezzel a forrással"

#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Váltás a következő ablakra"

#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Normál kijelölési mód"

#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "Beszúrási jelnél lévő fájl megnyitása"

#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Felülírási mód"

#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Beszúrási jel mozgatása az oldal aljára"

#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Beszúrási jel mozgatása egy oldallal lejjebb"

#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Beszúrási jel mozgatása egy oldallal balra"

#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Beszúrási jel mozgatása egy oldallal jobbra"

#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Beszúrási jel mozgatása az oldal tetejére"

#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Beszúrási jel mozgatása egy oldallal feljebb"

#: lazarusidestrconsts.srkmecpaste
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Beillesztés"

#: lazarusidestrconsts.srkmecpasteascolumns
msgid "Paste (as Columns)"
msgstr ""

#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "program szüneteltetése"

#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr "Az összes extra beszúrási jel eltávolítása"

#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr "A navigáló billentyűk eltávolítják az extra beszúrási jeleket"

#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr "A navigáló billentyűk mozgatják az extra beszúrási jeleket"

#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr "Extra beszúrási jel hozzáadása"

#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr "Extra beszúrási jel ki/be"

#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr "Extra beszúrási jel eltávolítása"

#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Előző könyvjelző"

#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Előző lapfülre ugrás"

#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr "Váltás az előző szerkesztőre az előzmények között"

#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Váltás az előző szerkesztőre ugyanezzel a forrással"

#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Váltás az előző ablakra"

#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "gyors fordítás, nincs összefűzés"

#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "töréspont eltávolítása"

#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Üres metódusok eltávolítása"

#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Nem használt unitok eltávolítása"

#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Azonosító átnevezése"

#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Szöveg cseréje"

#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Hiba jelentése"

#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "hibakereső visszaállítása"

#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "Beszúrási jel mozgatása jobbra"

#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "program futtatása"

#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "fájl futtatása"

#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "futtatási paraméterek"

#: lazarusidestrconsts.srkmecrunwithdebugging
msgid "run with debugging"
msgstr ""

#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr "futtatás hibakeresés nélkül"

#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Gördítés egy sorral lefelé"

#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Gördítés egy karakterrel balra"

#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Gördítés egy karakterrel jobbra"

#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Gördítés egy sorral felfelé"

#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Kijelölés lefelé"

#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Minden kijelölése"

#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Tabok cseréje szóközökre a kijelölésben"

#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Kijelölés a legvégéig"

#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Kijelölés a legelejéig"

#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Pozíció kijelölése"

#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr "Rész-szó kijelölése balra (pl. CamelCase)"

#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr "Rész-szó kijelölése jobbra (pl. CamelCase)"

#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr "Kijelölés balra"

#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Kijelölés a sor végéig"

#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Kijelölés a sor elejéig"

#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Kijelölés a szöveg elejéig a sorban"

#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Kijelölés az oldal aljáig"

#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Kijelölés egy oldalhosszot lefelé"

#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Kijelölés egy oldalhosszot balra"

#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Kijelölés egy oldalhosszot jobbra"

#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Kijelölés az oldal tetejéig"

#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Kijelölés egy oldalhosszot felfelé"

#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr "Kijelölés jobbra"

#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr "Szó okos kijelölése balra (szó elejéig/végéig)"

#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr "Szó okos kijelölése jobbra (szó elejéig/végéig)"

#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr "Ragadós kijelölés kezdése"

#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr "Ragadós kijelölés kezdése (Oszlop)"

#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr "Ragadós kijelölés kezdése (Sor)"

#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr "Ragadós kijelölés befejezése"

#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Kijelölés felfelé"

#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Kijelölés szó végéig balra"

#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Kijelölés szó végéig jobbra"

#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Szó kijelölése balra"

#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Szó kijelölése jobbra"

#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Üres könyvjelző beállítása"

#: lazarusidestrconsts.srkmecsetmarker
#, object-pascal-format
msgid "Set bookmark %d"
msgstr "%d. könyvjelző beállítása"

#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Shift Tab"

#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Absztrakt metódusok megjelenítése"

#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr "Lehetséges kód megjelenítése"

#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "Végrehajtási pont megjelenítése"

#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr "Beszúrási jel okos mozgatása balra (szó elejéig/végéig)"

#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr "Beszúrási jel okos mozgatása jobbra (szó elejéig/végéig)"

#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "program leállítása"

#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Makró végrehajtása"

#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Makró rögzítése"

#: lazarusidestrconsts.srkmecsynpsyncroedaddcell
msgid "Add Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase
msgid "Add Cell (case-sensitive)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx
msgid "Add Cell (context-sensitive)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase
msgid "Add Cell (context & case-sensitive)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Utolsó pozícióra ugrás a cellában"

#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Első pozícióra ugrás a cellában"

#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Cella kijelölése"

#: lazarusidestrconsts.srkmecsynpsyncroeddelcell
msgid "Remove current Cell"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Kilépés"

