1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 3090 3091 3092 3093 3094 3095 3096 3097 3098 3099 3100 3101 3102 3103 3104 3105 3106 3107 3108 3109 3110 3111 3112 3113 3114 3115 3116 3117 3118 3119 3120 3121 3122 3123 3124 3125 3126 3127 3128 3129 3130 3131 3132 3133 3134 3135 3136 3137 3138 3139 3140 3141 3142 3143 3144 3145 3146 3147 3148 3149 3150 3151 3152 3153 3154 3155 3156 3157 3158 3159 3160 3161 3162 3163 3164 3165 3166 3167 3168 3169 3170 3171 3172 3173 3174 3175 3176 3177 3178 3179 3180 3181 3182 3183 3184 3185 3186 3187 3188 3189 3190 3191 3192 3193 3194 3195 3196 3197 3198 3199 3200 3201 3202 3203 3204 3205 3206 3207 3208 3209 3210 3211 3212 3213 3214 3215 3216 3217 3218 3219 3220 3221 3222 3223 3224 3225 3226 3227 3228 3229 3230 3231 3232 3233 3234 3235 3236 3237 3238 3239 3240 3241 3242 3243 3244 3245 3246 3247 3248 3249 3250 3251 3252 3253 3254 3255 3256 3257 3258 3259 3260 3261 3262 3263 3264 3265 3266 3267 3268 3269 3270 3271 3272 3273 3274 3275 3276 3277 3278 3279 3280 3281 3282 3283 3284 3285 3286 3287 3288 3289 3290 3291 3292 3293 3294 3295 3296 3297 3298 3299 3300 3301 3302 3303 3304 3305 3306 3307 3308 3309 3310 3311 3312 3313 3314 3315 3316 3317 3318 3319 3320 3321 3322 3323 3324 3325 3326 3327 3328 3329 3330 3331 3332 3333 3334 3335 3336 3337 3338 3339 3340 3341 3342 3343 3344 3345 3346 3347 3348 3349 3350 3351 3352 3353 3354 3355 3356 3357 3358 3359 3360 3361 3362 3363 3364 3365 3366 3367 3368 3369 3370 3371 3372 3373 3374 3375 3376 3377 3378 3379 3380 3381 3382 3383 3384 3385 3386 3387 3388 3389 3390 3391 3392 3393 3394 3395 3396 3397 3398 3399 3400 3401 3402 3403 3404 3405 3406 3407 3408 3409 3410 3411 3412 3413 3414 3415 3416 3417 3418 3419 3420 3421 3422 3423 3424 3425 3426 3427 3428 3429 3430 3431 3432 3433 3434 3435 3436 3437 3438 3439 3440 3441 3442 3443 3444 3445 3446 3447 3448 3449 3450 3451 3452 3453 3454 3455 3456 3457 3458 3459 3460 3461 3462 3463 3464 3465 3466 3467 3468 3469 3470 3471 3472 3473 3474 3475 3476 3477 3478 3479 3480 3481 3482 3483 3484 3485 3486 3487 3488 3489 3490 3491 3492 3493 3494 3495 3496 3497 3498 3499 3500 3501 3502 3503 3504 3505 3506 3507 3508 3509 3510 3511 3512 3513 3514 3515 3516 3517 3518 3519 3520 3521 3522 3523 3524 3525 3526 3527 3528 3529 3530 3531 3532 3533 3534 3535 3536 3537 3538 3539 3540 3541 3542 3543 3544 3545 3546 3547 3548 3549 3550 3551 3552 3553 3554 3555 3556 3557 3558 3559 3560 3561 3562 3563 3564 3565 3566 3567 3568 3569 3570 3571 3572 3573 3574 3575 3576 3577 3578 3579 3580 3581 3582 3583 3584 3585 3586 3587 3588 3589 3590 3591 3592 3593 3594 3595 3596 3597 3598 3599 3600 3601 3602 3603 3604 3605 3606 3607 3608 3609 3610 3611 3612 3613 3614 3615 3616 3617 3618 3619 3620 3621 3622 3623 3624 3625 3626 3627 3628 3629 3630 3631 3632 3633 3634 3635 3636 3637 3638 3639 3640 3641 3642 3643 3644 3645 3646 3647 3648 3649 3650 3651 3652 3653 3654 3655 3656 3657 3658 3659 3660 3661 3662 3663 3664 3665 3666 3667 3668 3669 3670 3671 3672 3673 3674 3675 3676 3677 3678 3679 3680 3681 3682 3683 3684 3685 3686 3687 3688 3689 3690 3691 3692 3693 3694 3695 3696 3697 3698 3699 3700 3701 3702 3703 3704 3705 3706 3707 3708 3709 3710 3711 3712 3713 3714 3715 3716 3717 3718 3719 3720 3721 3722 3723 3724 3725 3726 3727 3728 3729 3730 3731 3732 3733 3734 3735 3736 3737 3738 3739 3740 3741 3742 3743 3744 3745 3746 3747 3748 3749 3750 3751 3752 3753 3754 3755 3756 3757 3758 3759 3760 3761 3762 3763 3764 3765 3766 3767 3768 3769 3770 3771 3772 3773 3774 3775 3776 3777 3778 3779 3780 3781 3782 3783 3784 3785 3786 3787 3788 3789 3790 3791 3792 3793 3794 3795 3796 3797 3798 3799 3800 3801 3802 3803 3804 3805 3806 3807 3808 3809 3810 3811 3812 3813 3814 3815 3816 3817 3818 3819 3820 3821 3822 3823 3824 3825 3826 3827 3828 3829 3830 3831 3832 3833 3834 3835 3836 3837 3838 3839 3840 3841 3842 3843 3844 3845 3846 3847 3848 3849 3850 3851 3852 3853 3854 3855 3856 3857 3858 3859 3860 3861 3862 3863 3864 3865 3866 3867 3868 3869 3870 3871 3872 3873 3874 3875 3876 3877 3878 3879 3880 3881 3882 3883 3884 3885 3886 3887 3888 3889 3890 3891 3892 3893 3894 3895 3896 3897 3898 3899 3900 3901 3902 3903 3904 3905 3906 3907 3908 3909 3910 3911 3912 3913 3914 3915 3916 3917 3918 3919 3920 3921 3922 3923 3924 3925 3926 3927 3928 3929 3930 3931 3932 3933 3934 3935 3936 3937 3938 3939 3940 3941 3942 3943 3944 3945 3946 3947 3948 3949 3950 3951 3952 3953 3954 3955 3956 3957 3958 3959 3960 3961 3962 3963 3964 3965 3966 3967 3968 3969 3970 3971 3972 3973 3974 3975 3976 3977 3978 3979 3980 3981 3982 3983 3984 3985 3986 3987 3988 3989 3990 3991 3992 3993 3994 3995 3996 3997 3998 3999 4000 4001 4002 4003 4004 4005 4006 4007 4008 4009 4010 4011 4012 4013 4014 4015 4016 4017 4018 4019 4020 4021 4022 4023 4024 4025 4026 4027 4028 4029 4030 4031 4032 4033 4034 4035 4036 4037 4038 4039 4040 4041 4042 4043 4044 4045 4046 4047 4048 4049 4050 4051 4052 4053 4054 4055 4056 4057 4058 4059 4060 4061 4062 4063 4064 4065 4066 4067 4068 4069 4070 4071 4072 4073 4074 4075 4076 4077 4078 4079 4080 4081 4082 4083 4084 4085 4086 4087 4088 4089 4090 4091 4092 4093 4094 4095 4096 4097 4098 4099 4100 4101 4102 4103 4104 4105 4106 4107 4108 4109 4110 4111 4112 4113 4114 4115 4116 4117 4118 4119 4120 4121 4122 4123 4124 4125 4126 4127 4128 4129 4130 4131 4132 4133 4134 4135 4136 4137 4138 4139 4140 4141 4142 4143 4144 4145 4146 4147 4148 4149 4150 4151 4152 4153 4154 4155 4156 4157 4158 4159 4160 4161 4162 4163 4164 4165 4166 4167 4168 4169 4170 4171 4172 4173 4174 4175 4176 4177 4178 4179 4180 4181 4182 4183 4184 4185 4186 4187 4188 4189 4190 4191 4192 4193 4194 4195 4196 4197 4198 4199 4200 4201 4202 4203 4204 4205 4206 4207 4208 4209 4210 4211 4212 4213 4214 4215 4216 4217 4218 4219 4220 4221 4222 4223 4224 4225 4226 4227 4228 4229 4230 4231 4232 4233 4234 4235 4236 4237 4238 4239 4240 4241 4242 4243 4244 4245 4246 4247 4248 4249 4250 4251 4252 4253 4254 4255 4256 4257 4258 4259 4260 4261 4262 4263 4264 4265 4266 4267 4268 4269 4270 4271 4272 4273 4274 4275 4276 4277 4278 4279 4280 4281 4282 4283 4284 4285 4286 4287 4288 4289 4290 4291 4292 4293 4294 4295 4296 4297 4298 4299 4300 4301 4302 4303 4304 4305 4306 4307 4308 4309 4310 4311 4312 4313 4314 4315 4316 4317 4318 4319 4320 4321 4322 4323 4324 4325 4326 4327 4328 4329 4330 4331 4332 4333 4334 4335 4336 4337 4338 4339 4340 4341 4342 4343 4344 4345 4346 4347 4348 4349 4350 4351 4352 4353 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4368 4369 4370 4371 4372 4373 4374 4375 4376 4377 4378 4379 4380 4381 4382 4383 4384 4385 4386 4387 4388 4389 4390 4391 4392 4393 4394 4395 4396 4397 4398 4399 4400 4401 4402 4403 4404 4405 4406 4407 4408 4409 4410 4411 4412 4413 4414 4415 4416 4417 4418 4419 4420 4421 4422 4423 4424 4425 4426 4427 4428 4429 4430 4431 4432 4433 4434 4435 4436 4437 4438 4439 4440 4441 4442 4443 4444 4445 4446 4447 4448 4449 4450 4451 4452 4453 4454 4455 4456 4457 4458 4459 4460 4461 4462 4463 4464 4465 4466 4467 4468 4469 4470 4471 4472 4473 4474 4475 4476 4477 4478 4479 4480 4481 4482 4483 4484 4485 4486 4487 4488 4489 4490 4491 4492 4493 4494 4495 4496 4497 4498 4499 4500 4501 4502 4503 4504 4505 4506 4507 4508 4509 4510 4511 4512 4513 4514 4515 4516 4517 4518 4519 4520 4521 4522 4523 4524 4525 4526 4527 4528 4529 4530 4531 4532 4533 4534 4535 4536 4537 4538 4539 4540 4541 4542 4543 4544 4545 4546 4547 4548 4549 4550 4551 4552 4553 4554 4555 4556 4557 4558 4559 4560 4561 4562 4563 4564 4565 4566 4567 4568 4569 4570 4571 4572 4573 4574 4575 4576 4577 4578 4579 4580 4581 4582 4583 4584 4585 4586 4587 4588 4589 4590 4591 4592 4593 4594 4595 4596 4597 4598 4599 4600 4601 4602 4603 4604 4605 4606 4607 4608 4609 4610 4611 4612 4613 4614 4615 4616 4617 4618 4619 4620 4621 4622 4623 4624 4625 4626 4627 4628 4629 4630 4631 4632 4633 4634 4635 4636 4637 4638 4639 4640 4641 4642 4643 4644 4645 4646 4647 4648 4649 4650 4651 4652 4653 4654 4655 4656 4657 4658 4659 4660 4661 4662 4663 4664 4665 4666 4667 4668 4669 4670 4671 4672 4673 4674 4675 4676 4677 4678 4679 4680 4681 4682 4683 4684 4685 4686 4687 4688 4689 4690 4691 4692 4693 4694 4695 4696 4697 4698 4699 4700 4701 4702 4703 4704 4705 4706 4707 4708 4709 4710 4711 4712 4713 4714 4715 4716 4717 4718 4719 4720 4721 4722 4723 4724 4725 4726 4727 4728 4729 4730 4731 4732 4733 4734 4735 4736 4737 4738 4739 4740 4741 4742 4743 4744 4745 4746 4747 4748 4749 4750 4751 4752 4753 4754 4755 4756 4757 4758 4759 4760 4761 4762 4763 4764 4765 4766 4767 4768 4769 4770 4771 4772 4773 4774 4775 4776 4777 4778 4779 4780 4781 4782 4783 4784 4785 4786 4787 4788 4789 4790 4791 4792 4793 4794 4795 4796 4797 4798 4799 4800 4801 4802 4803 4804 4805 4806 4807 4808 4809 4810 4811 4812 4813 4814 4815 4816 4817 4818 4819 4820 4821 4822 4823 4824 4825 4826 4827 4828 4829 4830 4831 4832 4833 4834 4835 4836 4837 4838 4839 4840 4841 4842 4843 4844 4845 4846 4847 4848 4849 4850 4851 4852 4853 4854 4855 4856 4857 4858 4859 4860 4861 4862 4863 4864 4865 4866 4867 4868 4869 4870 4871 4872 4873 4874 4875 4876 4877 4878 4879 4880 4881 4882 4883 4884 4885 4886 4887 4888 4889 4890 4891 4892 4893 4894 4895 4896 4897 4898 4899 4900 4901 4902 4903 4904 4905 4906 4907 4908 4909 4910 4911 4912 4913 4914 4915 4916 4917 4918 4919 4920 4921 4922 4923 4924 4925 4926 4927 4928 4929 4930 4931 4932 4933 4934 4935 4936 4937 4938 4939 4940 4941 4942 4943 4944 4945 4946 4947 4948 4949 4950 4951 4952 4953 4954 4955 4956 4957 4958 4959 4960 4961 4962 4963 4964 4965 4966 4967 4968 4969 4970 4971 4972 4973 4974 4975 4976 4977 4978 4979 4980 4981 4982 4983 4984 4985 4986 4987 4988 4989 4990 4991 4992 4993 4994 4995 4996 4997 4998 4999 5000 5001 5002 5003 5004 5005 5006 5007 5008 5009 5010 5011 5012 5013 5014 5015 5016 5017 5018 5019 5020 5021 5022 5023 5024 5025 5026 5027 5028 5029 5030 5031 5032 5033 5034 5035 5036 5037 5038 5039 5040 5041 5042 5043 5044 5045 5046 5047 5048 5049 5050 5051 5052 5053 5054 5055 5056 5057 5058 5059 5060 5061 5062 5063 5064 5065 5066 5067 5068 5069 5070 5071 5072 5073 5074 5075 5076 5077 5078 5079 5080 5081 5082 5083 5084 5085 5086 5087 5088 5089 5090 5091 5092 5093 5094 5095 5096 5097 5098 5099 5100 5101 5102 5103 5104 5105 5106 5107 5108 5109 5110 5111 5112 5113 5114 5115 5116 5117 5118 5119 5120 5121 5122 5123 5124 5125 5126 5127 5128 5129 5130 5131 5132 5133 5134 5135 5136 5137 5138 5139 5140 5141 5142 5143 5144 5145 5146 5147 5148 5149 5150 5151 5152 5153 5154 5155 5156 5157 5158 5159 5160 5161 5162 5163 5164 5165 5166 5167 5168 5169 5170 5171 5172 5173 5174 5175 5176 5177 5178 5179 5180 5181 5182 5183 5184 5185 5186 5187 5188 5189 5190 5191 5192 5193 5194 5195 5196 5197 5198 5199 5200 5201 5202 5203 5204 5205 5206 5207 5208 5209 5210 5211 5212 5213 5214 5215 5216 5217 5218 5219 5220 5221 5222 5223 5224 5225 5226 5227 5228 5229 5230 5231 5232 5233 5234 5235 5236 5237 5238 5239 5240 5241 5242 5243 5244 5245 5246 5247 5248 5249 5250 5251 5252 5253 5254 5255 5256 5257 5258 5259 5260 5261 5262 5263 5264 5265 5266 5267 5268 5269 5270 5271 5272 5273 5274 5275 5276 5277 5278 5279 5280 5281 5282 5283 5284 5285 5286 5287 5288 5289 5290 5291 5292 5293 5294 5295 5296 5297 5298 5299 5300 5301 5302 5303 5304 5305 5306 5307 5308 5309 5310 5311 5312 5313 5314 5315 5316 5317 5318 5319 5320 5321 5322 5323 5324 5325 5326 5327 5328 5329 5330 5331 5332 5333 5334 5335 5336 5337 5338 5339 5340 5341 5342 5343 5344 5345 5346 5347 5348 5349 5350 5351 5352 5353 5354 5355 5356 5357 5358 5359 5360 5361 5362 5363 5364 5365 5366 5367 5368 5369 5370 5371 5372 5373 5374 5375 5376 5377 5378 5379 5380 5381 5382 5383 5384 5385 5386 5387 5388 5389 5390 5391 5392 5393 5394 5395 5396 5397 5398 5399 5400 5401 5402 5403 5404 5405 5406 5407 5408 5409 5410 5411 5412 5413 5414 5415 5416 5417 5418 5419 5420 5421 5422 5423 5424 5425 5426 5427 5428 5429 5430 5431 5432 5433 5434 5435 5436 5437 5438 5439 5440 5441 5442 5443 5444 5445 5446 5447 5448 5449 5450 5451 5452 5453 5454 5455 5456 5457 5458 5459 5460 5461 5462 5463 5464 5465 5466 5467 5468 5469 5470 5471 5472 5473 5474 5475 5476 5477 5478 5479 5480 5481 5482 5483 5484 5485 5486 5487 5488 5489 5490 5491 5492 5493 5494 5495 5496 5497 5498 5499 5500 5501 5502 5503 5504 5505 5506 5507 5508 5509 5510 5511 5512 5513 5514 5515 5516 5517 5518 5519 5520 5521 5522 5523 5524 5525 5526 5527 5528 5529 5530 5531 5532 5533 5534 5535 5536 5537 5538 5539 5540 5541 5542 5543 5544 5545 5546 5547 5548 5549 5550 5551 5552 5553 5554 5555 5556 5557 5558 5559 5560 5561 5562 5563 5564 5565 5566 5567 5568 5569 5570 5571 5572 5573 5574 5575 5576 5577 5578 5579 5580 5581 5582 5583 5584 5585 5586 5587 5588 5589 5590 5591 5592 5593 5594 5595 5596 5597 5598 5599 5600 5601 5602 5603 5604 5605 5606 5607 5608 5609 5610 5611 5612 5613 5614 5615 5616 5617 5618 5619 5620 5621 5622 5623 5624 5625 5626 5627 5628 5629 5630 5631 5632 5633 5634 5635 5636 5637 5638 5639 5640 5641 5642 5643 5644 5645 5646 5647 5648 5649 5650 5651 5652 5653 5654 5655 5656 5657 5658 5659 5660 5661 5662 5663 5664 5665 5666 5667 5668 5669 5670 5671 5672 5673 5674 5675 5676 5677 5678 5679 5680 5681 5682 5683 5684 5685 5686 5687 5688 5689 5690 5691 5692 5693 5694 5695 5696 5697 5698 5699 5700 5701 5702 5703 5704 5705 5706 5707 5708 5709 5710 5711 5712 5713 5714 5715 5716 5717 5718 5719 5720 5721 5722 5723 5724 5725 5726 5727 5728 5729 5730 5731 5732 5733 5734 5735 5736 5737 5738 5739 5740 5741 5742 5743 5744 5745 5746 5747 5748 5749 5750 5751 5752 5753 5754 5755 5756 5757 5758 5759 5760 5761 5762 5763 5764 5765 5766 5767 5768 5769 5770 5771 5772 5773 5774 5775 5776 5777 5778 5779 5780 5781 5782 5783 5784 5785 5786 5787 5788 5789 5790 5791 5792 5793 5794 5795 5796 5797 5798 5799 5800 5801 5802 5803 5804 5805 5806 5807 5808 5809 5810 5811 5812 5813 5814 5815 5816 5817 5818 5819 5820 5821 5822 5823 5824 5825 5826 5827 5828 5829 5830 5831 5832 5833 5834 5835 5836 5837 5838 5839 5840 5841 5842 5843 5844 5845 5846 5847 5848 5849 5850 5851 5852 5853 5854 5855 5856 5857 5858 5859 5860 5861 5862 5863 5864 5865 5866 5867 5868 5869 5870 5871 5872 5873 5874 5875 5876 5877 5878 5879 5880 5881 5882 5883 5884 5885 5886 5887 5888 5889 5890 5891 5892 5893 5894 5895 5896 5897 5898 5899 5900 5901 5902 5903 5904 5905 5906 5907 5908 5909 5910 5911 5912 5913 5914 5915 5916 5917 5918 5919 5920 5921 5922 5923 5924 5925 5926 5927 5928 5929 5930 5931 5932 5933 5934 5935 5936 5937 5938 5939 5940 5941 5942 5943 5944 5945 5946 5947 5948 5949 5950 5951 5952 5953 5954 5955 5956 5957 5958 5959 5960 5961 5962 5963 5964 5965 5966 5967 5968 5969 5970 5971 5972 5973 5974 5975 5976 5977 5978 5979 5980 5981 5982 5983 5984 5985 5986 5987 5988 5989 5990 5991 5992 5993 5994 5995 5996 5997 5998 5999 6000 6001 6002 6003 6004 6005 6006 6007 6008 6009 6010 6011 6012 6013 6014 6015 6016 6017 6018 6019 6020 6021 6022 6023 6024 6025 6026 6027 6028 6029 6030 6031 6032 6033 6034 6035 6036 6037 6038 6039 6040 6041 6042 6043 6044 6045 6046 6047 6048 6049 6050 6051 6052 6053 6054 6055 6056 6057 6058 6059 6060 6061 6062 6063 6064 6065 6066 6067 6068 6069 6070 6071 6072 6073 6074 6075 6076 6077 6078 6079 6080 6081 6082 6083 6084 6085 6086 6087 6088 6089 6090 6091 6092 6093 6094 6095 6096 6097 6098 6099 6100 6101 6102 6103 6104 6105 6106 6107 6108 6109 6110 6111 6112 6113 6114 6115 6116 6117 6118 6119 6120 6121 6122 6123 6124 6125 6126 6127 6128 6129 6130 6131 6132 6133 6134 6135 6136 6137 6138 6139 6140 6141 6142 6143 6144 6145 6146 6147 6148 6149 6150 6151 6152 6153 6154 6155 6156 6157 6158 6159 6160 6161 6162 6163 6164 6165 6166 6167 6168 6169 6170 6171 6172 6173 6174 6175 6176 6177 6178 6179 6180 6181 6182 6183 6184 6185 6186 6187 6188 6189 6190 6191 6192 6193 6194 6195 6196 6197 6198 6199 6200 6201 6202 6203 6204 6205 6206 6207 6208 6209 6210 6211 6212 6213 6214 6215 6216 6217 6218 6219 6220 6221 6222 6223 6224 6225 6226 6227 6228 6229 6230 6231 6232 6233 6234 6235 6236 6237 6238 6239 6240 6241 6242 6243 6244 6245 6246 6247 6248 6249 6250 6251 6252 6253 6254 6255 6256 6257 6258 6259 6260 6261 6262 6263 6264 6265 6266 6267 6268 6269 6270 6271 6272 6273 6274 6275 6276 6277 6278 6279 6280 6281 6282 6283 6284 6285 6286 6287 6288 6289 6290 6291 6292 6293 6294 6295 6296 6297 6298 6299 6300 6301 6302 6303 6304 6305 6306 6307 6308 6309 6310 6311 6312 6313 6314 6315 6316 6317 6318 6319 6320 6321 6322 6323 6324 6325 6326 6327 6328 6329 6330 6331 6332 6333 6334 6335 6336 6337 6338 6339 6340 6341 6342 6343 6344 6345 6346 6347 6348 6349 6350 6351 6352 6353 6354 6355 6356 6357 6358 6359 6360 6361 6362 6363 6364 6365 6366 6367 6368 6369 6370 6371 6372 6373 6374 6375 6376 6377 6378 6379 6380 6381 6382 6383 6384 6385 6386 6387 6388 6389 6390 6391 6392 6393 6394 6395 6396 6397 6398 6399 6400 6401 6402 6403 6404 6405 6406 6407 6408 6409 6410 6411 6412 6413 6414 6415 6416 6417 6418 6419 6420 6421 6422 6423 6424 6425 6426 6427 6428 6429 6430 6431 6432 6433 6434 6435 6436 6437 6438 6439 6440 6441 6442 6443 6444 6445 6446 6447 6448 6449 6450 6451 6452 6453 6454 6455 6456 6457 6458 6459 6460 6461 6462 6463 6464 6465 6466 6467 6468 6469 6470 6471 6472 6473 6474 6475 6476 6477 6478 6479 6480 6481 6482 6483 6484 6485 6486 6487 6488 6489 6490 6491 6492 6493 6494 6495 6496 6497 6498 6499 6500 6501 6502 6503 6504 6505 6506 6507 6508 6509 6510 6511 6512 6513 6514 6515 6516 6517 6518 6519 6520 6521 6522 6523 6524 6525 6526 6527 6528 6529 6530 6531 6532 6533 6534 6535 6536 6537 6538 6539 6540 6541 6542 6543 6544 6545 6546 6547 6548 6549 6550 6551 6552 6553 6554 6555 6556 6557 6558 6559 6560 6561 6562 6563 6564 6565 6566 6567 6568 6569 6570 6571 6572 6573 6574 6575 6576 6577 6578 6579 6580 6581 6582 6583 6584 6585 6586 6587 6588 6589 6590 6591 6592 6593 6594 6595 6596 6597 6598 6599 6600 6601 6602 6603 6604 6605 6606 6607 6608 6609 6610 6611 6612 6613 6614 6615 6616 6617 6618 6619 6620 6621 6622 6623 6624 6625 6626 6627 6628 6629 6630 6631 6632 6633 6634 6635 6636 6637 6638 6639 6640 6641 6642 6643 6644 6645 6646 6647 6648 6649 6650 6651 6652 6653 6654 6655 6656 6657 6658 6659 6660 6661 6662 6663 6664 6665 6666 6667 6668 6669 6670 6671 6672 6673 6674 6675 6676 6677 6678 6679 6680 6681 6682 6683 6684 6685 6686 6687 6688 