#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft
msgid "Grow cell on the left"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright
msgid "Grow cell on the right"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Következő cella"

#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Következő cella (kijelöléssel)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Következő cella (csak elsők)"

#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Következő cella (kijelöléssel / csak elsők)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Előző cella"

#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Előző cella (kijelöléssel)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Előző cella (csak elsők)"

#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Előző cella (kijelöléssel / csak elsők)"

#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft
msgid "Shrink cell on the left"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright
msgid "Shrink cell on the right"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Egyidejű szerkesztés indítása"

#: lazarusidestrconsts.srkmecsynpsyncroedstartcase
msgid "Start Syncro edit (case-sensitive)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedstartctx
msgid "Start Syncro edit (context-sensitive)"
msgstr ""

#: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase
msgid "Start Syncro edit (context & case-sensitive)"
msgstr ""

#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Utolsó pozícióra ugrás a cellában"

#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Első pozícióra ugrás a cellában"

#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Cella kijelölése"

#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Kilépés"

#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Befejezés"

#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Következő cella"

#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Következő cella (forgatás)"

#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Következő cella (kijelöléssel)"

#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Következő cella (forgatás / kijelöléssel)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Következő cella (csak elsők)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr "Következő cella (forgatás / csak elsők)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Következő cella (kijelöléssel / csak elsők)"

#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr "Következő cella (forgatás / kijelöléssel / csak elsők)"

#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Előző cella"

#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Előző cella (kijelöléssel)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Előző cella (csak elsők)"

#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Előző cella (kijelöléssel / csak elsők)"

#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Szintaxis ellenőrzése"

#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Assembler megjelenítése"

#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "töréspont ki-/bekapcsolása"

#: lazarusidestrconsts.srkmectogglebreakpointenabled
msgid "enable/disable breakpoint"
msgstr "Töréspont be- és kikapcsolása"

#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Töréspontok megjelenítése"

#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Hívási verem megjelenítése"

#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Kódtallózó megjelenítése"

#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Kódböngésző megjelenítése"

#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Komponens paletta megjelenítése"

#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Hibakereső kimenetének megjelenítése"

#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Váltás a form és a unit között"

#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Dokumentációszerkesztő megjelenítése"

#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "IDE gyorsgombok megjelenítése"

#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Helyi változók megjelenítése"

#: lazarusidestrconsts.srkmectogglemarker
#, object-pascal-format
msgid "Toggle bookmark %d"
msgstr "%d. könyvjelző ki-/bekapcsolása"

#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Aktuális szó kiemelésének ki-/bekapcsolása"

#: lazarusidestrconsts.srkmectogglememviewer
msgctxt "lazarusidestrconsts.srkmectogglememviewer"
msgid "View Mem viewer"
msgstr ""

#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Üzenetek megjelenítése"

#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Üzemmód váltása"

#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Objektum-felügyelő megjelenítése"

#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Regiszterek megjelenítése"

#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Korlátozás-böngésző megjelenítése"

#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Keresési eredmények megjelenítése"

#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Forráskódszerkesztő megjelenítése"

#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Figyelők megjelenítése"

#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Minden blokk kinyitása"

#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Kinyitás a beszúrási jelnél"

#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "ismeretlen szerkesztő parancs"

#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Nem használt unitok ..."

#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "Beszúrási jel mozgatása felfelé"

#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Horgonyszerkesztő megjelenítése"

#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Komponensek megjelenítése"

#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Szerkesztő makrók megjelenítése"

#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Formok megjelenítése"

#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Előzmények megjelenítése"

#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr "Konzol be- és kimenetének megjelenítése"

#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Tab sorrend megjelenítése"

#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Szálak megjelenítése"

#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Unit függőségek megjelenítése"

#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Unit információ megjelenítése"

#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Unit-ok megjelenítése"

#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Kifejezés kiegészítés"

#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "Beszúrási jel mozgatása szó végére balra"

#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "Beszúrási jel mozgatása szó végére jobbra"

#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Beszúrási jel mozgatása szavanként balra"

#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Beszúrási jel mozgatása szavanként jobbra"

#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr "Nagyítás"

#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr "Kicsinyítés"

#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Parancs billentyűinek szerkesztése"

#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr "Folytatás a következő egérfelengedés művelettel"

#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr "Megjegyzések összecsukása"

#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Megjegyzések összecsukása a kijelölésben"

#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr "Inaktív Ifdef összecsukása"

#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr "Inaktív Ifdef összecsukása (kivéve a kevert állapotúak)"

#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr "Inaktív Ifdef összecsukása a kijelölésben"

#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr "Inaktív Ifdef összecsukása a kijelölésben (kivéve a kevert állapotúak)"

#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Megjegyzések elrejtése"

#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Megjegyzések elrejtése a kijelölésben"

#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr "Az egérlenyomás művelettel egyező gomb"

#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr "Az egérlenyomás művelettel egyező sor"