6689 6690 6691 6692 6693 6694 6695 6696 6697 6698 6699 6700 6701 6702 6703 6704 6705 6706 6707 6708 6709 6710 6711 6712 6713 6714 6715 6716 6717 6718 6719 6720 6721 6722 6723 6724 6725 6726 6727 6728 6729 6730 6731 6732 6733 6734 6735 6736 6737 6738 6739 6740 6741 6742 6743 6744 6745 6746 6747 6748 6749 6750 6751 6752 6753 6754 6755 6756 6757 6758 6759 6760 6761 6762 6763 6764 6765 6766 6767 6768 6769 6770 6771 6772 6773 6774 6775 6776 6777 6778 6779 6780 6781 6782 6783 6784 6785 6786 6787 6788 6789 6790 6791 6792 6793 6794 6795 6796 6797 6798 6799 6800 6801 6802 6803 6804 6805 6806 6807 6808 6809 6810 6811 6812 6813 6814 6815 6816 6817 6818 6819 6820 6821 6822 6823 6824 6825 6826 6827 6828 6829 6830 6831 6832 6833 6834 6835 6836 6837 6838 6839 6840 6841 6842 6843 6844 6845 6846 6847 6848 6849 6850 6851 6852 6853 6854 6855 6856 6857 6858 6859 6860 6861 6862 6863 6864 6865 6866 6867 6868 6869 6870 6871 6872 6873 6874 6875 6876 6877 6878 6879 6880 6881 6882 6883 6884 6885 6886 6887 6888 6889 6890 6891 6892 6893 6894 6895 6896 6897 6898 6899 6900 6901 6902 6903 6904 6905 6906 6907 6908 6909 6910 6911 6912 6913 6914 6915 6916 6917 6918 6919 6920 6921 6922 6923 6924 6925 6926 6927 6928 6929 6930 6931 6932 6933 6934 6935 6936 6937 6938 6939 6940 6941 6942 6943 6944 6945 6946 6947 6948 6949 6950 6951 6952 6953 6954 6955 6956 6957 6958 6959 6960 6961 6962 6963 6964 6965 6966 6967 6968 6969 6970 6971 6972 6973 6974 6975 6976 6977 6978 6979 6980 6981 6982 6983 6984 6985 6986 6987 6988 6989 6990 6991 6992 6993 6994 6995 6996 6997 6998 6999 7000 7001 7002 7003 7004 7005 7006 7007 7008 7009 7010 7011 7012 7013 7014 7015 7016 7017 7018 7019 7020 7021 7022 7023 7024 7025 7026 7027 7028 7029 7030 7031 7032 7033 7034 7035 7036 7037 7038 7039 7040 7041 7042 7043 7044 7045 7046 7047 7048 7049 7050 7051 7052 7053 7054 7055 7056 7057 7058 7059 7060 7061 7062 7063 7064 7065 7066 7067 7068 7069 7070 7071 7072 7073 7074 7075 7076 7077 7078 7079 7080 7081 7082 7083 7084 7085 7086 7087 7088 7089 7090 7091 7092 7093 7094 7095 7096 7097 7098 7099 7100 7101 7102 7103 7104 7105 7106 7107 7108 7109 7110 7111 7112 7113 7114 7115 7116 7117 7118 7119 7120 7121 7122 7123 7124 7125 7126 7127 7128 7129 7130 7131 7132 7133 7134 7135 7136 7137 7138 7139 7140 7141 7142 7143 7144 7145 7146 7147 7148 7149 7150 7151 7152 7153 7154 7155 7156 7157 7158 7159 7160 7161 7162 7163 7164 7165 7166 7167 7168 7169 7170 7171 7172 7173 7174 7175 7176 7177 7178 7179 7180 7181 7182 7183 7184 7185 7186 7187 7188 7189 7190 7191 7192 7193 7194 7195 7196 7197 7198 7199 7200 7201 7202 7203 7204 7205 7206 7207 7208 7209 7210 7211 7212 7213 7214 7215 7216 7217 7218 7219 7220 7221 7222 7223 7224 7225 7226 7227 7228 7229 7230 7231 7232 7233 7234 7235 7236 7237 7238 7239 7240 7241 7242 7243 7244 7245 7246 7247 7248 7249 7250 7251 7252 7253 7254 7255 7256 7257 7258 7259 7260 7261 7262 7263 7264 7265 7266 7267 7268 7269 7270 7271 7272 7273 7274 7275 7276 7277 7278 7279 7280 7281 7282 7283 7284 7285 7286 7287 7288 7289 7290 7291 7292 7293 7294 7295 7296 7297 7298 7299 7300 7301 7302 7303 7304 7305 7306 7307 7308 7309 7310 7311 7312 7313 7314 7315 7316 7317 7318 7319 7320 7321 7322 7323 7324 7325 7326 7327 7328 7329 7330 7331 7332 7333 7334 7335 7336 7337 7338 7339 7340 7341 7342 7343 7344 7345 7346 7347 7348 7349 7350 7351 7352 7353 7354 7355 7356 7357 7358 7359 7360 7361 7362 7363 7364 7365 7366 7367 7368 7369 7370 7371 7372 7373 7374 7375 7376 7377 7378 7379 7380 7381 7382 7383 7384 7385 7386 7387 7388 7389 7390 7391 7392 7393 7394 7395 7396 7397 7398 7399 7400 7401 7402 7403 7404 7405 7406 7407 7408 7409 7410 7411 7412 7413 7414 7415 7416 7417 7418 7419 7420 7421 7422 7423 7424 7425 7426 7427 7428 7429 7430 7431 7432 7433 7434 7435 7436 7437 7438 7439 7440 7441 7442 7443 7444 7445 7446 7447 7448 7449 7450 7451 7452 7453 7454 7455 7456 7457 7458 7459 7460 7461 7462 7463 7464 7465 7466 7467 7468 7469 7470 7471 7472 7473 7474 7475 7476 7477 7478 7479 7480 7481 7482 7483 7484 7485 7486 7487 7488 7489 7490 7491 7492 7493 7494 7495 7496 7497 7498 7499 7500 7501 7502 7503 7504 7505 7506 7507 7508 7509 7510 7511 7512 7513 7514 7515 7516 7517 7518 7519 7520 7521 7522 7523 7524 7525 7526 7527 7528 7529 7530 7531 7532 7533 7534 7535 7536 7537 7538 7539 7540 7541 7542 7543 7544 7545 7546 7547 7548 7549 7550 7551 7552 7553 7554 7555 7556 7557 7558 7559 7560 7561 7562 7563 7564 7565 7566 7567 7568 7569 7570 7571 7572 7573 7574 7575 7576 7577 7578 7579 7580 7581 7582 7583 7584 7585 7586 7587 7588 7589 7590 7591 7592 7593 7594 7595 7596 7597 7598 7599 7600 7601 7602 7603 7604 7605 7606 7607 7608 7609 7610 7611 7612 7613 7614 7615 7616 7617 7618 7619 7620 7621 7622 7623 7624 7625 7626 7627 7628 7629 7630 7631 7632 7633 7634 7635 7636 7637 7638 7639 7640 7641 7642 7643 7644 7645 7646 7647 7648 7649 7650 7651 7652 7653 7654 7655 7656 7657 7658 7659 7660 7661 7662 7663 7664 7665 7666 7667 7668 7669 7670 7671 7672 7673 7674 7675 7676 7677 7678 7679 7680 7681 7682 7683 7684 7685 7686 7687 7688 7689 7690 7691 7692 7693 7694 7695 7696 7697 7698 7699 7700 7701 7702 7703 7704 7705 7706 7707 7708 7709 7710 7711 7712 7713 7714 7715 7716 7717 7718 7719 7720 7721 7722 7723 7724 7725 7726 7727 7728 7729 7730 7731 7732 7733 7734 7735 7736 7737 7738 7739 7740 7741 7742 7743 7744 7745 7746 7747 7748 7749 7750 7751 7752 7753 7754 7755 7756 7757 7758 7759 7760 7761 7762 7763 7764 7765 7766 7767 7768 7769 7770 7771 7772 7773 7774 7775 7776 7777 7778 7779 7780 7781 7782 7783 7784 7785 7786 7787 7788 7789 7790 7791 7792 7793 7794 7795 7796 7797 7798 7799 7800 7801 7802 7803 7804 7805 7806 7807 7808 7809 7810 7811 7812 7813 7814 7815 7816 7817 7818 7819 7820 7821 7822 7823 7824 7825 7826 7827 7828 7829 7830 7831 7832 7833 7834 7835 7836 7837 7838 7839 7840 7841 7842 7843 7844 7845 7846 7847 7848 7849 7850 7851 7852 7853 7854 7855 7856 7857 7858 7859 7860 7861 7862 7863 7864 7865 7866 7867 7868 7869 7870 7871 7872 7873 7874 7875 7876 7877 7878 7879 7880 7881 7882 7883 7884 7885 7886 7887 7888 7889 7890 7891 7892 7893 7894 7895 7896 7897 7898 7899 7900 7901 7902 7903 7904 7905 7906 7907 7908 7909 7910 7911 7912 7913 7914 7915 7916 7917 7918 7919 7920 7921 7922 7923 7924 7925 7926 7927 7928 7929 7930 7931 7932 7933 7934 7935 7936 7937 7938 7939 7940 7941 7942 7943 7944 7945 7946 7947 7948 7949 7950 7951 7952 7953 7954 7955 7956 7957 7958 7959 7960 7961 7962 7963 7964 7965 7966 7967 7968 7969 7970 7971 7972 7973 7974 7975 7976 7977 7978 7979 7980 7981 7982 7983 7984 7985 7986 7987 7988 7989 7990 7991 7992 7993 7994 7995 7996 7997 7998 7999 8000 8001 8002 8003 8004 8005 8006 8007 8008 8009 8010 8011 8012 8013 8014 8015 8016 8017 8018 8019 8020 8021 8022 8023 8024 8025 8026 8027 8028 8029 8030 8031 8032 8033 8034 8035 8036 8037 8038 8039 8040 8041 8042 8043 8044 8045 8046 8047 8048 8049 8050 8051 8052 8053 8054 8055 8056 8057 8058 8059 8060 8061 8062 8063 8064 8065 8066 8067 8068 8069 8070 8071 8072 8073 8074 8075 8076 8077 8078 8079 8080 8081 8082 8083 8084 8085 8086 8087 8088 8089 8090 8091 8092 8093 8094 8095 8096 8097 8098 8099 8100 8101 8102 8103 8104 8105 8106 8107 8108 8109 8110 8111 8112 8113 8114 8115 8116 8117 8118 8119 8120 8121 8122 8123 8124 8125 8126 8127 8128 8129 8130 8131 8132 8133 8134 8135 8136 8137 8138 8139 8140 8141 8142 8143 8144 8145 8146 8147 8148 8149 8150 8151 8152 8153 8154 8155 8156 8157 8158 8159 8160 8161 8162 8163 8164 8165 8166 8167 8168 8169 8170 8171 8172 8173 8174 8175 8176 8177 8178 8179 8180 8181 8182 8183 8184 8185 8186 8187 8188 8189 8190 8191 8192 8193 8194 8195 8196 8197 8198 8199 8200 8201 8202 8203 8204 8205 8206 8207 8208 8209 8210 8211 8212 8213 8214 8215 8216 8217 8218 8219 8220 8221 8222 8223 8224 8225 8226 8227 8228 8229 8230 8231 8232 8233 8234 8235 8236 8237 8238 8239 8240 8241 8242 8243 8244 8245 8246 8247 8248 8249 8250 8251 8252 8253 8254 8255 8256 8257 8258 8259 8260 8261 8262 8263 8264 8265 8266 8267 8268 8269 8270 8271 8272 8273 8274 8275 8276 8277 8278 8279 8280 8281 8282 8283 8284 8285 8286 8287 8288 8289 8290 8291 8292 8293 8294 8295 8296 8297 8298 8299 8300 8301 8302 8303 8304 8305 8306 8307 8308 8309 8310 8311 8312 8313 8314 8315 8316 8317 8318 8319 8320 8321 8322 8323 8324 8325 8326 8327 8328 8329 8330 8331 8332 8333 8334 8335 8336 8337 8338 8339 8340 8341 8342 8343 8344 8345 8346 8347 8348 8349 8350 8351 8352 8353 8354 8355 8356 8357 8358 8359 8360 8361 8362 8363 8364 8365 8366 8367 8368 8369 8370 8371 8372 8373 8374 8375 8376 8377 8378 8379 8380 8381 8382 8383 8384 8385 8386 8387 8388 8389 8390 8391 8392 8393 8394 8395 8396 8397 8398 8399 8400 8401 8402 8403 8404 8405 8406 8407 8408 8409 8410 8411 8412 8413 8414 8415 8416 8417 8418 8419 8420 8421 8422 8423 8424 8425 8426 8427 8428 8429 8430 8431 8432 8433 8434 8435 8436 8437 8438 8439 8440 8441 8442 8443 8444 8445 8446 8447 8448 8449 8450 8451 8452 8453 8454 8455 8456 8457 8458 8459 8460 8461 8462 8463 8464 8465 8466 8467 8468 8469 8470 8471 8472 8473 8474 8475 8476 8477 8478 8479 8480 8481 8482 8483 8484 8485 8486 8487 8488 8489 8490 8491 8492 8493 8494 8495 8496 8497 8498 8499 8500 8501 8502 8503 8504 8505 8506 8507 8508 8509 8510 8511 8512 8513 8514 8515 8516 8517 8518 8519 8520 8521 8522 8523 8524 8525 8526 8527 8528 8529 8530 8531 8532 8533 8534 8535 8536 8537 8538 8539 8540 8541 8542 8543 8544 8545 8546 8547 8548 8549 8550 8551 8552 8553 8554 8555 8556 8557 8558 8559 8560 8561 8562 8563 8564 8565 8566 8567 8568 8569 8570 8571 8572 8573 8574 8575 8576 8577 8578 8579 8580 8581 8582 8583 8584 8585 8586 8587 8588 8589 8590 8591 8592 8593 8594 8595 8596 8597 8598 8599 8600 8601 8602 8603 8604 8605 8606 8607 8608 8609 8610 8611 8612 8613 8614 8615 8616 8617 8618 8619 8620 8621 8622 8623 8624 8625 8626 8627 8628 8629 8630 8631 8632 8633 8634 8635 8636 8637 8638 8639 8640 8641 8642 8643 8644 8645 8646 8647 8648 8649 8650 8651 8652 8653 8654 8655 8656 8657 8658 8659 8660 8661 8662 8663 8664 8665 8666 8667 8668 8669 8670 8671 8672 8673 8674 8675 8676 8677 8678 8679 8680 8681 8682 8683 8684 8685 8686 8687 8688 8689 8690 8691 8692 8693 8694 8695 8696 8697 8698 8699 8700 8701 8702 8703 8704 8705 8706 8707 8708 8709 8710 8711 8712 8713 8714 8715 8716 8717 8718 8719 8720 8721 8722 8723 8724 8725 8726 8727 8728 8729 8730 8731 8732 8733 8734 8735 8736 8737 8738 8739 8740 8741 8742 8743 8744 8745 8746 8747 8748 8749 8750 8751 8752 8753 8754 8755 8756 8757 8758 8759 8760 8761 8762 8763 8764 8765 8766 8767 8768 8769 8770 8771 8772 8773 8774 8775 8776 8777 8778 8779 8780 8781 8782 8783 8784 8785 8786 8787 8788 8789 8790 8791 8792 8793 8794 8795 8796 8797 8798 8799 8800 8801 8802 8803 8804 8805 8806 8807 8808 8809 8810 8811 8812 8813 8814 8815 8816 8817 8818 8819 8820 8821 8822 8823 8824 8825 8826 8827 8828 8829 8830 8831 8832 8833 8834 8835 8836 8837 8838 8839 8840 8841 8842 8843 8844 8845 8846 8847 8848 8849 8850 8851 8852 8853 8854 8855 8856 8857 8858 8859 8860 8861 8862 8863 8864 8865 8866 8867 8868 8869 8870 8871 8872 8873 8874 8875 8876 8877 8878 8879 8880 8881 8882 8883 8884 8885 8886 8887 8888 8889 8890 8891 8892 8893 8894 8895 8896 8897 8898 8899 8900 8901 8902 8903 8904 8905 8906 8907 8908 8909 8910 8911 8912 8913 8914 8915 8916 8917 8918 8919 8920 8921 8922 8923 8924 8925 8926 8927 8928 8929 8930 8931 8932 8933 8934 8935 8936 8937 8938 8939 8940 8941 8942 8943 8944 8945 8946 8947 8948 8949 8950 8951 8952 8953 8954 8955 8956 8957 8958 8959 8960 8961 8962 8963 8964 8965 8966 8967 8968 8969 8970 8971 8972 8973 8974 8975 8976 8977 8978 8979 8980 8981 8982 8983 8984 8985 8986 8987 8988 8989 8990 8991 8992 8993 8994 8995 8996 8997 8998 8999 9000 9001 9002 9003 9004 9005 9006 9007 9008 9009 9010 9011 9012 9013 9014 9015 9016 9017 9018 9019 9020 9021 9022 9023 9024 9025 9026 9027 9028 9029 9030 9031 9032 9033 9034 9035 9036 9037 9038 9039 9040 9041 9042 9043 9044 9045 9046 9047 9048 9049 9050 9051 9052 9053 9054 9055 9056 9057 9058 9059 9060 9061 9062 9063 9064 9065 9066 9067 9068 9069 9070 9071 9072 9073 9074 9075 9076 9077 9078 9079 9080 9081 9082 9083 9084 9085 9086 9087 9088 9089 9090 9091 9092 9093 9094 9095 9096 9097 9098 9099 9100 9101 9102 9103 9104 9105 9106 9107 9108 9109 9110 9111 9112 9113 9114 9115 9116 9117 9118 9119 9120 9121 9122 9123 9124 9125 9126 9127 9128 9129 9130 9131 9132 9133 9134 9135 9136 9137 9138 9139 9140 9141 9142 9143 9144 9145 9146 9147 9148 9149 9150 9151 9152 9153 9154 9155 9156 9157 9158 9159 9160 9161 9162 9163 9164 9165 9166 9167 9168 9169 9170 9171 9172 9173 9174 9175 9176 9177 9178 9179 9180 9181 9182 9183 9184 9185 9186 9187 9188 9189 9190 9191 9192 9193 9194 9195 9196 9197 9198 9199 9200 9201 9202 9203 9204 9205 9206 9207 9208 9209 9210 9211 9212 9213 9214 9215 9216 9217 9218 9219 9220 9221 9222 9223 9224 9225 9226 9227 9228 9229 9230 9231 9232 9233 9234 9235 9236 9237 9238 9239 9240 9241 9242 9243 9244 9245 9246 9247 9248 9249 9250 9251 9252 9253 9254 9255 9256 9257 9258 9259 9260 9261 9262 9263 9264 9265 9266 9267 9268 9269 9270 9271 9272 9273 9274 9275 9276 9277 9278 9279 9280 9281 9282 9283 9284 9285 9286 9287 9288 9289 9290 9291 9292 9293 9294 9295 9296 9297 9298 9299 9300 9301 9302 9303 9304 9305 9306 9307 9308 9309 9310 9311 9312 9313 9314 9315 9316 9317 9318 9319 9320 9321 9322 9323 9324 9325 9326 9327 9328 9329 9330 9331 9332 9333 9334 9335 9336 9337 9338 9339 9340 9341 9342 9343 9344 9345 9346 9347 9348 9349 9350 9351 9352 9353 9354 9355 9356 9357 9358 9359 9360 9361 9362 9363 9364 9365 9366 9367 9368 9369 9370 9371 9372 9373 9374 9375 9376 9377 9378 9379 9380 9381 9382 9383 9384 9385 9386 9387 9388 9389 9390 9391 9392 9393 9394 9395 9396 9397 9398 9399 9400 9401 9402 9403 9404 9405 9406 9407 9408 9409 9410 9411 9412 9413 9414 9415 9416 9417 9418 9419 9420 9421 9422 9423 9424 9425 9426 9427 9428 9429 9430 9431 9432 9433 9434 9435 9436 9437 9438 9439 9440 9441 9442 9443 9444 9445 9446 9447 9448 9449 9450 9451 9452 9453 9454 9455 9456 9457 9458 9459 9460 9461 9462 9463 9464 9465 9466 9467 9468 9469 9470 9471 9472 9473 9474 9475 9476 9477 9478 9479 9480 9481 9482 9483 9484 9485 9486 9487 9488 9489 9490 9491 9492 9493 9494 9495 9496 9497 9498 9499 9500 9501 9502 9503 9504 9505 9506 9507 9508 9509 9510 9511 9512 9513 9514 9515 9516 9517 9518 9519 9520 9521 9522 9523 9524 9525 9526 9527 9528 9529 9530 9531 9532 9533 9534 9535 9536 9537 9538 9539 9540 9541 9542 9543 9544 9545 9546 9547 9548 9549 9550 9551 9552 9553 9554 9555 9556 9557 9558 9559 9560 9561 9562 9563 9564 9565 9566 9567 9568 9569 9570 9571 9572 9573 9574 9575 9576 9577 9578 9579 9580 9581 9582 9583 9584 9585 9586 9587 9588 9589 9590 9591 9592 9593 9594 9595 9596 9597 9598 9599 9600 9601 9602 9603 9604 9605 9606 9607 9608 9609 9610 9611 9612 9613 9614 9615 9616 9617 9618 9619 9620 9621 9622 9623 9624 9625 9626 9627 9628 9629 9630 9631 9632 9633 9634 9635 9636 9637 9638 9639 9640 9641 9642 9643 9644 9645 9646 9647 9648 9649 9650 9651 9652 9653 9654 9655 9656 9657 9658 9659 9660 9661 9662 9663 9664 9665 9666 9667 9668 9669 9670 9671 9672 9673 9674 9675 9676 9677 9678 9679 9680 9681 9682 9683 9684 9685 9686 9687 9688 9689 9690 9691 9692 9693 9694 9695 9696 9697 9698 9699 9700 9701 9702 9703 9704 9705 9706 9707 9708 9709 9710 9711 9712 9713 9714 9715 9716 9717 9718 9719 9720 9721 9722 9723 9724 9725 9726 9727 9728 9729 9730 9731 9732 9733 9734 9735 9736 9737 9738 9739 9740 9741 9742 9743 9744 9745 9746 9747 9748 9749 9750 9751 9752 9753 9754 9755 9756 9757 9758 9759 9760 9761 9762 9763 9764 9765 9766 9767 9768 9769 9770 9771 9772 9773 9774 9775 9776 9777 9778 9779 9780 9781 9782 9783 9784 9785 9786 9787 9788 9789 9790 9791 9792 9793 9794 9795 9796 9797 9798 9799 9800 9801 9802 9803 9804 9805 9806 9807 9808 9809 9810 9811 9812 9813 9814 9815 9816 9817 9818 9819 9820 9821 9822 9823 9824 9825 9826 9827 9828 9829 9830 9831 9832 9833 9834 9835 9836 9837 9838 9839 9840 9841 9842 9843 9844 9845 9846 9847 9848 9849 9850 9851 9852 9853 9854 9855 9856 9857 9858 9859 9860 9861 9862 9863 9864 9865 9866 9867 9868 9869 9870 9871 9872 9873 9874 9875 9876 9877 9878 9879 9880 9881 9882 9883 9884 9885 9886 9887 9888 9889 9890 9891 9892 9893 9894 9895 9896 9897 9898 9899 9900 9901 9902 9903 9904 9905 9906 9907 9908 9909 9910 9911 9912 9913 9914 9915 9916 9917 9918 9919 9920 9921 9922 9923 9924 9925 9926 9927 9928 9929 9930 9931 9932 9933 9934 9935 9936 9937 9938 9939 9940 9941 9942 9943 9944 9945 9946 9947 9948 9949 9950 9951 9952 9953 9954 9955 9956 9957 9958 9959 9960 9961 9962 9963 9964 9965 9966 9967 9968 9969 9970 9971 9972 9973 9974 9975 9976 9977 9978 9979 9980 9981 9982 9983 9984 9985 9986 9987 9988 9989 9990 9991 9992 9993 9994 9995 9996 9997 9998 9999 10000 10001 10002 10003 10004 10005 10006 10007 10008 10009 10010 10011 10012 10013 10014 10015 10016 10017 10018 10019 10020 10021 10022 10023 10024 10025 10026 10027 10028 10029 10030 10031 10032 10033 10034 10035 10036 10037 10038 10039 10040 10041 10042 10043 10044 10045 10046 10047 10048 10049 10050 10051 10052 10053 10054 10055 10056 10057 10058 10059 10060 10061 10062 10063 10064 10065 10066 10067 10068 10069 10070 10071 10072 10073 10074 10075 10076 10077 10078 10079 10080 10081 10082 10083 10084 10085 10086 10087 10088 10089 10090 10091 10092 10093 10094 10095 10096 10097 10098 10099 10100 10101 10102 10103 10104 10105 10106 10107 10108 10109 10110 10111 10112 10113 10114 10115 10116 10117 10118 10119 10120 10121 10122 10123 10124 10125 10126 10127 10128 10129 10130 10131 10132 10133 10134 10135 10136 10137 10138 10139 10140 10141 10142 10143 10144 10145 10146 10147 10148 10149 10150 10151 10152 10153 10154 10155 10156 10157 10158 10159 10160 10161 10162 10163 10164 10165 10166 10167 10168 10169 10170 10171 10172 10173 10174 10175 10176 10177 10178 10179 10180 10181 10182 10183 10184 10185 10186 10187 10188 10189 10190 10191 10192 10193 10194 10195 10196 10197 10198 10199 10200 10201 10202 10203 10204 10205 10206 10207 10208 10209 10210 10211 10212 10213 10214 10215 10216 10217 10218 10219 10220 10221 10222 10223 10224 10225 10226 10227 10228 10229 10230 10231 10232 10233 10234 10235 10236 10237 10238 10239 10240 10241 10242 10243 10244 10245 10246 10247 10248 10249 10250 10251 10252 10253 10254 10255 10256 10257 10258 10259 10260 10261 10262 10263 10264 10265 10266 10267 10268 10269 10270 10271 10272 10273 10274 10275 10276 10277 10278 10279 10280 10281 10282 10283 10284 10285 10286 10287 10288 10289 10290 10291 10292 10293 10294 10295 10296 10297 10298 10299 10300 10301 10302 10303 10304 10305 10306 10307 10308 10309 10310 10311 10312 10313 10314 10315 10316 10317 10318 10319 10320 10321 10322 10323 10324 10325 10326 10327 10328 10329 10330 10331 10332 10333 10334 10335 10336 10337 10338 10339 10340 10341 10342 10343 10344 10345 10346 10347 10348 10349 10350 10351 10352 10353 10354 10355 10356 10357 10358 10359 10360 10361 10362 10363 10364 10365 10366 10367 10368 10369 10370 10371 10372 10373 10374 10375 10376 10377 10378 10379 10380 10381 10382 10383 10384 10385 10386 10387 10388 10389 10390 10391 10392 10393 10394 10395 10396 10397 10398 10399 10400 10401 10402 10403 10404 10405 10406 10407 10408 10409 10410 10411 10412 10413 10414 10415 10416 10417 10418 10419 10420 10421 10422 10423 10424 10425 10426 10427 10428 10429 10430 10431 10432 10433 10434 10435 10436 10437 10438 10439 10440 10441 10442 10443 10444 10445 10446 10447 10448 10449 10450 10451 10452 10453 10454 10455 10456 10457 10458 10459 10460 10461 10462 10463 10464 10465 10466 10467 10468 10469 10470 10471 10472 10473 10474 10475 10476 10477 10478 10479 10480 10481 10482 10483 10484 10485 10486 10487 10488 10489 10490 10491 10492 10493 10494 10495 10496 10497 10498 10499 10500 10501 10502 10503 10504 10505 10506 10507 10508 10509 10510 10511 10512 10513 10514 10515 10516 10517 10518 10519 10520 10521 10522 10523 10524 10525 10526 10527 10528 10529 10530 10531 10532 10533 10534 10535 10536 10537 10538 10539 10540 10541 10542 10543 10544 10545 10546 10547 10548 10549 10550 10551 10552 10553 10554 10555 10556 10557 10558 10559 10560 10561 10562 10563 10564 10565 10566 10567 10568 10569 10570 10571 10572 10573 10574 10575 10576 10577 10578 10579 10580 10581 10582 10583 10584 10585 10586 10587 10588 10589 10590 10591 10592 10593 10594 10595 10596 10597 10598 10599 10600 10601 10602 10603 10604 10605 10606 10607 10608 10609 10610 10611 10612 10613 10614 10615 10616 10617 10618 10619 10620 10621 10622 10623 10624 10625 10626 10627 10628 10629 10630 10631 10632 10633 10634 10635 10636 10637 10638 10639 10640 10641 10642 10643 10644 10645 10646 10647 10648 10649 10650 10651 10652 10653 10654 10655 10656 10657 10658 10659 10660 10661 10662 10663 10664 10665 10666 10667 10668 10669 10670 10671 10672 10673 10674 10675 10676 10677 10678 10679 10680 10681 10682 10683 10684 10685 10686 10687 10688 10689 10690 10691 10692 10693 10694 10695 10696 10697 10698 10699 10700 10701 10702 10703 10704 10705 10706 10707 10708 10709 10710 10711 10712 10713 10714 10715 10716 10717 10718 10719 10720 10721 10722 10723 10724 10725 10726 10727 10728 10729 10730 10731 10732 10733 10734 10735 10736 10737 10738 10739 10740 10741 10742 10743 10744 10745 10746 10747 10748 10749 10750 10751 10752 10753 10754 10755 10756 10757 10758 10759 10760 10761 10762 10763 10764 10765 10766 10767 10768 10769 10770 10771 10772 10773 10774 10775 10776 10777 10778 10779 10780 10781 10782 10783 10784 10785 10786 10787 10788 10789 10790 10791 10792 10793 10794 10795 10796 10797 10798 10799 10800 10801 10802 10803 10804 10805 10806 10807 10808 10809 10810 10811 10812 10813 10814 10815 10816 10817 10818 10819 10820 10821 10822 10823 10824 10825 10826 10827 10828 10829 10830 10831 10832 10833 10834 10835 10836 10837 10838 10839 10840 10841 10842 10843 10844 10845 10846 10847 10848 10849 10850 10851 10852 10853 10854 10855 10856 10857 10858 10859 10860 10861 10862 10863 10864 10865 10866 10867 10868 10869 10870 10871 10872 10873 10874 10875 10876 10877 10878 10879 10880 10881 10882 10883 10884 10885 10886 10887 10888 10889 10890 10891 10892 10893 10894 10895 10896 10897 10898 10899 10900 10901 10902 10903 10904 10905 10906 10907 10908 10909 10910 10911 10912 10913 10914 10915 10916 10917 10918 10919 10920 10921 10922 10923 10924 10925 10926 10927 10928 10929 10930 10931 10932 10933 10934 10935 10936 10937 10938 10939 10940 10941 10942 10943 10944 10945 10946 10947 10948 10949 10950 10951 10952 10953 10954 10955 10956 10957 10958 10959 10960 10961 10962 10963 10964 10965 10966 10967 10968 10969 10970 10971 10972 10973 10974 10975 10976 10977 10978 10979 10980 10981 10982 10983 10984 10985 10986 10987 10988 10989 10990 10991 10992 10993 10994 10995 10996 10997 10998 10999 11000 11001 11002 11003 11004 11005 11006 11007 11008 11009 11010 11011 11012 11013 11014 11015 11016 11017 11018 11019 11020 11021 11022 11023 11024 11025 11026 11027 11028 11029 11030 11031 11032 11033 11034 11035 11036 11037 11038 11039 11040 11041 11042 11043 11044 11045 11046 11047 11048 11049 11050 11051 11052 11053 11054 11055 11056 11057 11058 11059 11060 11061 11062 11063 11064 11065 11066 11067 11068 11069 11070 11071 11072 11073 11074 11075 11076 11077 11078 11079 11080 11081 11082 11083 11084 11085 11086 11087 11088 11089 11090 11091 11092 11093 11094 11095 11096 11097 11098 11099 11100 11101 11102 11103 11104 11105 11106 11107 11108 11109 11110 11111 11112 11113 11114 11115 11116 11117 11118 11119 11120 11121 11122 11123 11124 11125 11126 11127 11128 11129 11130 11131 11132 11133 11134 11135 11136 11137 11138 11139 11140 11141 11142 11143 11144 11145 11146 11147 11148 11149 11150 11151 11152 11153 11154 11155 11156 11157 11158 11159 11160 11161 11162 11163 11164 11165 11166 11167 11168 11169 11170 11171 11172 11173 11174 11175 11176 11177 11178 11179 11180 11181 11182 11183 11184 11185 11186 11187 11188 11189 11190 11191 11192 11193 11194 11195 11196 11197 11198 11199 11200 11201 11202 11203 11204 11205 11206 11207 11208 11209 11210 11211 11212 11213 11214 11215 11216 11217 11218 11219 11220 11221 11222 11223 11224 11225 11226 11227 11228 11229 11230 11231 11232 11233 11234 11235 11236 11237 11238 11239 11240 11241 11242 11243 11244 11245 11246 11247 11248 11249 11250 11251 11252 11253 11254 11255 11256 11257 11258 11259 11260 11261 11262 11263 11264 11265 11266 11267 11268 11269 11270 11271 11272 11273 11274 11275 11276 11277 11278 11279 11280 11281 11282 11283 11284 11285 11286 11287 11288 11289 11290 11291 11292 11293 11294 11295 11296 11297 11298 11299 11300 11301 11302 11303 11304 11305 11306 11307 11308 11309 11310 11311 11312 11313 11314 11315 11316 11317 11318 11319 11320 11321 11322 11323 11324 11325 11326 11327 11328 11329 11330 11331 11332 11333 11334 11335 11336 11337 11338 11339 11340 11341 11342 11343 11344 11345 11346 11347 11348 11349 11350 11351 11352 11353 11354 11355 11356 11357 11358 11359 11360 11361 11362 11363 11364 11365 11366 11367 11368 11369 11370 11371 11372 11373 11374 11375 11376 11377 11378 11379 11380 11381 11382 11383 11384 11385 11386 11387 11388 11389 11390 11391 11392 11393 11394 11395 11396 11397 11398 11399 11400 11401 11402 11403 11404 11405 11406 11407 11408 11409 11410 11411 11412 11413 11414 11415 11416 11417 11418 11419 11420 11421 11422 11423 11424 11425 11426 11427 11428 11429 11430 11431 11432 11433 11434 11435 11436 11437 11438 11439 11440 11441 11442 11443 11444 11445 11446 11447 11448 11449 11450 11451 11452 11453 11454 11455 11456 11457 11458 11459 11460 11461 11462 11463 11464 11465 11466 11467 11468 11469 11470 11471 11472 11473 11474 11475 11476 11477 11478 11479 11480 11481 11482 11483 11484 11485 11486 11487 11488 11489 11490 11491 11492 11493 11494 11495 11496 11497 11498 11499 11500 11501 11502 11503 11504 11505 11506 11507 11508 11509 11510 11511 11512 11513 11514 11515 11516 11517 11518 11519 11520 11521 11522 11523 11524 11525 11526 11527 11528 11529 11530 11531 11532 11533 11534 11535 11536 11537 11538 11539 11540 11541 11542 11543 11544 11545 11546 11547 11548 11549 11550 11551 11552 11553 11554 11555 11556 11557 11558 11559 11560 11561 11562 11563 11564 11565 11566 11567 11568 11569 11570 11571 11572 11573 11574 11575 11576 11577 11578 11579 11580 11581 11582 11583 11584 11585 11586 11587 11588 11589 11590 11591 11592 11593 11594 11595 11596 11597 11598 11599 11600 11601 11602 11603 11604 11605 11606 11607 11608 11609 11610 11611 11612 11613 11614 11615 11616 11617 11618 11619 11620 11621 11622 11623 11624 11625 11626 11627 11628 11629 11630 11631 11632 11633 11634 11635 11636 11637 11638 11639 11640 11641 11642 11643 11644 11645 11646 11647 11648 11649 11650 11651 11652 11653 11654 11655 11656 11657 11658 11659 11660 11661 11662 11663 11664 11665 11666 11667 11668 11669 11670 11671 11672 11673 11674 11675 11676 11677 11678 11679 11680 11681 11682 11683 11684 11685 11686 11687 11688 11689 11690 11691 11692 11693 11694 11695 11696 11697 11698 11699 11700 11701 11702 11703 11704 11705 11706 11707 11708 11709 11710 11711 11712 11713 11714 11715 11716 11717 11718 11719 11720 11721 11722 11723 11724 11725 11726 11727 11728 11729 11730 11731 11732 11733 11734 11735 11736 11737 11738 11739 11740 11741 11742 11743 11744 11745 11746 11747 11748 11749 11750 11751 11752 11753 11754 11755 11756 11757 11758 11759 11760 11761 11762 11763 11764 11765 11766 11767 11768 11769 11770 11771 11772 11773 11774 11775 11776 11777 11778 11779 11780 11781 11782 11783 11784 11785 11786 11787 11788 11789 11790 11791 11792 11793 11794 11795 11796 11797 11798 11799 11800 11801 11802 11803 11804 11805 11806 11807 11808 11809 11810 11811 11812 11813 11814 11815 11816 11817 11818 11819 11820 11821 11822 11823 11824 11825 11826 11827 11828 11829 11830 11831 11832 11833 11834 11835 11836 11837 11838 11839 11840 11841 11842 11843 11844 11845 11846 11847 11848 11849 11850 11851 11852 11853 11854 11855 11856 11857 11858 11859 11860 11861 11862 11863 11864 11865 11866 11867 11868 11869 11870 11871 11872 11873 11874 11875 11876 11877 11878 11879 11880 11881 11882 11883 11884 11885 11886 11887 11888 11889 11890 11891 11892 11893 11894 11895 11896 11897 11898 11899 11900 11901 11902 11903 11904 11905 11906 11907 11908 11909 11910 11911 11912 11913 11914 11915 11916 11917 11918 11919 11920 11921 11922 11923 11924 11925 11926 11927 11928 11929 11930 11931 11932 11933 11934 11935 11936 11937 11938 11939 11940 11941 11942 11943 11944 11945 11946 11947 11948 11949 11950 11951 11952 11953 11954 11955 11956 11957 11958 11959 11960 11961 11962 11963 11964 11965 11966 11967 11968 11969 11970 11971 11972 11973 11974 11975 11976 11977 11978 11979 11980 11981 11982 11983 11984 11985 11986 11987 11988 11989 11990 11991 11992 11993 11994 11995 11996 11997 11998 11999 12000 12001 12002 12003 12004 12005 12006 12007 12008 12009 12010 12011 12012 12013 12014 12015 12016 12017 12018 12019 12020 12021 12022 12023 12024 12025 12026 12027 12028 12029 12030 12031 12032 12033 12034 12035 12036 12037 12038 12039 12040 12041 12042 12043 12044 12045 12046 12047 12048 12049 12050 12051 12052 12053 12054 12055 12056 12057 12058 12059 12060 12061 12062 12063 12064 12065 12066 12067 12068 12069 12070 12071 12072 12073 12074 12075 12076 12077 12078 12079 12080 12081 12082 12083 12084 12085 12086 12087 12088 12089 12090 12091 12092 12093 12094 12095 12096 12097 12098 12099 12100 12101 12102 12103 12104 12105 12106 12107 12108 12109 12110 12111 12112 12113 12114 12115 12116 12117 12118 12119 12120 12121 12122 12123 12124 12125 12126 12127 12128 12129 12130 12131 12132 12133 12134 12135 12136 12137 12138 12139 12140 12141 12142 12143 12144 12145 12146 12147 12148 12149 12150 12151 12152 12153 12154 12155 12156 12157 12158 12159 12160 12161 12162 12163 12164 12165 12166 12167 12168 12169 12170 12171 12172 12173 12174 12175 12176 12177 12178 12179 12180 12181 12182 12183 12184 12185 12186 12187 12188 12189 12190 12191 12192 12193 12194 12195 12196 12197 12198 12199 12200 12201 12202 12203 12204 12205 12206 12207 12208 12209 12210 12211 12212 12213 12214 12215 12216 12217 12218 12219 12220 12221 12222 12223 12224 12225 12226 12227 12228 12229 12230 12231 12232 12233 12234 12235 12236 12237 12238 12239 12240 12241 12242 12243 12244 12245 12246 12247 12248 12249 12250 12251 12252 12253 12254 12255 12256 12257 12258 12259 12260 12261 12262 12263 12264 12265 12266 12267 12268 12269 12270 12271 12272 12273 12274 12275 12276 12277 12278 12279 12280 12281 12282 12283 12284 12285 12286 12287 12288 12289 12290 12291 12292 12293 12294 12295 12296 12297 12298 12299 12300 12301 12302 12303 12304 12305 12306 12307 12308 12309 12310 12311 12312 12313 12314 12315 12316 12317 12318 12319 12320 12321 12322 12323 12324 12325 12326 12327 12328 12329 12330 12331 12332 12333 12334 12335 12336 12337 12338 12339 12340 12341 12342 12343 12344 12345 12346 12347 12348 12349 12350 12351 12352 12353 12354 12355 12356 12357 12358 12359 12360 12361 12362 12363 12364 12365 12366 12367 12368 12369 12370 12371 12372 12373 12374 12375 12376 12377 12378 12379 12380 12381 12382 12383 12384 12385 12386 12387 12388 12389 12390 12391 12392 12393 12394 12395 12396 12397 12398 12399 12400 12401 12402 12403 12404 12405 12406 12407 12408 12409 12410 12411 12412 12413 12414 12415 12416 12417 12418 12419 12420 12421 12422 12423 12424 12425 12426 12427 12428 12429 12430 12431 12432 12433 12434 12435 12436 12437 12438 12439 12440 12441 12442 12443 12444 12445 12446 12447 12448 12449 12450 12451 12452 12453 12454 12455 12456 12457 12458 12459 12460 12461 12462 12463 12464 12465 12466 12467 12468 12469 12470 12471 12472 12473 12474 12475 12476 12477 12478 12479 12480 12481 12482 12483 12484 12485 12486 12487 12488 12489 12490 12491 12492 12493 12494 12495 12496 12497 12498 12499 12500 12501 12502 12503 12504 12505 12506 12507 12508 12509 12510 12511 12512 12513 12514 12515 12516 12517 12518 12519 12520 12521 12522 12523 12524 12525 12526 12527 12528 12529 12530 12531 12532 12533 12534 12535 12536 12537 12538 12539 12540 12541 12542 12543 12544 12545 12546 12547 12548 12549 12550 12551 12552 12553 12554 12555 12556 12557 12558 12559 12560 12561 12562 12563 12564 12565 12566 12567 12568 12569 12570 12571 12572 12573 12574 12575 12576 12577 12578 12579 12580 12581 12582 12583 12584 12585 12586 12587 12588 12589 12590 12591 12592 12593 12594 12595 12596 12597 12598 12599 12600 12601 12602 12603 12604 12605 12606 12607 12608 12609 12610 12611 12612 12613 12614 12615 12616 12617 12618 12619 12620 12621 12622 12623 12624 12625 12626 12627 12628 12629 12630 12631 12632 12633 12634 12635 12636 12637 12638 12639 12640 12641 12642 12643 12644 12645 12646 12647 12648 12649 12650 12651 12652 12653 12654 12655 12656 12657 12658 12659 12660 12661 12662 12663 12664 12665 12666 12667 12668 12669 12670 12671 12672 12673 12674 12675 12676 12677 12678 12679 12680 12681 12682 12683 12684 12685 12686 12687 12688 12689 12690 12691 12692 12693 12694 12695 12696 12697 12698 12699 12700 12701 12702 12703 12704 12705 12706 12707 12708 12709 12710 12711 12712 12713 12714 12715 12716 12717 12718 12719 12720 12721 12722 12723 12724 12725 12726 12727 12728 12729 12730 12731 12732 12733 12734 12735 12736 12737 12738 12739 12740 12741 12742 12743 12744 12745 12746 12747 12748 12749 12750 12751 12752 12753 12754 12755 12756 12757 12758 12759 12760 12761 12762 12763 12764 12765 12766 12767 12768 12769 12770 12771 12772 12773 12774 12775 12776 12777 12778 12779 12780 12781 12782 12783 12784 12785 12786 12787 12788 12789 12790 12791 12792 12793 12794 12795 12796 12797 12798 12799 12800 12801 12802 12803 12804 12805 12806 12807 12808 12809 12810 12811 12812 12813 12814 12815 12816 12817 12818 12819 12820 12821 12822 12823 12824 12825 12826 12827 12828 12829 12830 12831 12832 12833 12834 12835 12836 12837 12838 12839 12840 12841 12842 12843 12844 12845 12846 12847 12848 12849 12850 12851 12852 12853 12854 12855 12856 12857 12858 12859 12860 12861 12862 12863 12864 12865 12866 12867 12868 12869 12870 12871 12872 12873 12874 12875 12876 12877 12878 12879 12880 12881 12882 12883 12884 12885 12886 12887 12888 12889 12890 12891 12892 12893 12894 12895 12896 12897 12898 12899 12900 12901 12902 12903 12904 12905 12906 12907 12908 12909 12910 12911 12912 12913 12914 12915 12916 12917 12918 12919 12920 12921 12922 12923 12924 12925 12926 12927 12928 12929 12930 12931 12932 12933 12934 12935 12936 12937 12938 12939 12940 12941 12942 12943 12944 12945 12946 12947 12948 12949 12950 12951 12952 12953 12954 12955 12956 12957 12958 12959 12960 12961 12962 12963 12964 12965 12966 12967 12968 12969 12970 12971 12972 12973 12974 12975 12976 12977 12978 12979 12980 12981 12982 12983 12984 12985 12986 12987 12988 12989 12990 12991 12992 12993 12994 12995 12996 12997 12998 12999 13000 13001 13002 13003 13004 13005 13006 13007 13008 13009 13010 13011 13012 13013 13014 13015 13016 13017 13018 13019 13020 13021 13022 13023 13024 13025 13026 13027 13028 13029 13030 13031 13032 13033 13034 13035 13036 13037 13038 13039 13040 13041 13042 13043 13044 13045 13046 13047 13048 13049 13050 13051 13052 13053 13054 13055 13056 13057 13058 13059 13060 13061 13062 13063 13064 13065 13066 13067 13068 13069 13070 13071 13072 13073 13074 13075 13076 13077 13078 13079 13080 13081 13082 13083 13084 13085 13086 13087 13088 13089 13090 13091 13092 13093 13094 13095 13096 13097 13098 13099 13100 13101 13102 13103 13104 13105 13106 13107 13108 13109 13110 13111 13112 13113 13114 13115 13116 13117 13118 13119 13120 13121 13122 13123 13124 13125 13126 13127 13128 13129 13130 13131 13132 13133 13134 13135 13136 13137 13138 13139 13140 13141 13142 13143 13144 13145 13146 13147 13148 13149 13150 13151 13152 13153 13154 13155 13156 13157 13158 13159 13160 13161 13162 13163 13164 13165 13166 13167 13168 13169 13170 13171 13172 13173 13174 13175 13176 13177 13178 13179 13180 13181 13182 13183 13184 13185 13186 13187 13188 13189 13190 13191 13192 13193 13194 13195 13196 13197 13198 13199 13200 13201 13202 13203 13204 13205 13206 13207 13208 13209 13210 13211 13212 13213 13214 13215 13216 13217 13218 13219 13220 13221 13222 13223 13224 13225 13226 13227 13228 13229 13230 13231 13232 13233 13234 13235 13236 13237 13238 13239 13240 13241 13242 13243 13244 13245 13246 13247 13248 13249 13250 