#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr "Az egérlenyomás művelettel egyező módosító"

#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr "Az egérlenyomás művelettel egyező hely"

#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr "Összes egérlenyomás művelet keresése"

#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr "Aktív Ifdef kinyitása"

#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr "Aktív Ifdef kinyitása a kijelölésben"

#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Minden blokk kinyitása"

#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr "Minden Ifdef kinyitása"

#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr "Minden Ifdef kinyitása a kijelölésben"

#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr "Minden kinyitása a kijelölésben"

#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr "Megjegyzések kinyitása"

#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr "Megjegyzések kinytása a kijelölésben"

#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr "Inaktív Ifdef kinyitása"

#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr "Inaktív Ifdef kinyitása a kijelölésben"

#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "A fájl csak olvasható"

#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "A fájl \""

#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" nem írható."

#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Zárolva"

#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Rögzítés"

#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Rögz. szünet"

#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Figyelő hozzáadása a beszúrási jelnél"

#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "Figyelési pont hozzáadása a beszúrási jelnél"

#: lazarusidestrconsts.uembookmarknset
#, object-pascal-format
msgid "Bookmark &%s: %s"
msgstr "&%s. könyvjelző: %s"

#: lazarusidestrconsts.uembookmarknunset
#, object-pascal-format
msgid "Bookmark &%s"
msgstr "&%s. Könyvjelző"

#: lazarusidestrconsts.uembookmarknunsetdisabled
#, object-pascal-format
msgid "Bookmark %s"
msgstr "%s. Könyvjelző"

#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Minden más lap bezárása"

#: lazarusidestrconsts.uemcloseotherpagesplain
msgid "Close All Other Pages"
msgstr "Minden más lap bezárása"

#: lazarusidestrconsts.uemcloseotherpagesright
msgid "Close Pages on the &Right"
msgstr "Jobbra lévő lapok bezárása"

#: lazarusidestrconsts.uemcloseotherpagesrightplain
msgid "Close Pages on the Right"
msgstr "Jobbra lévő lapok bezárása"

#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "Lap bezárása"

#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Fájlnév másolása"

#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Klónozás új ablakba"

#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Klónozás másik ablakba"

#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Új Ablak"

#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Hibakeresés"

#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Kódolás"

#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "Kiérték&elés/Módosítás ..."

#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "Deklaráció megkeresése"

#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Keresés másik ablakban"

#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "U&grás könyvjelzőhöz"

#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr "Ugrás könyvjelzőhöz ..."

#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Kiemelés"

#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "V&izsgálat ..."

#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Hozzárendelés megfordítása"

#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Sorvég"

#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "Lap zárolása"

#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Mozgatás eggyel balra"

#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Mozgatás a bal szélre"

#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Mozgatás eggyel jobbra"

#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Mozgatás a jobb szélre"

#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Mozgatás új ablakba"

#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Mozgatás másik ablakba"

#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Új Ablak"

#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Ugrás a következő könyvjelzőhöz"

#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Módosítva"

#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "Beszúrási jelnél lévő fájl megnyitása"

#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Ugrás az előző könyvjelzőhöz"

#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Ugrás az eljárásra"

#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Csak olvasható"

#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Átstrukturálás"

#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Üres könyvjelző beállítása"

#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Sorszámok megjelenítése"

#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Forrás"

#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "Könyvjelző ki-/bekapcsolása"

#: lazarusidestrconsts.uemtogglebookmarknset
#, object-pascal-format
msgid "Toggle Bookmark &%s: %s"
msgstr "&%s. könyvjelző ki-/bekapcsolása: %s"

#: lazarusidestrconsts.uemtogglebookmarknunset
#, object-pascal-format
msgid "Toggle Bookmark &%s"
msgstr "&%s. könyvjelző ki-/bekapcsolása"

#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr "Könyvjelző ki-/bekapcsolása ..."

#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "Töréspont ki-/&bekapcsolása"

#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Hívási verem megjelenítése"

#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Még nincs megvalósítva"

#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "INS"

#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "OVR"

#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Csak olvasható"

#: lazarusidestrconsts.uepselchars
#, object-pascal-format
msgid "%d"
msgstr ""

#: lazarusidestrconsts.uepselcol
msgid "COL"
msgstr ""

#: lazarusidestrconsts.uepselcxchars
#, object-pascal-format
msgid "%d * %d"
msgstr ""

#: lazarusidestrconsts.uepselline
#, fuzzy
#| msgid "Line"
msgctxt "lazarusidestrconsts.uepselline"
msgid "LINE"
msgstr "Sor"

#: lazarusidestrconsts.uepselnorm
msgid "DEF"
msgstr ""

#: lazarusidestrconsts.unitdepoptionsforpackage
msgid "Options for Package graph"
msgstr "Csomag-fa beállításai"

#: lazarusidestrconsts.unitdepoptionsforunit
msgid "Options for Unit graph"
msgstr "Unit-fa beállítása"

#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Változatinformációk"