13251 13252 13253 13254 13255 13256 13257 13258 13259 13260 13261 13262 13263 13264 13265 13266 13267 13268 13269 13270 13271 13272 13273 13274 13275 13276 13277 13278 13279 13280 13281 13282 13283 13284 13285 13286 13287 13288 13289 13290 13291 13292 13293 13294 13295 13296 13297 13298 13299 13300 13301 13302 13303 13304 13305 13306 13307 13308 13309 13310 13311 13312 13313 13314 13315 13316 13317 13318 13319 13320 13321 13322 13323 13324 13325 13326 13327 13328 13329 13330 13331 13332 13333 13334 13335 13336 13337 13338 13339 13340 13341 13342 13343 13344 13345 13346 13347 13348 13349 13350 13351 13352 13353 13354 13355 13356 13357 13358 13359 13360 13361 13362 13363 13364 13365 13366 13367 13368 13369 13370 13371 13372 13373 13374 13375 13376 13377 13378 13379 13380 13381 13382 13383 13384 13385 13386 13387 13388 13389 13390 13391 13392 13393 13394 13395 13396 13397 13398 13399 13400 13401 13402 13403 13404 13405 13406 13407 13408 13409 13410 13411 13412 13413 13414 13415 13416 13417 13418 13419 13420 13421 13422 13423 13424 13425 13426 13427 13428 13429 13430 13431 13432 13433 13434 13435 13436 13437 13438 13439 13440 13441 13442 13443 13444 13445 13446 13447 13448 13449 13450 13451 13452 13453 13454 13455 13456 13457 13458 13459 13460 13461 13462 13463 13464 13465 13466 13467 13468 13469 13470 13471 13472 13473 13474 13475 13476 13477 13478 13479 13480 13481 13482 13483 13484 13485 13486 13487 13488 13489 13490 13491 13492 13493 13494 13495 13496 13497 13498 13499 13500 13501 13502 13503 13504 13505 13506 13507 13508 13509 13510 13511 13512 13513 13514 13515 13516 13517 13518 13519 13520 13521 13522 13523 13524 13525 13526 13527 13528 13529 13530 13531 13532 13533 13534 13535 13536 13537 13538 13539 13540 13541 13542 13543 13544 13545 13546 13547 13548 13549 13550 13551 13552 13553 13554 13555 13556 13557 13558 13559 13560 13561 13562 13563 13564 13565 13566 13567 13568 13569 13570 13571 13572 13573 13574 13575 13576 13577 13578 13579 13580 13581 13582 13583 13584 13585 13586 13587 13588 13589 13590 13591 13592 13593 13594 13595 13596 13597 13598 13599 13600 13601 13602 13603 13604 13605 13606 13607 13608 13609 13610 13611 13612 13613 13614 13615 13616 13617 13618 13619 13620 13621 13622 13623 13624 13625 13626 13627 13628 13629 13630 13631 13632 13633 13634 13635 13636 13637 13638 13639 13640 13641 13642 13643 13644 13645 13646 13647 13648 13649 13650 13651 13652 13653 13654 13655 13656 13657 13658 13659 13660 13661 13662 13663 13664 13665 13666 13667 13668 13669 13670 13671 13672 13673 13674 13675 13676 13677 13678 13679 13680 13681 13682 13683 13684 13685 13686 13687 13688 13689 13690 13691 13692 13693 13694 13695 13696 13697 13698 13699 13700 13701 13702 13703 13704 13705 13706 13707 13708 13709 13710 13711 13712 13713 13714 13715 13716 13717 13718 13719 13720 13721 13722 13723 13724 13725 13726 13727 13728 13729 13730 13731 13732 13733 13734 13735 13736 13737 13738 13739 13740 13741 13742 13743 13744 13745 13746 13747 13748 13749 13750 13751 13752 13753 13754 13755 13756 13757 13758 13759 13760 13761 13762 13763 13764 13765 13766 13767 13768 13769 13770 13771 13772 13773 13774 13775 13776 13777 13778 13779 13780 13781 13782 13783 13784 13785 13786 13787 13788 13789 13790 13791 13792 13793 13794 13795 13796 13797 13798 13799 13800 13801 13802 13803 13804 13805 13806 13807 13808 13809 13810 13811 13812 13813 13814 13815 13816 13817 13818 13819 13820 13821 13822 13823 13824 13825 13826 13827 13828 13829 13830 13831 13832 13833 13834 13835 13836 13837 13838 13839 13840 13841 13842 13843 13844 13845 13846 13847 13848 13849 13850 13851 13852 13853 13854 13855 13856 13857 13858 13859 13860 13861 13862 13863 13864 13865 13866 13867 13868 13869 13870 13871 13872 13873 13874 13875 13876 13877 13878 13879 13880 13881 13882 13883 13884 13885 13886 13887 13888 13889 13890 13891 13892 13893 13894 13895 13896 13897 13898 13899 13900 13901 13902 13903 13904 13905 13906 13907 13908 13909 13910 13911 13912 13913 13914 13915 13916 13917 13918 13919 13920 13921 13922 13923 13924 13925 13926 13927 13928 13929 13930 13931 13932 13933 13934 13935 13936 13937 13938 13939 13940 13941 13942 13943 13944 13945 13946 13947 13948 13949 13950 13951 13952 13953 13954 13955 13956 13957 13958 13959 13960 13961 13962 13963 13964 13965 13966 13967 13968 13969 13970 13971 13972 13973 13974 13975 13976 13977 13978 13979 13980 13981 13982 13983 13984 13985 13986 13987 13988 13989 13990 13991 13992 13993 13994 13995 13996 13997 13998 13999 14000 14001 14002 14003 14004 14005 14006 14007 14008 14009 14010 14011 14012 14013 14014 14015 14016 14017 14018 14019 14020 14021 14022 14023 14024 14025 14026 14027 14028 14029 14030 14031 14032 14033 14034 14035 14036 14037 14038 14039 14040 14041 14042 14043 14044 14045 14046 14047 14048 14049 14050 14051 14052 14053 14054 14055 14056 14057 14058 14059 14060 14061 14062 14063 14064 14065 14066 14067 14068 14069 14070 14071 14072 14073 14074 14075 14076 14077 14078 14079 14080 14081 14082 14083 14084 14085 14086 14087 14088 14089 14090 14091 14092 14093 14094 14095 14096 14097 14098 14099 14100 14101 14102 14103 14104 14105 14106 14107 14108 14109 14110 14111 14112 14113 14114 14115 14116 14117 14118 14119 14120 14121 14122 14123 14124 14125 14126 14127 14128 14129 14130 14131 14132 14133 14134 14135 14136 14137 14138 14139 14140 14141 14142 14143 14144 14145 14146 14147 14148 14149 14150 14151 14152 14153 14154 14155 14156 14157 14158 14159 14160 14161 14162 14163 14164 14165 14166 14167 14168 14169 14170 14171 14172 14173 14174 14175 14176 14177 14178 14179 14180 14181 14182 14183 14184 14185 14186 14187 14188 14189 14190 14191 14192 14193 14194 14195 14196 14197 14198 14199 14200 14201 14202 14203 14204 14205 14206 14207 14208 14209 14210 14211 14212 14213 14214 14215 14216 14217 14218 14219 14220 14221 14222 14223 14224 14225 14226 14227 14228 14229 14230 14231 14232 14233 14234 14235 14236 14237 14238 14239 14240 14241 14242 14243 14244 14245 14246 14247 14248 14249 14250 14251 14252 14253 14254 14255 14256 14257 14258 14259 14260 14261 14262 14263 14264 14265 14266 14267 14268 14269 14270 14271 14272 14273 14274 14275 14276 14277 14278 14279 14280 14281 14282 14283 14284 14285 14286 14287 14288 14289 14290 14291 14292 14293 14294 14295 14296 14297 14298 14299 14300 14301 14302 14303 14304 14305 14306 14307 14308 14309 14310 14311 14312 14313 14314 14315 14316 14317 14318 14319 14320 14321 14322 14323 14324 14325 14326 14327 14328 14329 14330 14331 14332 14333 14334 14335 14336 14337 14338 14339 14340 14341 14342 14343 14344 14345 14346 14347 14348 14349 14350 14351 14352 14353 14354 14355 14356 14357 14358 14359 14360 14361 14362 14363 14364 14365 14366 14367 14368 14369 14370 14371 14372 14373 14374 14375 14376 14377 14378 14379 14380 14381 14382 14383 14384 14385 14386 14387 14388 14389 14390 14391 14392 14393 14394 14395 14396 14397 14398 14399 14400 14401 14402 14403 14404 14405 14406 14407 14408 14409 14410 14411 14412 14413 14414 14415 14416 14417 14418 14419 14420 14421 14422 14423 14424 14425 14426 14427 14428 14429 14430 14431 14432 14433 14434 14435 14436 14437 14438 14439 14440 14441 14442 14443 14444 14445 14446 14447 14448 14449 14450 14451 14452 14453 14454 14455 14456 14457 14458 14459 14460 14461 14462 14463 14464 14465 14466 14467 14468 14469 14470 14471 14472 14473 14474 14475 14476 14477 14478 14479 14480 14481 14482 14483 14484 14485 14486 14487 14488 14489 14490 14491 14492 14493 14494 14495 14496 14497 14498 14499 14500 14501 14502 14503 14504 14505 14506 14507 14508 14509 14510 14511 14512 14513 14514 14515 14516 14517 14518 14519 14520 14521 14522 14523 14524 14525 14526 14527 14528 14529 14530 14531 14532 14533 14534 14535 14536 14537 14538 14539 14540 14541 14542 14543 14544 14545 14546 14547 14548 14549 14550 14551 14552 14553 14554 14555 14556 14557 14558 14559 14560 14561 14562 14563 14564 14565 14566 14567 14568 14569 14570 14571 14572 14573 14574 14575 14576 14577 14578 14579 14580 14581 14582 14583 14584 14585 14586 14587 14588 14589 14590 14591 14592 14593 14594 14595 14596 14597 14598 14599 14600 14601 14602 14603 14604 14605 14606 14607 14608 14609 14610 14611 14612 14613 14614 14615 14616 14617 14618 14619 14620 14621 14622 14623 14624 14625 14626 14627 14628 14629 14630 14631 14632 14633 14634 14635 14636 14637 14638 14639 14640 14641 14642 14643 14644 14645 14646 14647 14648 14649 14650 14651 14652 14653 14654 14655 14656 14657 14658 14659 14660 14661 14662 14663 14664 14665 14666 14667 14668 14669 14670 14671 14672 14673 14674 14675 14676 14677 14678 14679 14680 14681 14682 14683 14684 14685 14686 14687 14688 14689 14690 14691 14692 14693 14694 14695 14696 14697 14698 14699 14700 14701 14702 14703 14704 14705 14706 14707 14708 14709 14710 14711 14712 14713 14714 14715 14716 14717 14718 14719 14720 14721 14722 14723 14724 14725 14726 14727 14728 14729 14730 14731 14732 14733 14734 14735 14736 14737 14738 14739 14740 14741 14742 14743 14744 14745 14746 14747 14748 14749 14750 14751 14752 14753 14754 14755 14756 14757 14758 14759 14760 14761 14762 14763 14764 14765 14766 14767 14768 14769 14770 14771 14772 14773 14774 14775 14776 14777 14778 14779 14780 14781 14782 14783 14784 14785 14786 14787 14788 14789 14790 14791 14792 14793 14794 14795 14796 14797 14798 14799 14800 14801 14802 14803 14804 14805 14806 14807 14808 14809 14810 14811 14812 14813 14814 14815 14816 14817 14818 14819 14820 14821 14822 14823 14824 14825 14826 14827 14828 14829 14830 14831 14832 14833 14834 14835 14836 14837 14838 14839 14840 14841 14842 14843 14844 14845 14846 14847 14848 14849 14850 14851 14852 14853 14854 14855 14856 14857 14858 14859 14860 14861 14862 14863 14864 14865 14866 14867 14868 14869 14870 14871 14872 14873 14874 14875 14876 14877 14878 14879 14880 14881 14882 14883 14884 14885 14886 14887 14888 14889 14890 14891 14892 14893 14894 14895 14896 14897 14898 14899 14900 14901 14902 14903 14904 14905 14906 14907 14908 14909 14910 14911 14912 14913 14914 14915 14916 14917 14918 14919 14920 14921 14922 14923 14924 14925 14926 14927 14928 14929 14930 14931 14932 14933 14934 14935 14936 14937 14938 14939 14940 14941 14942 14943 14944 14945 14946 14947 14948 14949 14950 14951 14952 14953 14954 14955 14956 14957 14958 14959 14960 14961 14962 14963 14964 14965 14966 14967 14968 14969 14970 14971 14972 14973 14974 14975 14976 14977 14978 14979 14980 14981 14982 14983 14984 14985 14986 14987 14988 14989 14990 14991 14992 14993 14994 14995 14996 14997 14998 14999 15000 15001 15002 15003 15004 15005 15006 15007 15008 15009 15010 15011 15012 15013 15014 15015 15016 15017 15018 15019 15020 15021 15022 15023 15024 15025 15026 15027 15028 15029 15030 15031 15032 15033 15034 15035 15036 15037 15038 15039 15040 15041 15042 15043 15044 15045 15046 15047 15048 15049 15050 15051 15052 15053 15054 15055 15056 15057 15058 15059 15060 15061 15062 15063 15064 15065 15066 15067 15068 15069 15070 15071 15072 15073 15074 15075 15076 15077 15078 15079 15080 15081 15082 15083 15084 15085 15086 15087 15088 15089 15090 15091 15092 15093 15094 15095 15096 15097 15098 15099 15100 15101 15102 15103 15104 15105 15106 15107 15108 15109 15110 15111 15112 15113 15114 15115 15116 15117 15118 15119 15120 15121 15122 15123 15124 15125 15126 15127 15128 15129 15130 15131 15132 15133 15134 15135 15136 15137 15138 15139 15140 15141 15142 15143 15144 15145 15146 15147 15148 15149 15150 15151 15152 15153 15154 15155 15156 15157 15158 15159 15160 15161 15162 15163 15164 15165 15166 15167 15168 15169 15170 15171 15172 15173 15174 15175 15176 15177 15178 15179 15180 15181 15182 15183 15184 15185 15186 15187 15188 15189 15190 15191 15192 15193 15194 15195 15196 15197 15198 15199 15200 15201 15202 15203 15204 15205 15206 15207 15208 15209 15210 15211 15212 15213 15214 15215 15216 15217 15218 15219 15220 15221 15222 15223 15224 15225 15226 15227 15228 15229 15230 15231 15232 15233 15234 15235 15236 15237 15238 15239 15240 15241 15242 15243 15244 15245 15246 15247 15248 15249 15250 15251 15252 15253 15254 15255 15256 15257 15258 15259 15260 15261 15262 15263 15264 15265 15266 15267 15268 15269 15270 15271 15272 15273 15274 15275 15276 15277 15278 15279 15280 15281 15282 15283 15284 15285 15286 15287 15288 15289 15290 15291 15292 15293 15294 15295 15296 15297 15298 15299 15300 15301 15302 15303 15304 15305 15306 15307 15308 15309 15310 15311 15312 15313 15314 15315 15316 15317 15318 15319 15320 15321 15322 15323 15324 15325 15326 15327 15328 15329 15330 15331 15332 15333 15334 15335 15336 15337 15338 15339 15340 15341 15342 15343 15344 15345 15346 15347 15348 15349 15350 15351 15352 15353 15354 15355 15356 15357 15358 15359 15360 15361 15362 15363 15364 15365 15366 15367 15368 15369 15370 15371 15372 15373 15374 15375 15376 15377 15378 15379 15380 15381 15382 15383 15384 15385 15386 15387 15388 15389 15390 15391 15392 15393 15394 15395 15396 15397 15398 15399 15400 15401 15402 15403 15404 15405 15406 15407 15408 15409 15410 15411 15412 15413 15414 15415 15416 15417 15418 15419 15420 15421 15422 15423 15424 15425 15426 15427 15428 15429 15430 15431 15432 15433 15434 15435 15436 15437 15438 15439 15440 15441 15442 15443 15444 15445 15446 15447 15448 15449 15450 15451 15452 15453 15454 15455 15456 15457 15458 15459 15460 15461 15462 15463 15464 15465 15466 15467 15468 15469 15470 15471 15472 15473 15474 15475 15476 15477 15478 15479 15480 15481 15482 15483 15484 15485 15486 15487 15488 15489 15490 15491 15492 15493 15494 15495 15496 15497 15498 15499 15500 15501 15502 15503 15504 15505 15506 15507 15508 15509 15510 15511 15512 15513 15514 15515 15516 15517 15518 15519 15520 15521 15522 15523 15524 15525 15526 15527 15528 15529 15530 15531 15532 15533 15534 15535 15536 15537 15538 15539 15540 15541 15542 15543 15544 15545 15546 15547 15548 15549 15550 15551 15552 15553 15554 15555 15556 15557 15558 15559 15560 15561 15562 15563 15564 15565 15566 15567 15568 15569 15570 15571 15572 15573 15574 15575 15576 15577 15578 15579 15580 15581 15582 15583 15584 15585 15586 15587 15588 15589 15590 15591 15592 15593 15594 15595 15596 15597 15598 15599 15600 15601 15602 15603 15604 15605 15606 15607 15608 15609 15610 15611 15612 15613 15614 15615 15616 15617 15618 15619 15620 15621 15622 15623 15624 15625 15626 15627 15628 15629 15630 15631 15632 15633 15634 15635 15636 15637 15638 15639 15640 15641 15642 15643 15644 15645 15646 15647 15648 15649 15650 15651 15652 15653 15654 15655 15656 15657 15658 15659 15660 15661 15662 15663 15664 15665 15666 15667 15668 15669 15670 15671 15672 15673 15674 15675 15676 15677 15678 15679 15680 15681 15682 15683 15684 15685 15686 15687 15688 15689 15690 15691 15692 15693 15694 15695 15696 15697 15698 15699 15700 15701 15702 15703 15704 15705 15706 15707 15708 15709 15710 15711 15712 15713 15714 15715 15716 15717 15718 15719 15720 15721 15722 15723 15724 15725 15726 15727 15728 15729 15730 15731 15732 15733 15734 15735 15736 15737 15738 15739 15740 15741 15742 15743 15744 15745 15746 15747 15748 15749 15750 15751 15752 15753 15754 15755 15756 15757 15758 15759 15760 15761 15762 15763 15764 15765 15766 15767 15768 15769 15770 15771 15772 15773 15774 15775 15776 15777 15778 15779 15780 15781 15782 15783 15784 15785 15786 15787 15788 15789 15790 15791 15792 15793 15794 15795 15796 15797 15798 15799 15800 15801 15802 15803 15804 15805 15806 15807 15808 15809 15810 15811 15812 15813 15814 15815 15816 15817 15818 15819 15820 15821 15822 15823 15824 15825 15826 15827 15828 15829 15830 15831 15832 15833 15834 15835 15836 15837 15838 15839 15840 15841 15842 15843 15844 15845 15846 15847 15848 15849 15850 15851 15852 15853 15854 15855 15856 15857 15858 15859 15860 15861 15862 15863 15864 15865 15866 15867 15868 15869 15870 15871 15872 15873 15874 15875 15876 15877 15878 15879 15880 15881 15882 15883 15884 15885 15886 15887 15888 15889 15890 15891 15892 15893 15894 15895 15896 15897 15898 15899 15900 15901 15902 15903 15904 15905 15906 15907 15908 15909 15910 15911 15912 15913 15914 15915 15916 15917 15918 15919 15920 15921 15922 15923 15924 15925 15926 15927 15928 15929 15930 15931 15932 15933 15934 15935 15936 15937 15938 15939 15940 15941 15942 15943 15944 15945 15946 15947 15948 15949 15950 15951 15952 15953 15954 15955 15956 15957 15958 15959 15960 15961 15962 15963 15964 15965 15966 15967 15968 15969 15970 15971 15972 15973 15974 15975 15976 15977 15978 15979 15980 15981 15982 15983 15984 15985 15986 15987 15988 15989 15990 15991 15992 15993 15994 15995 15996 15997 15998 15999 16000 16001 16002 16003 16004 16005 16006 16007 16008 16009 16010 16011 16012 16013 16014 16015 16016 16017 16018 16019 16020 16021 16022 16023 16024 16025 16026 16027 16028 16029 16030 16031 16032 16033 16034 16035 16036 16037 16038 16039 16040 16041 16042 16043 16044 16045 16046 16047 16048 16049 16050 16051 16052 16053 16054 16055 16056 16057 16058 16059 16060 16061 16062 16063 16064 16065 16066 16067 16068 16069 16070 16071 16072 16073 16074 16075 16076 16077 16078 16079 16080 16081 16082 16083 16084 16085 16086 16087 16088 16089 16090 16091 16092 16093 16094 16095 16096 16097 16098 16099 16100 16101 16102 16103 16104 16105 16106 16107 16108 16109 16110 16111 16112 16113 16114 16115 16116 16117 16118 16119 16120 16121 16122 16123 16124 16125 16126 16127 16128 16129 16130 16131 16132 16133 16134 16135 16136 16137 16138 16139 16140 16141 16142 16143 16144 16145 16146 16147 16148 16149 16150 16151 16152 16153 16154 16155 16156 16157 16158 16159 16160 16161 16162 16163 16164 16165 16166 16167 16168 16169 16170 16171 16172 16173 16174 16175 16176 16177 16178 16179 16180 16181 16182 16183 16184 16185 16186 16187 16188 16189 16190 16191 16192 16193 16194 16195 16196 16197 16198 16199 16200 16201 16202 16203 16204 16205 16206 16207 16208 16209 16210 16211 16212 16213 16214 16215 16216 16217 16218 16219 16220 16221 16222 16223 16224 16225 16226 16227 16228 16229 16230 16231 16232 16233 16234 16235 16236 16237 16238 16239 16240 16241 16242 16243 16244 16245 16246 16247 16248 16249 16250 16251 16252 16253 16254 16255 16256 16257 16258 16259 16260 16261 16262 16263 16264 16265 16266 16267 16268 16269 16270 16271 16272 16273 16274 16275 16276 16277 16278 16279 16280 16281 16282 16283 16284 16285 16286 16287 16288 16289 16290 16291 16292 16293 16294 16295 16296 16297 16298 16299 16300 16301 16302 16303 16304 16305 16306 16307 16308 16309 16310 16311 16312 16313 16314 16315 16316 16317 16318 16319 16320 16321 16322 16323 16324 16325 16326 16327 16328 16329 16330 16331 16332 16333 16334 16335 16336 16337 16338 16339 16340 16341 16342 16343 16344 16345 16346 16347 16348 16349 16350 16351 16352 16353 16354 16355 16356 16357 16358 16359 16360 16361 16362 16363 16364 16365 16366 16367 16368 16369 16370 16371 16372 16373 16374 16375 16376 16377 16378 16379 16380 16381 16382 16383 16384 16385 16386 16387 16388 16389 16390 16391 16392 16393 16394 16395 16396 16397 16398 16399 16400 16401 16402 16403 16404 16405 16406 16407 16408 16409 16410 16411 16412 16413 16414 16415 16416 16417 16418 16419 16420 16421 16422 16423 16424 16425 16426 16427 16428 16429 16430 16431 16432 16433 16434 16435 16436 16437 16438 16439 16440 16441 16442 16443 16444 16445 16446 16447 16448 16449 16450 16451 16452 16453 16454 16455 16456 16457 16458 16459 16460 16461 16462 16463 16464 16465 16466 16467 16468 16469 16470 16471 16472 16473 16474 16475 16476 16477 16478 16479 16480 16481 16482 16483 16484 16485 16486 16487 16488 16489 16490 16491 16492 16493 16494 16495 16496 16497 16498 16499 16500 16501 16502 16503 16504 16505 16506 16507 16508 16509 16510 16511 16512 16513 16514 16515 16516 16517 16518 16519 16520 16521 16522 16523 16524 16525 16526 16527 16528 16529 16530 16531 16532 16533 16534 16535 16536 16537 16538 16539 16540 16541 16542 16543 16544 16545 16546 16547 16548 16549 16550 16551 16552 16553 16554 16555 16556 16557 16558 16559 16560 16561 16562 16563 16564 16565 16566 16567 16568 16569 16570 16571 16572 16573 16574 16575 16576 16577 16578 16579 16580 16581 16582 16583 16584 16585 16586 16587 16588 16589 16590 16591 16592 16593 16594 16595 16596 16597 16598 16599 16600 16601 16602 16603 16604 16605 16606 16607 16608 16609 16610 16611 16612 16613 16614 16615 16616 16617 16618 16619 16620 16621 16622 16623 16624 16625 16626 16627 16628 16629 16630 16631 16632 16633 16634 16635 16636 16637 16638 16639 16640 16641 16642 16643 16644 16645 16646 16647 16648 16649 16650 16651 16652 16653 16654 16655 16656 16657 16658 16659 16660 16661 16662 16663 16664 16665 16666 16667 16668 16669 16670 16671 16672 16673 16674 16675 16676 16677 16678 16679 16680 16681 16682 16683 16684 16685 16686 16687 16688 16689 16690 16691 16692 16693 16694 16695 16696 16697 16698 16699 16700 16701 16702 16703 16704 16705 16706 16707 16708 16709 16710 16711 16712 16713 16714 16715 16716 16717 16718 16719 16720 16721 16722 16723 16724 16725 16726 16727 16728 16729 16730 16731 16732 16733 16734 16735 16736 16737 16738 16739 16740 16741 16742 16743 16744 16745 16746 16747 16748 16749 16750 16751 16752 16753 16754 16755 16756 16757 16758 16759 16760 16761 16762 16763 16764 16765 16766 16767 16768 16769 16770 16771 16772 16773 16774 16775 16776 16777 16778 16779 16780 16781 16782 16783 16784 16785 16786 16787 16788 16789 16790 16791 16792 16793 16794 16795 16796 16797 16798 16799 16800 16801 16802 16803 16804 16805 16806 16807 16808 16809 16810 16811 16812 16813 16814 16815 16816 16817 16818 16819 16820 16821 16822 16823 16824 16825 16826 16827 16828 16829 16830 16831 16832 16833 16834 16835 16836 16837 16838 16839 16840 16841 16842 16843 16844 16845 16846 16847 16848 16849 16850 16851 16852 16853 16854 16855 16856 16857 16858 16859 16860 16861 16862 16863 16864 16865 16866 16867 16868 16869 16870 16871 16872 16873 16874 16875 16876 16877 16878 16879 16880 16881 16882 16883 16884 16885 16886 16887 16888 16889 16890 16891 16892 16893 16894 16895 16896 16897 16898 16899 16900 16901 16902 16903 16904 16905 16906 16907 16908 16909 16910 16911 16912 16913 16914 16915 16916 16917 16918 16919 16920 16921 16922 16923 16924 16925 16926 16927 16928 16929 16930 16931 16932 16933 16934 16935 16936 16937 16938 16939 16940 16941 16942 16943 16944 16945 16946 16947 16948 16949 16950 16951 16952 16953 16954 16955 16956 16957 16958 16959 16960 16961 16962 16963 16964 16965 16966 16967 16968 16969 16970 16971 16972 16973 16974 16975 16976 16977 16978 16979 16980 16981 16982 16983 16984 16985 16986 16987 16988 16989 16990 16991 16992 16993 16994 16995 16996 16997 16998 16999 17000 17001 17002 17003 17004 17005 17006 17007 17008 17009 17010 17011 17012 17013 17014 17015 17016 17017 17018 17019 17020 17021 17022 17023 17024 17025 17026 17027 17028 17029 17030 17031 17032 17033 17034 17035 17036 17037 17038 17039 17040 17041 17042 17043 17044 17045 17046 17047 17048 17049 17050 17051 17052 17053 17054 17055 17056 17057 17058 17059 17060 17061 17062 17063 17064 17065 17066 17067 17068 17069 17070 17071 17072 17073 17074 17075 17076 17077 17078 17079 17080 17081 17082 17083 17084 17085 17086 17087 17088 17089 17090 17091 17092 17093 17094 17095 17096 17097 17098 17099 17100 17101 17102 17103 17104 17105 17106 17107 17108 17109 17110 17111 17112 17113 17114 17115 17116 17117 17118 17119 17120 17121 17122 17123 17124 17125 17126 17127 17128 17129 17130 17131 17132 17133 17134 17135 17136 17137 17138 17139 17140 17141 17142 17143 17144 17145 17146 17147 17148 17149 17150 17151 17152 17153 17154 17155 17156 17157 17158 17159 17160 17161 17162 17163 17164 17165 17166 17167 17168 17169 17170 17171 17172 17173 17174 17175 17176 17177 17178 17179 17180 17181 17182 17183 17184 17185 17186 17187 17188 17189 17190 17191 17192 17193 17194 17195 17196 17197 17198 17199 17200 17201 17202 17203 17204 17205 17206 17207 17208 17209 17210 17211 17212 17213 17214 17215 17216 17217 17218 17219 17220 17221 17222 17223 17224 17225 17226 17227 17228 17229 17230 17231 17232 17233 17234 17235 17236 17237 17238 17239 17240 17241 17242 17243 17244 17245 17246 17247 17248 17249 17250 17251 17252 17253 17254 17255 17256 17257 17258 17259 17260 17261 17262 17263 17264 17265 17266 17267 17268 17269 17270 17271 17272 17273 17274 17275 17276 17277 17278 17279 17280 17281 17282 17283 17284 17285 17286 17287 17288 17289 17290 17291 17292 17293 17294 17295 17296 17297 17298 17299 17300 17301 17302 17303 17304 17305 17306 17307 17308 17309 17310 17311 17312 17313 17314 17315 17316 17317 17318 17319 17320 17321 17322 17323 17324 17325 17326 17327 17328 17329 17330 17331 17332 17333 17334 17335 17336 17337 17338 17339 17340 17341 17342 17343 17344 17345 17346 17347 17348 17349 17350 17351 17352 17353 17354 17355 17356 17357 17358 17359 17360 17361 17362 17363 17364 17365 17366 17367 17368 17369 17370 17371 17372 17373 17374 17375 17376 17377 17378 17379 17380 17381 17382 17383 17384 17385 17386 17387 17388 17389 17390 17391 17392 17393 17394 17395 17396 17397 17398 17399 17400 17401 17402 17403 17404 17405 17406 17407 17408 17409 17410 17411 17412 17413 17414 17415 17416 17417 17418 17419 17420 17421 17422 17423 17424 17425 17426 17427 17428 17429 17430 17431 17432 17433 17434 17435 17436 17437 17438 17439 17440 17441 17442 17443 17444 17445 17446 17447 17448 17449 17450 17451 17452 17453 17454 17455 17456 17457 17458 17459 17460 17461 17462 17463 17464 17465 17466 17467 17468 17469 17470 17471 17472 17473 17474 17475 17476 17477 17478 17479 17480 17481 17482 17483 17484 17485 17486 17487 17488 17489 17490 17491 17492 17493 17494 17495 17496 17497 17498 17499 17500 17501 17502 17503 17504 17505 17506 17507 17508 17509 17510 17511 17512 17513 17514 17515 17516 17517 17518 17519 17520 17521 17522 17523 17524 17525 17526 17527 17528 17529 17530 17531 17532 17533 17534 17535 17536 17537 17538 17539 17540 17541 17542 17543 17544 17545 17546 17547 17548 17549 17550 17551 17552 17553 17554 17555 17556 17557 17558 17559 17560 17561 17562 17563 17564 17565 17566 17567 17568 17569 17570 17571 17572 17573 17574 17575 17576 17577 17578 17579 17580 17581 17582 17583 17584 17585 17586 17587 17588 17589 17590 17591 17592 17593 17594 17595 17596 17597 17598 17599 17600 17601 17602 17603 17604 17605 17606 17607 17608 17609 17610 17611 17612 17613 17614 17615 17616 17617 17618 17619 17620 17621 17622 17623 17624 17625 17626 17627 17628 17629 17630 17631 17632 17633 17634 17635 17636 17637 17638 17639 17640 17641 17642 17643 17644 17645 17646 17647 17648 17649 17650 17651 17652 17653 17654 17655 17656 17657 17658 17659 17660 17661 17662 17663 17664 17665 17666 17667 17668 17669 17670 17671 17672 17673 17674 17675 17676 17677 17678 17679 17680 17681 17682 17683 17684 17685 17686 17687 17688 17689 17690 17691 17692 17693 17694 17695 17696 17697 17698 17699 17700 17701 17702 17703 17704 17705 17706 17707 17708 17709 17710 17711 17712 17713 17714 17715 17716 17717 17718 17719 17720 17721 17722 17723 17724 17725 17726 17727 17728 17729 17730 17731 17732 17733 17734 17735 17736 17737 17738 17739 17740 17741 17742 17743 17744 17745 17746 17747 17748 17749 17750 17751 17752 17753 17754 17755 17756 17757 17758 17759 17760 17761 17762 17763 17764 17765 17766 17767 17768 17769 17770 17771 17772 17773 17774 17775 17776 17777 17778 17779 17780 17781 17782 17783 17784 17785 17786 17787 17788 17789 17790 17791 17792 17793 17794 17795 17796 17797 17798 17799 17800 17801 17802 17803 17804 17805 17806 17807 17808 17809 17810 17811 17812 17813 17814 17815 17816 17817 17818 17819 17820 17821 17822 17823 17824 17825 17826 17827 17828 17829 17830 17831 17832 17833 17834 17835 17836 17837 17838 17839 17840 17841 17842 17843 17844 17845 17846 17847 17848 17849 17850 17851 17852 17853 17854 17855 17856 17857 17858 17859 17860 17861 17862 17863 17864 17865 17866 17867 17868 17869 17870 17871 17872 17873 17874 17875 17876 17877 17878 17879 17880 17881 17882 17883 17884 17885 17886 17887 17888 17889 17890 17891 17892 17893 17894 17895 17896 17897 17898 17899 17900 17901 17902 17903 17904 17905 17906 17907 17908 17909 17910 17911 17912 17913 17914 17915 17916 17917 17918 17919 17920 17921 17922 17923 17924 17925 17926 17927 17928 17929 17930 17931 17932 17933 17934 17935 17936 17937 17938 17939 17940 17941 17942 17943 17944 17945 17946 17947 17948 17949 17950 17951 17952 17953 17954 17955 17956 17957 17958 17959 17960 17961 17962 17963 17964 17965 17966 17967 17968 17969 17970 17971 17972 17973 17974 17975 17976 17977 17978 17979 17980 17981 17982 17983 17984 17985 17986 17987 17988 17989 17990 17991 17992 17993 17994 17995 17996 17997 17998 17999 18000 18001 18002 18003 18004 18005 18006 18007 18008 18009 18010 18011 18012 18013 18014 18015 18016 18017 18018 18019 18020 18021 18022 18023 18024 18025 18026 18027 18028 18029 18030 18031 18032 18033 18034 18035 18036 18037 18038 18039 18040 18041 18042 18043 18044 18045 18046 18047 18048 18049 18050 18051 18052 18053 18054 18055 18056 18057 18058 18059 18060 18061 18062 18063 18064 18065 18066 18067 18068 18069 18070 18071 18072 18073 18074 18075 18076 18077 18078 18079 18080 18081 18082 18083 18084 18085 18086 18087 18088 18089 18090 18091 18092 18093 18094 18095 18096 18097 18098 18099 18100 18101 18102 18103 18104 18105 18106 18107 18108 18109 18110 18111 18112 18113 18114 18115 18116 18117 18118 18119 18120 18121 18122 18123 18124 18125 18126 18127 18128 18129 18130 18131 18132 18133 18134 18135 18136 18137 18138 18139 18140 18141 18142 18143 18144 18145 18146 18147 18148 18149 18150 18151 18152 18153 18154 18155 18156 18157 18158 18159 18160 18161 18162 18163 18164 18165 18166 18167 18168 18169 18170 18171 18172 18173 18174 18175 18176 18177 18178 18179 18180 18181 18182 18183 18184 18185 18186 18187 18188 18189 18190 18191 18192 18193 18194 18195 18196 18197 18198 18199 18200 18201 18202 18203 18204 18205 18206 18207 18208 18209 18210 18211 18212 18213 18214 18215 18216 18217 18218 18219 18220 18221 18222 18223 18224 18225 18226 18227 18228 18229 18230 18231 18232 18233 18234 18235 18236 18237 18238 18239 18240 18241 18242 18243 18244 18245 18246 18247 18248 18249 18250 18251 18252 18253 18254 18255 18256 18257 18258 18259 18260 18261 18262 18263 18264 18265 18266 18267 18268 18269 18270 18271 18272 18273 18274 18275 18276 18277 18278 18279 18280 18281 18282 18283 18284 18285 18286 18287 18288 18289 18290 18291 18292 18293 18294 18295 18296 18297 18298 18299 18300 18301 18302 18303 18304 18305 18306 18307 18308 18309 18310 18311 18312 18313 18314 18315 18316 18317 18318 18319 18320 18321 18322 18323 18324 18325 18326 18327 18328 18329 18330 18331 18332 18333 18334 18335 18336 18337 18338 18339 18340 18341 18342 18343 18344 18345 18346 18347 18348 18349 18350 18351 18352 18353 18354 18355 18356 18357 18358 18359 18360 18361 18362 18363 18364 18365 18366 18367 18368 18369 18370 18371 18372 18373 18374 18375 18376 18377 18378 18379 18380 18381 18382 18383 18384 18385 18386 18387 18388 18389 18390 18391 18392 18393 18394 18395 18396 18397 18398 18399 18400 18401 18402 18403 18404 18405 18406 18407 18408 18409 18410 18411 18412 18413 18414 18415 18416 18417 18418 18419 18420 18421 18422 18423 18424 18425 18426 18427 18428 18429 18430 18431 18432 18433 18434 18435 18436 18437 18438 18439 18440 18441 18442 18443 18444 18445 18446 18447 18448 18449 18450 18451 18452 18453 18454 18455 18456 18457 18458 18459 18460 18461 18462 18463 18464 18465 18466 18467 18468 18469 18470 18471 18472 18473 18474 18475 18476 18477 18478 18479 18480 18481 18482 18483 18484 18485 18486 18487 18488 18489 18490 18491 18492 18493 18494 18495 18496 18497 18498 18499 18500 18501 18502 18503 18504 18505 18506 18507 18508 18509 18510 18511 18512 18513 18514 18515 18516 18517 18518 18519 18520 18521 18522 18523 18524 18525 18526 18527 18528 18529 18530 18531 18532 18533 18534 18535 18536 18537 18538 18539 18540 18541 18542 18543 18544 18545 18546 18547 18548 18549 18550 18551 18552 18553 18554 18555 18556 18557 18558 18559 18560 18561 18562 18563 18564 18565 18566 18567 18568 18569 18570 18571 18572 18573 18574 18575 18576 18577 18578 18579 18580 18581 18582 18583 18584 18585 18586 18587 18588 18589 18590 18591 18592 18593 18594 18595 18596 18597 18598 18599 18600 18601 18602 18603 18604 18605 18606 18607 18608 18609 18610 18611 18612 18613 18614 18615 18616 18617 18618 18619 18620 18621 18622 18623 18624 18625 18626 18627 18628 18629 18630 18631 18632 18633 18634 18635 18636 18637 18638 18639 18640 18641 18642 18643 18644 18645 18646 18647 18648 18649 18650 18651 18652 18653 18654 18655 18656 18657 18658 18659 18660 18661 18662 18663 18664 18665 18666 18667 18668 18669 18670 18671 18672 18673 18674 18675 18676 18677 18678 18679 18680 18681 18682 18683 18684 18685 18686 18687 18688 18689 18690 18691 18692 18693 18694 18695 18696 18697 18698 18699 18700 18701 18702 18703 18704 18705 18706 18707 18708 18709 18710 18711 18712 18713 18714 18715 18716 18717 18718 18719 18720 18721 18722 18723 18724 18725 18726 18727 18728 18729 18730 18731 18732 18733 18734 18735 18736 18737 18738 18739 18740 18741 18742 18743 18744 18745 18746 18747 18748 18749 18750 18751 18752 18753 18754 18755 18756 18757 18758 18759 18760 18761 18762 18763 18764 18765 18766 18767 18768 18769 18770 18771 18772 18773 18774 18775 18776 18777 18778 18779 18780 18781 18782 18783 18784 18785 18786 18787 18788 18789 18790 18791 18792 18793 18794 18795 18796 18797 18798 18799 18800 18801 18802 18803 18804 18805 18806 18807 18808 18809 18810 18811 18812 18813 18814 18815 18816 18817 18818 18819 18820 18821 18822 18823 18824 18825 18826 18827 18828 18829 18830 18831 18832 18833 18834 18835 18836 18837 18838 18839 18840 18841 18842 18843 18844 18845 18846 18847 18848 18849 18850 18851 18852 18853 18854 18855 18856 18857 18858 18859 18860 18861 18862 18863 18864 18865 18866 18867 18868 18869 18870 18871 18872 18873 18874 18875 18876 18877 18878 18879 18880 18881 18882 18883 18884 18885 18886 18887 18888 18889 18890 18891 18892 18893 18894 18895 18896 18897 18898 18899 18900 18901 18902 18903 18904 18905 18906 18907 18908 18909 18910 18911 18912 18913 18914 18915 18916 18917 18918 18919 18920 18921 18922 18923 18924 18925 18926 18927 18928 18929 18930 18931 18932 18933 18934 18935 18936 18937 18938 18939 18940 18941 18942 18943 18944 18945 18946 18947 18948 18949 18950 18951 18952 18953 18954 18955 18956 18957 18958 18959 18960 18961 18962 18963 18964 18965 18966 18967 18968 18969 18970 18971 18972 18973 18974 18975 18976 18977 18978 18979 18980 18981 18982 18983 18984 18985 18986 18987 18988 18989 18990 18991 18992 18993 18994 18995 18996 18997 18998 18999 19000 19001 19002 19003 19004 19005 19006 19007 19008 19009 19010 19011 19012 19013 19014 19015 19016 19017 19018 19019 19020 19021 19022 19023 19024 19025 19026 19027 19028 19029 19030 19031 19032 19033 19034 19035 19036 19037 19038 19039 19040 19041 19042 19043 19044 19045 19046 19047 19048 19049 19050 19051 19052 19053 19054 19055 19056 19057 19058 19059 19060 19061 19062 19063 19064 19065 19066 19067 19068 19069 19070 19071 19072 19073 19074 19075 19076 19077 19078 19079 19080 19081 19082 19083 19084 19085 19086 19087 19088 19089 19090 19091 19092 19093 19094 19095 19096 19097 19098 19099 19100 19101 19102 19103 19104 19105 19106 19107 19108 19109 19110 19111 19112 19113 19114 19115 19116 19117 19118 19119 19120 19121 19122 19123 19124 19125 19126 19127 19128 19129 19130 19131 19132 19133 19134 19135 19136 19137 19138 19139 19140 19141 19142 19143 19144 19145 19146 19147 19148 19149 19150 19151 19152 19153 19154 19155 19156 19157 19158 19159 19160 19161 19162 19163 19164 19165 19166 19167 19168 19169 19170 19171 19172 19173 19174 19175 19176 19177 19178 19179 19180 19181 19182 19183 19184 19185 19186 19187 19188 19189 19190 19191 19192 19193 19194 19195 19196 19197 19198 19199 19200 19201 19202 19203 19204 19205 19206 19207 19208 19209 19210 19211 19212 19213 19214 19215 19216 19217 19218 19219 19220 19221 19222 19223 19224 19225 19226 19227 19228 19229 19230 19231 19232 19233 19234 19235 19236 19237 19238 19239 19240 19241 19242 19243 19244 19245 19246 19247 19248 19249 19250 19251 19252 19253 19254 19255 19256 19257 19258 19259 19260 19261 19262 19263 19264 19265 19266 19267 19268 19269 19270 19271 19272 19273 19274 19275 19276 19277 19278 19279 19280 19281 19282 19283 19284 19285 19286 19287 19288 19289 19290 19291 19292 19293 19294 19295 19296 19297 19298 19299 19300 19301 19302 19303 19304 19305 19306 19307 19308 19309 19310 19311 19312 19313 19314 19315 19316 19317 19318 19319 19320 19321 19322 19323 19324 19325 19326 19327 19328 19329 19330 19331 19332 19333 19334 19335 19336 19337 19338 19339 19340 19341 19342 19343 19344 19345 19346 19347 19348 19349 19350 19351 19352 19353 19354 19355 19356 19357 19358 19359 19360 19361 19362 19363 19364 19365 19366 19367 19368 19369 19370 19371 19372 19373 19374 19375 19376 19377 19378 19379 19380 19381 19382 19383 19384 19385 19386 19387 19388 19389 19390 19391 19392 19393 19394 19395 19396 19397 19398 19399 19400 19401 19402 19403 19404 19405 19406 19407 19408 19409 19410 19411 19412 19413 19414 19415 19416 19417 19418 19419 19420 19421 19422 19423 19424 19425 19426 19427 19428 19429 19430 19431 19432 19433 19434 19435 19436 19437 19438 19439 19440 19441 19442 19443 19444 19445 19446 19447 19448 19449 19450 19451 19452 19453 19454 19455 19456 19457 19458 19459 19460 19461 19462 19463 19464 19465 19466 19467 19468 19469 19470 19471 19472 19473 19474 19475 19476 19477 19478 19479 19480 19481 19482 19483 19484 19485 19486 19487 19488 19489 19490 19491 19492 19493 19494 19495 19496 19497 19498 19499 19500 19501 19502 19503 19504 19505 19506 19507 19508 19509 19510 19511 19512 19513 19514 19515 19516 19517 19518 19519 19520 19521 19522 19523 19524 19525 19526 19527 19528 19529 19530 19531 19532 19533 19534 19535 19536 19537 19538 19539 19540 19541 19542 19543 19544 19545 19546 19547 19548 19549 19550 19551 19552 19553 19554 19555 19556 19557 19558 19559 19560 19561 19562 19563 19564 19565 19566 19567 19568 19569 19570 19571 19572 19573 19574 19575 19576 19577 19578 19579 19580 19581 19582 19583 19584 19585 19586 19587 19588 19589 19590 19591 19592 19593 19594 19595 19596 19597 19598 19599 19600 19601 19602 19603 19604 19605 19606 19607 19608 19609 19610 19611 19612 19613 19614 19615 19616 19617 19618 19619 19620 19621 19622 19623 19624 19625 19626 19627 19628 19629 19630 19631 19632 19633 19634 19635 19636 19637 19638 19639 19640 19641 19642 19643 19644 19645 19646 19647 19648 19649 19650 19651 19652 19653 19654 19655 19656 19657 19658 19659 19660 19661 19662 19663 19664 19665 19666 19667 19668 19669 19670 19671 19672 19673 19674 19675 19676 19677 19678 19679 19680 19681 19682 19683 19684 19685 19686 19687 19688 19689 19690 19691 19692 19693 19694 19695 19696 19697 19698 19699 19700 19701 19702 19703 19704 19705 19706 19707 19708 19709 19710 19711 19712 19713 19714 19715 19716 19717 19718 19719 19720 19721 19722 19723 19724 19725 19726 19727 19728 19729 19730 19731 19732 19733 19734 19735 19736 19737 19738 19739 19740 19741 19742 19743 19744 19745 19746 19747 19748 19749 19750 19751 19752 19753 19754 19755 19756 19757 19758 19759 19760 19761 19762 19763 19764 19765 19766 19767 19768 19769 19770 19771 19772 19773 19774 19775 19776 19777 19778 19779 19780 19781 19782 19783 19784 19785 19786 19787 19788 19789 19790 19791 19792 19793 19794 19795 19796 19797 19798 19799 19800 19801 19802 19803 19804 19805 19806 19807 19808 19809 19810 19811 19812 19813 19814 19815 19816 19817 19818 19819 19820 19821 19822 19823 19824 19825 19826 19827 19828 19829 19830 19831 19832 19833 19834 19835 19836 19837 19838 19839 19840 19841 19842 19843 19844 19845 19846 19847 19848 19849 19850 19851 19852 19853 19854 19855 19856 19857 19858 19859 19860 19861 19862 19863 19864 19865 19866 19867 19868 19869 19870 19871 19872 19873 19874 19875 19876 19877 19878 19879 19880 19881 19882 19883 19884 19885 19886 19887 19888 19889 19890 19891 19892 19893 19894 19895 19896 19897 19898 19899 19900 19901 19902 19903 19904 19905 19906 19907 19908 19909 19910 19911 19912 19913 19914 19915 19916 19917 19918 19919 19920 19921 19922 19923 19924 19925 19926 19927 19928 19929 19930 19931 19932 19933 19934 19935 19936 19937 19938 19939 19940 19941 19942 19943 19944 19945 19946 19947 19948 19949 19950 19951 19952 19953 19954 19955 19956 19957 19958 19959 19960 19961 19962 19963 19964 19965 19966 19967 19968 19969 19970 19971 19972 19973 19974 19975 19976 19977 19978 19979 19980 19981 19982 19983 19984 19985 19986 19987 19988 19989 19990 19991 19992 19993 19994 19995 19996 19997 19998 19999 20000 20001 20002 20003 20004 20005 20006 20007 20008 20009 20010 20011 20012 20013 20014 20015 20016 20017 20018 20019 20020 20021 20022 20023 20024 20025 20026 20027 20028 20029 20030 20031 20032 20033 20034 20035 20036 20037 20038 20039 20040 20041 20042 20043 20044 20045 20046 20047 20048 20049 20050 20051 20052 20053 20054 20055 20056 20057 20058 20059 20060 20061 20062 20063 20064 20065 20066 20067 20068 20069 20070 20071 20072 20073 20074 20075 20076 20077 20078 20079 20080 20081 20082 20083 20084 20085 20086 20087 20088 20089 20090 20091 20092 20093 20094 20095 20096 20097 20098 20099 20100 20101 20102 20103 20104 20105 20106 20107 20108 20109 20110 20111 20112 20113 20114 20115 20116 20117 20118 20119 20120 20121 20122 20123 20124 20125 20126 20127 20128 20129 20130 20131 20132 20133 20134 20135 20136 20137 20138 20139 20140 20141 20142 20143 20144 20145 20146 20147 20148 20149 20150 20151 20152 20153 20154 20155 20156 20157 20158 20159 20160 20161 20162 20163 20164 20165 20166 20167 20168 20169 20170 20171 20172 20173 20174 20175 20176 20177 20178 20179 20180 20181 20182 20183 20184 20185 20186 20187 20188 20189 20190 20191 20192 20193 20194 20195 20196 20197 20198 20199 20200 20201 20202 20203 20204 20205 20206 20207 20208 20209 20210 20211 20212 20213 20214 20215 20216 20217 20218 20219 20220 20221 20222 20223 20224 20225 20226 20227 20228 20229 20230 20231 20232 20233 20234 20235 20236 20237 20238 20239 20240 20241 20242 20243 20244 20245 20246 20247 20248 20249 20250 20251 20252 20253 20254 20255 20256 20257 20258 20259 20260 20261 20262 20263 20264 20265 20266 20267 20268 20269 20270 20271 20272 20273 20274 20275 20276 20277 20278 20279 20280 20281 20282 20283 20284 20285 20286 20287 20288 20289 20290 20291 20292 20293 20294 20295 20296 20297 20298 20299 20300 20301 20302 20303 20304 20305 20306 20307 20308 20309 20310 20311 20312 20313 20314 20315 20316 20317 20318 20319 20320 20321 20322 20323 20324 20325 20326 20327 20328 20329 20330 20331 20332 20333 20334 20335 20336 20337 20338 20339 20340 20341 20342 20343 20344 20345 20346 20347 20348 20349 20350 20351 20352 20353 20354 20355 20356 20357 20358 20359 20360 20361 20362 20363 20364 20365 20366 20367 20368 20369 20370 20371 20372 20373 20374 20375 20376 20377 20378 20379 20380 20381 20382 20383 20384 20385 20386 20387 20388 20389 20390 20391 20392 20393 20394 20395 20396 20397 20398 20399 20400 20401 20402 20403 20404 20405 20406 20407 20408 20409 20410 20411 20412 20413 20414 20415 20416 20417 20418 20419 20420 20421 20422 20423 20424 20425 20426 20427 20428 20429 20430 20431 20432 20433 20434 20435 20436 20437 20438 20439 20440 20441 20442 20443 20444 20445 20446 20447 20448 20449 20450 20451 20452 20453 20454 20455 20456 20457 20458 20459 20460 20461 20462 20463 20464 20465 20466 20467 20468 20469 20470 20471 20472 20473 20474 20475 20476 20477 20478 20479 20480 20481 20482 20483 20484 20485 20486 20487 20488 20489 20490 20491 20492 20493 20494 20495 20496 20497 20498 20499 20500 20501 20502 20503 20504 20505 20506 20507 20508 20509 20510 20511 20512 20513 20514 20515 20516 20517 20518 20519 20520 20521 20522 20523 20524 20525 20526 20527 20528 20529 20530 20531 20532 20533 20534 20535 20536 20537 20538 20539 20540 20541 20542 20543 20544 20545 20546 20547 20548 20549 20550 20551 20552 20553 20554 20555 20556 20557 20558 20559 20560 20561 20562 20563 20564 20565 20566 20567 20568 20569 20570 20571 20572 20573 20574 20575 20576 20577 20578 20579 20580 20581 20582 20583 20584 20585 20586 20587 20588 20589 20590 20591 20592 20593 20594 20595 20596 20597 20598 20599 20600 20601 20602 20603 20604 20605 20606 20607 20608 20609 20610 20611 20612 20613 20614 20615 20616 20617 20618 20619 20620 20621 20622 20623 20624 20625 20626 20627 20628 20629 20630 20631 20632 20633 20634 20635 20636 20637 20638 20639 20640 20641 20642 20643 20644 20645 20646 20647 20648 20649 20650 20651 20652 20653 20654 20655 20656 20657 20658 20659 20660 20661 20662 20663 20664 20665 20666 20667 20668 20669 20670 20671 20672 20673 20674 20675 20676 20677 20678 20679 20680 20681 20682 20683 20684 20685 20686 20687 20688 20689 20690 20691 20692 20693 20694 20695 20696 20697 20698 20699 20700 20701 20702 20703 20704 20705 20706 20707 20708 20709 20710 20711 20712 20713 20714 20715 20716 20717 20718 20719 20720 20721 20722 20723 20724 20725 20726 20727 20728 20729 20730 20731 20732 20733 20734 20735 20736 20737 20738 20739 20740 20741 20742 20743 20744 20745 20746 20747 20748 20749 20750 20751 20752 20753 20754 20755 20756 20757 20758 20759 20760 20761 20762 20763 20764 20765 20766 20767 20768 20769 20770 20771 20772 20773 20774 20775 20776 20777 20778 20779 20780 20781 20782 20783 20784 20785 20786 20787 20788 20789 20790 20791 20792 20793 20794 20795 20796 20797 20798 20799 20800 20801 20802 20803 20804 20805 20806 20807 20808 20809 20810 20811 20812 20813 20814 20815 20816 20817 20818 20819 20820 20821 20822 20823 20824 20825 20826 20827 20828 20829 20830 20831 20832 20833 20834 20835 20836 20837 20838 20839 20840 20841 20842 20843 20844 20845 20846 20847 20848 20849 20850 20851 20852 20853 20854 20855 20856 20857 20858 20859 20860 20861 20862 20863 20864 20865 20866 20867 20868 20869 20870 20871 20872 20873 20874 20875 20876 20877 20878 20879 20880 20881 20882 20883 20884 20885 20886 20887 20888 20889 20890 20891 20892 20893 20894 20895 20896 20897 20898 20899 20900 20901 20902 20903 20904 20905 20906 20907 20908 20909 20910 20911 20912 20913 20914 20915 20916 20917 20918 20919 20920 20921 20922 20923 20924 20925 20926 20927 20928 20929 20930 20931 20932 20933 20934 20935 20936 20937 20938 20939 20940 20941 20942 20943 20944 20945 20946 20947 20948 20949 20950 20951 20952 20953 20954 20955 20956 20957 20958 20959 20960 20961 20962 20963 20964 20965 20966 20967 20968 20969 20970 20971 20972 20973 20974 20975 20976 20977 20978 20979 20980 20981 20982 20983 20984 20985 20986 20987 20988 20989 20990 20991 20992 20993 20994 20995 20996 20997 20998 20999 21000 21001 21002 21003 21004 21005 21006 21007 21008 21009 21010 21011 21012 21013 21014 21015 21016 21017 21018 21019 21020 21021 21022 21023 21024 21025 21026 21027 21028 21029 21030 21031 21032 21033 21034 21035 21036 21037 21038 21039 21040 21041 21042 21043 21044 21045 21046 21047 21048 21049 21050 21051 21052 21053 21054 21055 21056 21057 21058 21059 21060 21061 21062 21063 21064 21065 21066 21067 21068 21069 21070 21071 21072 21073 21074 21075 21076 21077 21078 21079 21080 21081 21082 21083 21084 21085 21086 21087 21088 21089 21090 21091 21092 21093 21094 21095 21096 21097 21098 21099 21100 21101 21102 21103 21104 21105 21106 21107 21108 21109 21110 21111 21112 21113 21114 21115 21116 21117 21118 21119 21120 21121 21122 21123 21124 21125 21126 21127 21128 21129 21130 21131 21132 21133 21134 21135 21136 21137 21138 21139 21140 21141 21142 21143 21144 21145 21146 21147 21148 21149 21150 21151 21152 21153 21154 21155 21156 21157 21158 21159 21160 21161 21162 21163 21164 21165 21166 21167 21168 21169 21170 21171 21172 21173 21174 21175 21176 21177 21178 21179 21180 21181 21182 21183 21184 21185 21186 21187 21188 21189 21190 21191 21192 21193 21194 21195 21196 21197 21198 21199 21200 21201 21202 21203 21204 21205 21206 21207 21208 21209 21210 21211 21212 21213 21214 21215 21216 21217 21218 21219 21220 21221 21222 21223 21224 21225 21226 21227 21228 21229 21230 21231 21232 21233 21234 21235 21236 21237 21238 21239 21240 21241 21242 21243 21244 21245 21246 21247 21248 21249 21250 21251 21252 21253 21254 21255 21256 21257 21258 21259 21260 21261 21262 21263 21264 21265 21266 21267 21268 21269 21270 21271 21272 21273 21274 21275 21276 21277 21278 21279 21280 21281 21282 21283 21284 21285 21286 21287 21288 21289 21290 21291 21292 21293 21294 21295 21296 21297 21298 21299 21300 21301 21302 21303 21304 21305 21306 21307 21308 21309 21310 21311 21312 21313 21314 21315 21316 21317 21318 21319 21320 21321 21322 21323 21324 21325 21326 21327 21328 21329 21330 21331 21332 21333 21334 21335 21336 21337 21338 21339 21340 21341 21342 21343 21344 21345 21346 21347 21348 21349 21350 21351 21352 21353 21354 21355 21356 21357 21358 21359 21360 21361 21362 21363 21364 21365 21366 21367 21368 21369 21370 21371 21372 21373 21374 21375 21376 21377 21378 21379 21380 21381 21382 21383 21384 21385 21386 21387 21388 21389 21390 21391 21392 21393 21394 21395 21396 21397 21398 21399 21400 21401 21402 21403 21404 21405 21406 21407 21408 21409 21410 21411 21412 21413 21414 21415 21416 21417 21418 21419 21420 21421 21422 21423 21424 21425 21426 21427 21428 21429 21430 21431 21432 21433 21434 21435 21436 21437 21438 21439 21440 21441 21442 21443 21444 21445 21446 21447 21448 21449 21450 21451 21452 21453 21454 21455 21456 21457 21458 21459 21460 21461 21462 21463 21464 21465 21466 21467 21468 21469 21470
|
msgid ""
msgstr ""
"Last-Translator: Maxim Ganetsky <maxkill@mail.ru>\n"
"Project-Id-Version: lazaruside\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"POT-Creation-Date: \n"
"PO-Revision-Date: 2024-10-28 19:05+0300\n"
"Language-Team: \n"
"MIME-Version: 1.0\n"
"X-Poedit-Bookmarks: -1,-1,-1,-1,-1,-1,-1,3325,-1,-1\n"
"Language: ru\n"
"X-Generator: Poedit 2.3.1\n"
#: lazarusidestrconsts.cocoamfstbicommand
msgid "Command"
msgstr "Команда"
#: lazarusidestrconsts.cocoamfstbijumpback
msgctxt "lazarusidestrconsts.cocoamfstbijumpback"
msgid "Jump Back"
msgstr "Перейти назад"
#: lazarusidestrconsts.cocoamfstbijumpforward
msgctxt "lazarusidestrconsts.cocoamfstbijumpforward"
msgid "Jump Forward"
msgstr "Перейти вперёд"
#: lazarusidestrconsts.cocoamfstbisearch
msgid "Search Instantly"
msgstr "Найти мгновенно"
#: lazarusidestrconsts.dbgasmwindowlinktarget
msgid "Link target line"
msgstr "Целевая строка ссылки"
#: lazarusidestrconsts.dbgasmwindowsourcefunc
msgid "Function name"
msgstr "Имя функции"
#: lazarusidestrconsts.dbgasmwindowsourceline
msgid "Source line"
msgstr "Строка исходного кода"
#: lazarusidestrconsts.dbgeventbreakaddressbreakpoint
#, object-pascal-format
msgid "Address Breakpoint %s"
msgstr "Точка останова %s"
#: lazarusidestrconsts.dbgeventbreakataddress
#, object-pascal-format
msgid "at $%s"
msgstr "по адресу $%s"
#: lazarusidestrconsts.dbgeventbreakataddressoriginsourceoriginline
#, object-pascal-format
msgid "at $%s: from origin %s line %d"
msgstr "по адресу $%s: изначально находится в %s строка %d"
#: lazarusidestrconsts.dbgeventbreakataddresssourceline
#, object-pascal-format
msgid "at $%s: %s line %d"
msgstr "по адресу $%s: %s строка %d"
#: lazarusidestrconsts.dbgeventbreaksourcebreakpoint
#, object-pascal-format
msgid "Source Breakpoint %s"
msgstr "Точка останова в исходном коде %s"
#: lazarusidestrconsts.dbgeventbreakunknownbreakpoint
#, object-pascal-format
msgid "Unknown Breakpoint %s"
msgstr "Неизвестная точка останова %s"
#: lazarusidestrconsts.dbgeventbreakwatchpoint
#, object-pascal-format
msgid "Watchpoint %s"
msgstr "Наблюдение %s"
#: lazarusidestrconsts.dbgeventunknownwatchpointscopeended
#, object-pascal-format
msgid "Unknown Watchpoint out of scope %s"
msgstr "Неизвестное наблюдение вне области действия %s"
#: lazarusidestrconsts.dbgeventunknownwatchpointtriggered
#, object-pascal-format
msgid "Unknown Watchpoint triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Сработало неизвестное наблюдение %s. Старое значение - \"%s\", новое значение - \"%s\""
#: lazarusidestrconsts.dbgeventwatchscopeended
#, object-pascal-format
msgid "Watchpoint for \"%s\" out of scope %s"
msgstr "Наблюдение для \"%s\" вне области действия %s"
#: lazarusidestrconsts.dbgeventwatchtriggered
#, object-pascal-format
msgid "Watchpoint for \"%s\" was triggered %s. Old value \"%s\", New Value \"%s\""
msgstr "Сработало наблюдение для \"%s\" %s. Старое значение - \"%s\", новое значение - \"%s\""
#: lazarusidestrconsts.dlfmousepredefinedscheme
msgid "Use predefined scheme"
msgstr "Использовать готовую схему"
#: lazarusidestrconsts.dlfmouseresetall
msgid "Reset all settings"
msgstr "Сбросить все параметры"
#: lazarusidestrconsts.dlfmouseresetgutter
msgid "Reset all gutter settings"
msgstr "Сбросить все параметры бокового поля"
#: lazarusidestrconsts.dlfmouseresettext
msgid "Reset all text settings"
msgstr "Сбросить все параметры текста"
#: lazarusidestrconsts.dlfmousesimplebuttonaddhistorypoint
msgid "Add history point"
msgstr "Добавить точку перехода в историю"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenu
msgid "Context Menu"
msgstr "Контекстное меню"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenudbg
msgid "Context Menu (debug)"
msgstr "Контекстное меню (отладка)"
#: lazarusidestrconsts.dlfmousesimplebuttoncontextmenutab
msgid "Context Menu (tab)"
msgstr "Контекстное меню (вкладка)"
#: lazarusidestrconsts.dlfmousesimplebuttondeclaration
msgid "Jumps to implementation"
msgstr "Перейти к реализации"
#: lazarusidestrconsts.dlfmousesimplebuttondeclarationblock
msgid "Jumps to implementation/other block end"
msgstr "Перейти к реализации / концу другого блока"
#: lazarusidestrconsts.dlfmousesimplebuttonhistback
msgid "History back"
msgstr "Перейти по истории назад"
#: lazarusidestrconsts.dlfmousesimplebuttonhistforw
msgid "History forward"
msgstr "Перейти по истории вперёд"
#: lazarusidestrconsts.dlfmousesimplebuttonmulticarettoggle
msgid "Toggle extra Caret"
msgstr "Включить или выключить дополнительный курсор"
#: lazarusidestrconsts.dlfmousesimplebuttonnothing
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonnothing"
msgid "Nothing/Default"
msgstr "Ничего / по умолчанию"
#: lazarusidestrconsts.dlfmousesimplebuttonpaste
msgctxt "lazarusidestrconsts.dlfmousesimplebuttonpaste"
msgid "Paste"
msgstr "Вставить"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinue
#, object-pascal-format
msgid "Continue %0:s (Bound to: %1:s)"
msgstr "Продолжение действия: %0:s (привязано к %1:s)"
#: lazarusidestrconsts.dlfmousesimplebuttonselcontinueplain
#, object-pascal-format
msgid "Continue %0:s"
msgstr "Продолжение действия: %0:s"
#: lazarusidestrconsts.dlfmousesimplebuttonselect
msgid "Select text"
msgstr "Выделить текст"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyline
msgid "Select text (lines)"
msgstr "Выделить текст (строки)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbytoken
msgid "Select text (tokens)"
msgstr "Выделить текст (элементы)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectbyword
msgid "Select text (words)"
msgstr "Выделить текст (слова)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectcolumn
msgid "Select text (Column mode)"
msgstr "Выделить текст (режим столбцов)"
#: lazarusidestrconsts.dlfmousesimplebuttonselectline
msgid "Select text (Line mode)"
msgstr "Выделить текст (режим строк)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetfreebookmark
msgid "Set free bookmark"
msgstr "Установить свободную закладку"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinefull
msgid "Select current Line (Full)"
msgstr "Выделить текущую строку (всю)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetlinesmart
msgid "Select current Line (Text)"
msgstr "Выделить текущую строку (текст)"
#: lazarusidestrconsts.dlfmousesimplebuttonsetpara
msgid "Select current Paragraph"
msgstr "Выделить текущий абзац"
#: lazarusidestrconsts.dlfmousesimplebuttonsetword
msgid "Select current Word"
msgstr "Выделить текущее слово"
#: lazarusidestrconsts.dlfmousesimplebuttonzoomreset
msgid "Reset zoom"
msgstr "Сбросить масштаб"
#: lazarusidestrconsts.dlfmousesimplediff
msgid "This page does not represent your current settings. See advanced page. Use this page to reset any advanced changes"
msgstr "Эта страница не отражает текущие значения расширенных параметров. Используйте данную страницу для сброса любых их изменений"
#: lazarusidestrconsts.dlfmousesimplegenericsect
msgctxt "lazarusidestrconsts.dlfmousesimplegenericsect"
msgid "General"
msgstr "Общие"
#: lazarusidestrconsts.dlfmousesimplegutterleftdown
msgid "Standard, All actions (breakpoint, fold) on mouse down"
msgstr "Стандартное, все действия - при нажатии кнопки мыши"
#: lazarusidestrconsts.dlfmousesimplegutterleftup
msgid "Extended, Actions (breakpoint, fold) on mouse up. Selection on mouse down and move"
msgstr "Расширенное, действия - при отпускании кнопки мыши. Выделение - при нажатии и перемещении"
#: lazarusidestrconsts.dlfmousesimplegutterleftupright
msgid "Extended, Actions, right gutter half only"
msgstr "Расширенное, действия - при нажатии кнопки мыши на правой половине поля"
#: lazarusidestrconsts.dlfmousesimplegutterlines
msgid "Use line numbers to select lines"
msgstr "Выделять строку при щелчке по её номеру"
#: lazarusidestrconsts.dlfmousesimpleguttersect
msgctxt "lazarusidestrconsts.dlfmousesimpleguttersect"
msgid "Gutter"
msgstr "Боковое поле"
#: lazarusidestrconsts.dlfmousesimplerightmovecaret
msgid "Right button click includes caret move"
msgstr "Перемещать курсор правой кнопкой мыши"
#: lazarusidestrconsts.dlfmousesimpletextsect
msgctxt "lazarusidestrconsts.dlfmousesimpletextsect"
msgid "Text"
msgstr "Текст"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrllabel
msgid "Alt-Ctrl Button"
msgstr "Alt-Ctrl - кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectaltctrlwheellabel
msgid "Alt-Ctrl Wheel"
msgstr "Alt-Ctrl - колёсико"
#: lazarusidestrconsts.dlfmousesimpletextsectaltlabel
msgid "Alt Button"
msgstr "Alt - кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectaltwheellabel
msgid "Alt Wheel"
msgstr "Alt - колёсико"
#: lazarusidestrconsts.dlfmousesimpletextsectctrllabel
msgid "Ctrl Button"
msgstr "Ctrl - кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectctrlwheellabel
msgid "Ctrl Wheel"
msgstr "Ctrl - колёсико"
#: lazarusidestrconsts.dlfmousesimpletextsectdrag
msgid "Drag selection (copy/paste)"
msgstr "Копировать/вставлять перетаскиванием"
#: lazarusidestrconsts.dlfmousesimpletextsectextra1label
msgid "Extra-1 Button"
msgstr "Дополнительная-1"
#: lazarusidestrconsts.dlfmousesimpletextsectextra2label
msgid "Extra-2 Button"
msgstr "Дополнительная-2"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublealtlabel
msgid "Alt Double"
msgstr "Alt - двойной"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublectrllabel
msgid "Ctrl Double"
msgstr "Ctrl - двойной"
#: lazarusidestrconsts.dlfmousesimpletextsectldoublelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectldoublelabel"
msgid "Double"
msgstr "Двойной"
#: lazarusidestrconsts.dlfmousesimpletextsectldoubleshiftlabel
msgid "Shift Double"
msgstr "Shift - двойной"
#: lazarusidestrconsts.dlfmousesimpletextsectlquadlabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectlquadlabel"
msgid "Quad"
msgstr "Четверной"
#: lazarusidestrconsts.dlfmousesimpletextsectltriplelabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectltriplelabel"
msgid "Triple"
msgstr "Тройной"
#: lazarusidestrconsts.dlfmousesimpletextsectmidlabel
msgid "Middle Button"
msgstr "Средняя"
#: lazarusidestrconsts.dlfmousesimpletextsectpagebtn
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagebtn"
msgid "Middle"
msgstr "Средняя"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra1
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra1"
msgid "Extra 1"
msgstr "Дополнительная 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpageextra2
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageextra2"
msgid "Extra 2"
msgstr "Дополнительная 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpagehorizwheel
msgid "Horizontal-Wheel"
msgstr "Колёсико горизонтально"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmod
msgid "Left 1"
msgstr "Левая 1"
#: lazarusidestrconsts.dlfmousesimpletextsectpagelmulti
msgid "Left 2"
msgstr "Левая 2"
#: lazarusidestrconsts.dlfmousesimpletextsectpageright
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpageright"
msgid "Right"
msgstr "Правая"
#: lazarusidestrconsts.dlfmousesimpletextsectpagewheel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectpagewheel"
msgid "Wheel"
msgstr "Колёсико"
#: lazarusidestrconsts.dlfmousesimpletextsectrightlabel
msgid "Right Button"
msgstr "Правая"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrllabel
msgid "Shift-Alt-Ctrl Button"
msgstr "Shift-Alt-Ctrl - кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltctrlwheellabel
msgid "Shift-Alt-Ctrl"
msgstr "Shift-Alt-Ctrl"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltlabel
msgid "Shift-Alt Button"
msgstr "Shift-Alt - кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftaltwheellabel
msgid "Shift-Alt Wheel"
msgstr "Shift-Alt - колёсико"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrllabel
msgid "Shift-Ctrl Button"
msgstr "Shift-Ctrl - кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftctrlwheellabel
msgid "Shift-Ctrl Wheel"
msgstr "Shift-Ctrl - колёсико"
#: lazarusidestrconsts.dlfmousesimpletextsectshiftlabel
msgid "Shift Button"
msgstr "Shift - кнопка"
#: lazarusidestrconsts.dlfmousesimpletextsectwheellabel
msgctxt "lazarusidestrconsts.dlfmousesimpletextsectwheellabel"
msgid "Wheel"
msgstr "Колёсико"
#: lazarusidestrconsts.dlfmousesimpletextshiftsectwheellabel
msgid "Shift Wheel"
msgstr "Shift - колёсико"
#: lazarusidestrconsts.dlfmousesimplewarning
msgid "You have unsaved changes. Using this page will undo changes made on the advanced page"
msgstr "Имеются несохранённые изменения. Использование этой страницы сбросит изменения на странице расширенных параметров"
#: lazarusidestrconsts.dlfmousesimplewheelhsrolldef
msgid "Scroll horizontal (System speed)"
msgstr "Прокрутить горизонтально (системная скорость)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollline
msgid "Scroll horizontal (Single line)"
msgstr "Прокрутить горизонтально (одна строка)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpage
msgid "Scroll horizontal (Page)"
msgstr "Прокрутить горизонтально (страница)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpagehalf
msgid "Scroll horizontal (Half page)"
msgstr "Прокрутить горизонтально (полстраницы)"
#: lazarusidestrconsts.dlfmousesimplewheelhsrollpageless
msgid "Scroll horizontal (Page, less one line)"
msgstr "Прокрутить горизонтально (страница минус одна строка)"
#: lazarusidestrconsts.dlfmousesimplewheelnothing
msgctxt "lazarusidestrconsts.dlfmousesimplewheelnothing"
msgid "Nothing/Default"
msgstr "Ничего / по умолчанию"
#: lazarusidestrconsts.dlfmousesimplewheelsrolldef
msgid "Scroll (System speed)"
msgstr "Прокрутить (системная скорость)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollline
msgid "Scroll (Single line)"
msgstr "Прокрутить (одна строка)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpage
msgid "Scroll (Page)"
msgstr "Прокрутить (страница)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpagehalf
msgid "Scroll (Half page)"
msgstr "Прокрутить (полстраницы)"
#: lazarusidestrconsts.dlfmousesimplewheelsrollpageless
msgid "Scroll (Page, less one line)"
msgstr "Прокрутить (страница минус одна строка)"
#: lazarusidestrconsts.dlfmousesimplewheelzoom
msgid "Zoom"
msgstr "Изменить масштаб"
#: lazarusidestrconsts.dlfnopredefinedscheme
msgid "< None >"
msgstr "< Нет >"
#: lazarusidestrconsts.dlfreadonlycolor
msgctxt "lazarusidestrconsts.dlfreadonlycolor"
msgid "Read Only"
msgstr "Только чтение"
#: lazarusidestrconsts.dlg1up2low
msgid "Lowercase, first letter up"
msgstr "Только первая буква заглавная"
#: lazarusidestrconsts.dlgactivedesktop
msgid "active"
msgstr "активный"
#: lazarusidestrconsts.dlgaddassignmentoperator
msgid "Add assignment operator :="
msgstr "Добавлять оператор присваивания :="
#: lazarusidestrconsts.dlgaddhiattrbracketmatch
msgid "Brackets highlight"
msgstr "Подсветка скобок"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtree
msgid "Code folding tree"
msgstr "Дерево сворачиваний кода"
#: lazarusidestrconsts.dlgaddhiattrcodefoldingtreecur
msgid "Code folding (current)"
msgstr "Сворачивание кода (текущее)"
#: lazarusidestrconsts.dlgaddhiattrdefault
msgid "Default Text"
msgstr "Текст по умолчанию"
#: lazarusidestrconsts.dlgaddhiattrdefaultwindow
msgid "Default Text / Window"
msgstr "Текст по умолчанию / окно"
#: lazarusidestrconsts.dlgaddhiattrdisabledbreakpoint
msgid "Disabled breakpoint"
msgstr "Отключённая точка останова"
#: lazarusidestrconsts.dlgaddhiattrenabledbreakpoint
msgid "Enabled breakpoint"
msgstr "Включённая точка останова"
#: lazarusidestrconsts.dlgaddhiattrerrorline
msgid "Error line"
msgstr "Строка с ошибкой"
#: lazarusidestrconsts.dlgaddhiattrexecutionpoint
msgid "Execution point"
msgstr "Точка исполнения"
#: lazarusidestrconsts.dlgaddhiattrfoldedcode
msgid "Folded code marker"
msgstr "Знак свёрнутого кода"
#: lazarusidestrconsts.dlgaddhiattrfoldedcodeline
msgid "Fold start-line"
msgstr "Строка начала свёрнутого блока"
#: lazarusidestrconsts.dlgaddhiattrgroupdefault
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupdefault"
msgid "Global"
msgstr "Глобальные"
#: lazarusidestrconsts.dlgaddhiattrgroupgutter
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupgutter"
msgid "Gutter"
msgstr "Боковое поле"
#: lazarusidestrconsts.dlgaddhiattrgroupifdef
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.dlgaddhiattrgroupline
msgctxt "lazarusidestrconsts.dlgaddhiattrgroupline"
msgid "Line"
msgstr "Строка"
#: lazarusidestrconsts.dlgaddhiattrgroupoutlinecolors
msgid "Outline Colors"
msgstr "Цвета контуров блоков"
#: lazarusidestrconsts.dlgaddhiattrgroupsyncroedit
msgid "Syncron Edit"
msgstr "Синхронное редактирование"
#: lazarusidestrconsts.dlgaddhiattrgrouptemplateedit
msgid "Template Edit"
msgstr "Редактирование шаблона"
#: lazarusidestrconsts.dlgaddhiattrgrouptext
msgctxt "lazarusidestrconsts.dlgaddhiattrgrouptext"
msgid "Text"
msgstr "Текст"
#: lazarusidestrconsts.dlgaddhiattrgutterseparator
msgid "Gutter Separator"
msgstr "Линия отделения бокового поля"
#: lazarusidestrconsts.dlgaddhiattrhiddencodeline
msgid "Hide start-line"
msgstr "Строка начала скрытого блока"
#: lazarusidestrconsts.dlgaddhiattrhighlightall
msgid "Incremental others"
msgstr "Остальные совпадения при инкрементном поиске"
#: lazarusidestrconsts.dlgaddhiattrhighlightprefix
msgctxt "lazarusidestrconsts.dlgaddhiattrhighlightprefix"
msgid "Highlight prefix"
msgstr "Подсветка префикса"
#: lazarusidestrconsts.dlgaddhiattrhighlightword
msgid "Highlight current word"
msgstr "Подсветка текущего слова"
#: lazarusidestrconsts.dlgaddhiattrincrementalsearch
msgid "Incremental search"
msgstr "Текущее совпадение при инкрементном поиске"
#: lazarusidestrconsts.dlgaddhiattrinvalidbreakpoint
msgid "Invalid breakpoint"
msgstr "Неработоспособная точка останова"
#: lazarusidestrconsts.dlgaddhiattrlinehighlight
msgid "Current line highlight"
msgstr "Подсветка текущей строки"
#: lazarusidestrconsts.dlgaddhiattrlinenumber
msgid "Line number"
msgstr "Номер строки"
#: lazarusidestrconsts.dlgaddhiattrmodifiedline
msgid "Modified line"
msgstr "Изменённая строка"
#: lazarusidestrconsts.dlgaddhiattrmouselink
msgid "Mouse link"
msgstr "Ссылка при наведении мыши"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel10color
msgid "Level 10"
msgstr "Уровень 10"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel1color
msgid "Level 1"
msgstr "Уровень 1"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel2color
msgid "Level 2"
msgstr "Уровень 2"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel3color
msgid "Level 3"
msgstr "Уровень 3"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel4color
msgid "Level 4"
msgstr "Уровень 4"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel5color
msgid "Level 5"
msgstr "Уровень 5"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel6color
msgid "Level 6"
msgstr "Уровень 6"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel7color
msgid "Level 7"
msgstr "Уровень 7"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel8color
msgid "Level 8"
msgstr "Уровень 8"
#: lazarusidestrconsts.dlgaddhiattroutlinelevel9color
msgid "Level 9"
msgstr "Уровень 9"
#: lazarusidestrconsts.dlgaddhiattrrecentlyused
msgid "Recently used item"
msgstr "Недавно использовавшийся элемент"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditarea
msgid "Selected Area"
msgstr "Выделенная область"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditcur"
msgid "Active Cell"
msgstr "Текущее поле"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditother"
msgid "Other Cells"
msgstr "Другие поля"
#: lazarusidestrconsts.dlgaddhiattrsyncroeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrsyncroeditsync"
msgid "Syncronized Cells"
msgstr "Синхронизируемые поля"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditcur
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditcur"
msgid "Active Cell"
msgstr "Текущее поле"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditother
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditother"
msgid "Other Cells"
msgstr "Другие поля"
#: lazarusidestrconsts.dlgaddhiattrtemplateeditsync
msgctxt "lazarusidestrconsts.dlgaddhiattrtemplateeditsync"
msgid "Syncronized Cells"
msgstr "Синхронизируемые поля"
#: lazarusidestrconsts.dlgaddhiattrtextblock
msgid "Text block"
msgstr "Выделение текста"
#: lazarusidestrconsts.dlgaddhiattrunknownbreakpoint
msgid "Unknown breakpoint"
msgstr "Неизвестная точка останова"
#: lazarusidestrconsts.dlgaddhiattrwindowborder
msgid "Window border"
msgstr "Граница окна"
#: lazarusidestrconsts.dlgaddhiattrwordgroup
msgid "Word-Brackets"
msgstr "Операторные скобки"
#: lazarusidestrconsts.dlgaddhispecialvisiblechars
msgid "Visualized Special Chars"
msgstr "Видимые специальные символы"
#: lazarusidestrconsts.dlgaddnewmode
msgid "Add new mode"
msgstr "Добавить новый режим"
#: lazarusidestrconsts.dlgaddsemicolon
msgid "Add semicolon"
msgstr "Добавлять точку с запятой"
#: lazarusidestrconsts.dlgadjusttopline
msgid "Adjust top line due to comment in front"
msgstr "Устанавливать верхнюю строку на комментарии"
#: lazarusidestrconsts.dlgalphabetically
msgid "Alphabetically"
msgstr "По алфавиту"
#: lazarusidestrconsts.dlgalwaysvisiblecursor
msgid "Always keep caret in visible area of editor"
msgstr "Всегда держать курсор в видимой части редактора"
#: lazarusidestrconsts.dlgambigfileact
msgid "Ambiguous file action:"
msgstr "Неясное действие с файлом:"
#: lazarusidestrconsts.dlgambigwarn
msgid "Warn on compile"
msgstr "Предупредить при компиляции"
#: lazarusidestrconsts.dlganiconforerrorwarninghintisshown
msgid "An icon for error/warning/hint is shown in front of a message. The same icon shows in source editor gutter in any case."
msgstr "Значок для ошибки/предупреждения/подсказки отображается перед сообщением. Тот же значок выводится в редакторе исходного кода в любом случае."
#: lazarusidestrconsts.dlgansicommenttab
msgid "Ansi (* *)"
msgstr "ANSI (* *)"
#: lazarusidestrconsts.dlgapplicationsettings
msgid "Application settings"
msgstr "Параметры приложения"
#: lazarusidestrconsts.dlgassertcode
msgid "Include assertion code"
msgstr "Включить код Assert"
#: lazarusidestrconsts.dlgassociateddebugdesktop
#, object-pascal-format
msgid "Associated debug desktop for \"%s\""
msgstr "Связанный отладочный рабочий стол для \"%s\""
#: lazarusidestrconsts.dlgassociateddebugdesktophint
msgid "If you select the desktop, the associated debug desktop will be selected as well."
msgstr "При выборе рабочего стола также будет выбран связанный с ним отладочный рабочий стол."
#: lazarusidestrconsts.dlgautocreateforms
msgid "Auto-create forms:"
msgstr "Автосоздаваемые формы:"
#: lazarusidestrconsts.dlgautocreateformshint
msgid "Main .lpr unit creates each form with Application.CreateForm(). They are also freed automatically."
msgstr "Каждая форма создаётся в главном модуле .lpr посредством вызова Application.CreateForm(). Освобождаются формы также автоматически."
#: lazarusidestrconsts.dlgautocreatenewforms
msgid "Auto-create new forms"
msgstr "Создавать новые формы автоматически"
#: lazarusidestrconsts.dlgautodel
msgid "Auto delete file"
msgstr "Автоматически удалить файл"
#: lazarusidestrconsts.dlgautodisplayfuncproto
msgid "Auto Display Function Prototypes"
msgstr "Автоматически отображать прототипы функций"
#: lazarusidestrconsts.dlgautohidecursor
msgid "Hide mouse pointer when typing"
msgstr "Скрывать курсор мыши во время набора текста"
#: lazarusidestrconsts.dlgautoindent
msgctxt "lazarusidestrconsts.dlgautoindent"
msgid "Auto indent"
msgstr "Автоматический отступ"
#: lazarusidestrconsts.dlgautoindentlink
msgid "(Set up smart indent)"
msgstr "(Настроить)"
#: lazarusidestrconsts.dlgautoindenttype
msgctxt "lazarusidestrconsts.dlgautoindenttype"
msgid "Auto indent"
msgstr "Автоматический отступ"
#: lazarusidestrconsts.dlgautoremoveemptymethods
msgid "Auto remove empty methods"
msgstr "Автоматически удалять пустые методы"
#: lazarusidestrconsts.dlgautoren
msgid "Auto rename file lowercase"
msgstr "Переименовать в нижний регистр"
#: lazarusidestrconsts.dlgautosaveactivedesktop
msgid "Auto save active desktop"
msgstr "Автоматически сохранять активный"
#: lazarusidestrconsts.dlgautosaveactivedesktophint
msgid ""
"Save active desktop on IDE close\n"
"Save debug desktop on IDE close and debug end"
msgstr ""
"Сохранять активный рабочий стол при закрытии IDE,\n"
"сохранять отладочный рабочий стол при закрытии IDE и окончании отладки"
#: lazarusidestrconsts.dlgavailableforms
msgid "Available forms:"
msgstr "Доступные формы:"
#: lazarusidestrconsts.dlgavailableformshint
msgid "These forms must be created and freed in the program code."
msgstr "Эти формы должны создаваться и освобождаться в коде программы."
#: lazarusidestrconsts.dlgavoidunnecessaryjumps
msgid "Avoid unnecessary jumps"
msgstr "Избегать излишних переходов"
#: lazarusidestrconsts.dlgbackcolor
msgid "Background"
msgstr "Фон"
#: lazarusidestrconsts.dlgbaknosubdirectory
msgid "(no subdirectory)"
msgstr "(нет подкаталога)"
#: lazarusidestrconsts.dlgbckupsubdir
msgid "Same name (in subdirectory)"
msgstr "То же имя (в подкаталоге)"
#: lazarusidestrconsts.dlgbehindmethods
msgid "Behind methods"
msgstr "После методов"
#: lazarusidestrconsts.dlgblockgroupoptions
msgctxt "lazarusidestrconsts.dlgblockgroupoptions"
msgid "Selection"
msgstr "Выделение"
#: lazarusidestrconsts.dlgblockindent
msgid "Block indent (spaces)"
msgstr "Отступ блока в пробелах"
#: lazarusidestrconsts.dlgblockindentkeys
msgid "Block indent"
msgstr "Отступ блока"
#: lazarusidestrconsts.dlgblockindentlink
msgid "(edit keys)"
msgstr "(изменить клавиши)"
#: lazarusidestrconsts.dlgblockindenttypecopy
msgid "Space/tab as prev Line"
msgstr "Пробел/ТАБ как на строке выше"
#: lazarusidestrconsts.dlgblockindenttypepos
msgid "Position only"
msgstr "Только положение"
#: lazarusidestrconsts.dlgblockindenttypespace
msgid "Spaces"
msgstr "Пробелы"
#: lazarusidestrconsts.dlgblockindenttypetabonly
msgid "Tabs, cut off"
msgstr "ТАБы, обрезать \"лишнее\""
#: lazarusidestrconsts.dlgblockindenttypetabspace
msgid "Tabs, then spaces"
msgstr "ТАБы, затем пробелы"
#: lazarusidestrconsts.dlgblocktabindent
msgid "Block indent (tabs)"
msgstr "Отступ блока в ТАБах"
#: lazarusidestrconsts.dlgbookmarksetscroll
msgid "Restore scroll position for bookmarks"
msgstr "Восстанавливать положение прокрутки для закладок"
#: lazarusidestrconsts.dlgborderspacecanbesetinanchoreditor
msgid "Border space can be set in Anchor editor. A colored line is shown if spacing > 0."
msgstr "Если установленный в редакторе привязок зазор больше нуля, отображается цветная рамка"
#: lazarusidestrconsts.dlgborderspacingcolor
msgid "BorderSpacing frame"
msgstr "Рамка зазоров"
#: lazarusidestrconsts.dlgbrackethighlight
msgid "Bracket highlight"
msgstr "Подсветка скобок"
#: lazarusidestrconsts.dlgbracketmatchgroup
msgid "Matching bracket and quote pairs"
msgstr "Парные скобки и кавычки"
#: lazarusidestrconsts.dlgcannotusedockedundockeddesktop
msgid "You cannot use docked desktop in undocked environment and vice versa."
msgstr "Невозможно использовать стыкуемый рабочий стол в нестыкуемом окружении, и наоборот."
#: lazarusidestrconsts.dlgcaretbackcolor
msgid "Secondary carets (multi-caret mode)"
msgstr "Вторичные курсоры (многокурсорный режим)"
#: lazarusidestrconsts.dlgcaretcolor
msgctxt "lazarusidestrconsts.dlgcaretcolor"
msgid "Caret (Text-Cursor)"
msgstr "Курсор (в тексте)"
#: lazarusidestrconsts.dlgcaretcolorinfo
msgid "The caret color depends on the colors of text and background under the caret. Each pixel's RGB are bitwise inverted and XOR'ed with the chosen color's RGB."
msgstr "Цвет курсора зависит от цветов находящихся под ним текста и фона. Значения RGB каждого пикселя побитово инвертируются и складываются по XOR со значением RGB выбранного цвета."
#: lazarusidestrconsts.dlgcaretforecolor
msgid "Main or primary caret"
msgstr "Главный или первичный курсор"
#: lazarusidestrconsts.dlgcaretgroupoptions
msgid "Caret (Text Cursor)"
msgstr "Курсор (в тексте)"
#: lazarusidestrconsts.dlgcaretscrollgroupoptions
msgid "Caret (Text Cursor) past end of line"
msgstr "Перемещение курсора (в тексте) за конец строки"
#: lazarusidestrconsts.dlgcasesensitive
msgctxt "lazarusidestrconsts.dlgcasesensitive"
msgid "&Case sensitive"
msgstr "&Учитывать регистр"
#: lazarusidestrconsts.dlgccocaption
msgid "Checking compiler options"
msgstr "Проверка параметров компилятора"
#: lazarusidestrconsts.dlgccoorphanedfilefound
#, object-pascal-format
msgid "orphaned file found: %s"
msgstr "найден брошенный файл: %s"
#: lazarusidestrconsts.dlgccoresults
msgid "Results"
msgstr "Результаты"
#: lazarusidestrconsts.dlgccotest
msgctxt "lazarusidestrconsts.dlgccotest"
msgid "Test"
msgstr "Тест"
#: lazarusidestrconsts.dlgccotestcheckingcompiler
msgid "Test: Checking compiler ..."
msgstr "Тест: проверка компилятора ..."
#: lazarusidestrconsts.dlgccotestcheckingcompilerconfig
msgid "Test: Checking compiler configuration ..."
msgstr "Тест: проверка параметров компилятора ..."
#: lazarusidestrconsts.dlgccotestcompilerdate
msgid "Test: Checking compiler date ..."
msgstr "Тест: проверка даты компилятора ..."
#: lazarusidestrconsts.dlgccotestcompilingemptyfile
msgid "Test: Compiling an empty file ..."
msgstr "Тест: компиляция пустого файла ..."
#: lazarusidestrconsts.dlgccotestrtlunits
msgid "Test: Checking RTL units ..."
msgstr "Тест: проверка модулей RTL ..."
#: lazarusidestrconsts.dlgccotestsrcinppupaths
msgid "Test: Checking sources in fpc ppu search paths ..."
msgstr "Тест: проверка наличия файлов исходного кода в путях поиска ppu ..."
#: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile
msgid "Test: Compiling an empty file"
msgstr "Тест: компиляция пустого файла"
#: lazarusidestrconsts.dlgccousingconfigfile
#, object-pascal-format
msgid "using config file %s"
msgstr "используется файл настройки %s"
#: lazarusidestrconsts.dlgcdtclassorder
msgid "Class order"
msgstr "В порядке следования классов"
#: lazarusidestrconsts.dlgcdtlast
msgid "Last"
msgstr "В конце"
#: lazarusidestrconsts.dlgcdtlower
msgid "lowercase"
msgstr "нижний регистр"
#: lazarusidestrconsts.dlgcdtpreview
msgid "Preview (max line length = 1)"
msgstr "Предпросмотр (max длина = 1)"
#: lazarusidestrconsts.dlgcdtreadprefix
msgid "Read prefix"
msgstr "Префикс READ"
#: lazarusidestrconsts.dlgcdtstoredpostfix
msgid "Stored postfix"
msgstr "Префикс STORED"
#: lazarusidestrconsts.dlgcdtuppercase
msgid "UPPERCASE"
msgstr "ВЕРХНИЙ РЕГИСТР"
#: lazarusidestrconsts.dlgcdtvariableprefix
msgid "Variable prefix"
msgstr "Префикс переменной"
#: lazarusidestrconsts.dlgcdtwriteprefix
msgid "Write prefix"
msgstr "Префикс WRITE"
#: lazarusidestrconsts.dlgcharcasefileact
msgid "Save As - auto rename Pascal files lower case"
msgstr "Автопереименование в нижний регистр в диалоге 'Сохранить как'"
#: lazarusidestrconsts.dlgcheckandautosavefiles
msgid "Check and Auto Save Files"
msgstr "Проверка и автоматическое сохранение"
#: lazarusidestrconsts.dlgcheckpackagesonformcreate
msgid "Check packages on form create"
msgstr "Проверять пакеты при создании формы"
#: lazarusidestrconsts.dlgcheckpackagesonformcreatehint
msgid "The form may require a package to work. Install such a package automatically."
msgstr "Форма может требовать пакета для корректной работы. Установить его автоматически."
#: lazarusidestrconsts.dlgchscodetempl
msgid "Choose code template file (*.dci)"
msgstr "Выберите файл шаблонов кода (*.dci)"
#: lazarusidestrconsts.dlgclosebuttonsnotebook
msgid "Show close buttons in notebook"
msgstr "Показывать кнопки закрытия вкладок"
#: lazarusidestrconsts.dlgclrscheme
msgid "Color Scheme"
msgstr "Цветовая схема"
#: lazarusidestrconsts.dlgcmacro
msgid "C style macros (global)"
msgstr "Макросы в стиле C (глобально)"
#: lazarusidestrconsts.dlgcoansistr
msgctxt "lazarusidestrconsts.dlgcoansistr"
msgid "Use Ansistrings"
msgstr "Использовать строки Ansistring"
#: lazarusidestrconsts.dlgcoasmstyle
msgid "Assembler style"
msgstr "Стиль ассемблера"
#: lazarusidestrconsts.dlgcocfgcmpmessages
msgctxt "lazarusidestrconsts.dlgcocfgcmpmessages"
msgid "Messages"
msgstr "Сообщения"
#: lazarusidestrconsts.dlgcochecksandassertion
msgid "Checks and assertion"
msgstr "Проверки и Assert"
#: lazarusidestrconsts.dlgcocompilercommands
msgid "Compiler Commands"
msgstr "Команды компилятора"
#: lazarusidestrconsts.dlgcocops
msgid "C style operators (*=, +=, /= and -=)"
msgstr "Операторы в стиле C (*=, +=, /= и -=)"
#: lazarusidestrconsts.dlgcocreatemakefile
msgctxt "lazarusidestrconsts.dlgcocreatemakefile"
msgid "Create Makefile"
msgstr "Создать Makefile"
#: lazarusidestrconsts.dlgcodebugging
msgctxt "lazarusidestrconsts.dlgcodebugging"
msgid "Debugging"
msgstr "Отладка"
#: lazarusidestrconsts.dlgcodebugpath
msgid "Debugger path addition (none):"
msgstr "Дополнения к путям отладчика (нет):"
#: lazarusidestrconsts.dlgcodecreation
msgid "Code Creation"
msgstr "Создание кода"
#: lazarusidestrconsts.dlgcodefoldenableboth
msgid "Both"
msgstr "Сворачивать и скрывать"
#: lazarusidestrconsts.dlgcodefoldenablefold
msgid "Fold"
msgstr "Сворачивать"
#: lazarusidestrconsts.dlgcodefoldenablehide
msgid "Hide"
msgstr "Скрывать"
#: lazarusidestrconsts.dlgcodefoldpopuporder
msgid "Reverse fold-order in Popup"
msgstr "Обратить порядок элементов во всплывающем меню"
#: lazarusidestrconsts.dlgcogdb
msgid "Generate info for the debugger (slower / increases exe-size)"
msgstr "Генерировать отладочную информацию (медленнее / больше размер)"
#: lazarusidestrconsts.dlgcoheaptrc
msgid "Use Heaptrc unit (check for mem-leaks)"
msgstr "Использовать модуль Heaptrc (проверка на наличие утечек памяти)"
#: lazarusidestrconsts.dlgcoincfiles
msgid "Include files (-Fi):"
msgstr "Включаемые файлы (-Fi):"
#: lazarusidestrconsts.dlgcoinfoforgdb
msgid "Debugger info"
msgstr "Отладочная информация"
#: lazarusidestrconsts.dlgcolibraries
msgid "Libraries (-Fl):"
msgstr "Библиотеки (-Fl):"
#: lazarusidestrconsts.dlgcolinking
msgid "Linking"
msgstr "Компоновка"
#: lazarusidestrconsts.dlgcoloadsavehint
msgctxt "lazarusidestrconsts.dlgcoloadsavehint"
msgid "Compiler options can be saved to an XML file."
msgstr "Параметры компилятора могут быть сохранены в файл XML."
#: lazarusidestrconsts.dlgcolorlink
msgid "(Edit Color)"
msgstr "(Изменить цвет)"
#: lazarusidestrconsts.dlgcolornotmodified
msgid "Not modified"
msgstr "Исходный"
#: lazarusidestrconsts.dlgcolors
msgctxt "lazarusidestrconsts.dlgcolors"
msgid "Colors"
msgstr "Цвета"
#: lazarusidestrconsts.dlgcolorstml
msgid "TML Setup"
msgstr "Параметры TML"
#: lazarusidestrconsts.dlgcolorstmlbadsampletxtfile
#, object-pascal-format
msgid "Sample text file not found: %1:s"
msgstr "Файл с текстом-образцом не найден: %1:s"
#: lazarusidestrconsts.dlgcolorstmlerror
msgid "Error:"
msgstr "Ошибка:"
#: lazarusidestrconsts.dlgcolorstmlfromfile
msgid "File:"
msgstr "Файл:"
#: lazarusidestrconsts.dlgcolorstmlinfo
#, object-pascal-format
msgid "Below is a list of Highlighter (Textmate) found in the folder %1:s.%0:sThis list may include files with errors and files not yet active in the IDE.%0:sTo activate newly added/changed files restart the IDE.%0:sThe \"Reload\" button will update the list below, checking if any errors were fixed."
msgstr "Ниже представлен список модулей подсветки (Textmate), найденных в каталоге %1:s.%0:sЭтот список может содержать файлы, которые имеют ошибки либо ещё не подключены в IDE.%0:sДля подключения вновь созданных либо изменённых файлов требуется перезапуск IDE.%0:sКнопка \"Обновить\" позволит привести список в актуальное состояние и проверить, были ли исправлены какие-либо ошибки."
#: lazarusidestrconsts.dlgcolorstmlmissinginclude
#, object-pascal-format
msgid "Did not find all includes: %1:s"
msgstr "Не удалось найти все включаемые элементы: %1:s"
#: lazarusidestrconsts.dlgcolorstmlnofilesfound
msgid "No files found."
msgstr "Файлов не найдено."
#: lazarusidestrconsts.dlgcolorstmlnosampletxt
msgid "No sample text configured"
msgstr "Тексты-образцы не заданы"
#: lazarusidestrconsts.dlgcolorstmlok
msgid "OK"
msgstr "ОК"
#: lazarusidestrconsts.dlgcolorstmlrefresh
msgid "Reload"
msgstr "Обновить"
#: lazarusidestrconsts.dlgcommandlineparams
msgid "Command line parameters (without application name)"
msgstr "Параметры командной строки (без имени приложения)"
#: lazarusidestrconsts.dlgcommentalignmaxdefault
msgid "Max indent for new line if prefix is based on start of comment on first comment line:"
msgstr "Максимальный отступ новой строки при префиксе, привязанном к началу комментария на первой строке:"
#: lazarusidestrconsts.dlgcommentalignmaxtoken
msgid "Limit indent to"
msgstr "Ограничение отступа"
#: lazarusidestrconsts.dlgcommentcontinue
msgid "Prefix comments on linebreak"
msgstr "Добавлять префикс в новую строку комментария"
#: lazarusidestrconsts.dlgcommentcontinuematch
msgid "Match current line"
msgstr "Искать в текущей строке"
#: lazarusidestrconsts.dlgcommentcontinuematchasterisk
msgid "Match text including \"*\" of token \"(*\""
msgstr "Взять текст, включая \"*\" элемента \"(*\""
#: lazarusidestrconsts.dlgcommentcontinuematchline
msgid "Match whole line"
msgstr "Взять всю строку"
#: lazarusidestrconsts.dlgcommentcontinuematchtext
#, object-pascal-format
msgid "Match text after token \"%s\""
msgstr "Взять текст после элемента \"%s\""
#: lazarusidestrconsts.dlgcommentcontinuematchtoken
#, object-pascal-format
msgid "Match text including token \"%s\""
msgstr "Взять текст, включая элемент \"%s\""
#: lazarusidestrconsts.dlgcommentcontinueprefix
msgid "Prefix new line"
msgstr "Префикс новой строки"
#: lazarusidestrconsts.dlgcommentcontinueprefixinddefault
msgid "Align Prefix at indent of previous line"
msgstr "Выровнять префикс по отступу предыдущей строки"
#: lazarusidestrconsts.dlgcommentcontinueprefixindmatch
msgid "Align Prefix below start of comment on first comment line"
msgstr "Выровнять префикс по началу комментария на первой строке"
#: lazarusidestrconsts.dlgcommentcontinueprefixindnone
msgid "Do not indent prefix"
msgstr "Не делать отступ префикса"
#: lazarusidestrconsts.dlgcommentindentgroupoptions
msgid "Comments and Strings"
msgstr "Комментарии и строки"
#: lazarusidestrconsts.dlgcommentshlashextendalways
msgid "Extend if matched or not matched"
msgstr "Добавлять строку в любом случае"
#: lazarusidestrconsts.dlgcommentshlashextendalwayssplit
msgid "Extend if matched or not matched (not at EOL)"
msgstr "Добавлять строку, если курсор не находится в конце строки"
#: lazarusidestrconsts.dlgcommentshlashextendmatch
msgid "Extend if matched"
msgstr "Добавлять строку при соответствии"
#: lazarusidestrconsts.dlgcommentshlashextendmatchsplit
msgid "Extend if matched and caret in the middle of text (not at EOL)"
msgstr "Добавлять строку при соответствии (курсор не в конце строки)"
#: lazarusidestrconsts.dlgcompilationandlinking
msgid "Compilation and Linking"
msgstr "Компиляция и компоновка"
#: lazarusidestrconsts.dlgcompilermessage
msgid "Compiler messages"
msgstr "Сообщения компилятора"
#: lazarusidestrconsts.dlgcompilermessages
msgid "Compiler messages language file (*.msg)"
msgstr "Языковой файл сообщений компилятора (*.msg)"
#: lazarusidestrconsts.dlgcompleteproperties
msgid "Complete properties"
msgstr "Завершать свойства"
#: lazarusidestrconsts.dlgcomponentundermousecursorisfirstselected
msgid "Component under mouse cursor is first selected, then the popup menu commands work on it."
msgstr "Сначала компонент под курсором мыши выделяется, и только затем на нём срабатывают команды из всплывающего меню"
#: lazarusidestrconsts.dlgconfigandtarget
msgid "Config and Target"
msgstr "Настройка и целевая платформа"
#: lazarusidestrconsts.dlgconfigfiles
msgid "Config files"
msgstr "Файлы настройки"
#: lazarusidestrconsts.dlgconsolesizenotsupported
msgid "Current debugger does not support this."
msgstr "Текущий отладчик не поддерживает эту возможность."
#: lazarusidestrconsts.dlgcootherdebugginginfo
msgid "Other debugging info"
msgstr "Прочая отладочная информация"
#: lazarusidestrconsts.dlgcooverflow
msgid "Overflow"
msgstr "Переполнения"
#: lazarusidestrconsts.dlgcoparsing
msgid "Parsing"
msgstr "Анализ"
#: lazarusidestrconsts.dlgcopypastekeepfolds
msgid "Copy/Paste with fold info"
msgstr "Копировать/вставлять со свёрнутостью"
#: lazarusidestrconsts.dlgcopywordatcursoroncopynone
msgid "Copy current word when no selection exists"
msgstr "Копировать текущее слово при отсутствии выделения"
#: lazarusidestrconsts.dlgcorange
msgctxt "lazarusidestrconsts.dlgcorange"
msgid "Range"
msgstr "Диапазона"
#: lazarusidestrconsts.dlgcorelocatable
msgid "Relocatable"
msgstr "Перемещаемый"
#: lazarusidestrconsts.dlgcosetasdefault
msgid "Set compiler options as default"
msgstr "Использовать как параметры по умолчанию"
#: lazarusidestrconsts.dlgcoshowoptions
msgid "&Show Options"
msgstr "&Показать параметры"
#: lazarusidestrconsts.dlgcosmartlinkable
msgid "Smart linkable"
msgstr "Умная компоновка"
#: lazarusidestrconsts.dlgcosources
msgid "Other sources (.pp/.pas files, used only by IDE not by compiler)"
msgstr "Прочие файлы исходного кода (файлы .pp/.pas, нужны только IDE, не компилятору)"
#: lazarusidestrconsts.dlgcostack
msgid "Stack"
msgstr "Стека"
#: lazarusidestrconsts.dlgcostrip
msgid "Strip symbols from executable"
msgstr "Вырезать символы из исполнимого файла"
#: lazarusidestrconsts.dlgcosymboltype
msgid "Type of debug info"
msgstr "Тип отладочной информации"
#: lazarusidestrconsts.dlgcosymboltypeauto
msgctxt "lazarusidestrconsts.dlgcosymboltypeauto"
msgid "Automatic"
msgstr "Автоматический"
#: lazarusidestrconsts.dlgcosymboltypedwarf2
msgid "Dwarf 2"
msgstr "Dwarf 2"
#: lazarusidestrconsts.dlgcosymboltypedwarf2set
msgid "Dwarf 2 with sets"
msgstr "Dwarf 2 с поддержкой множеств"
#: lazarusidestrconsts.dlgcosymboltypedwarf3
msgid "Dwarf 3 (beta)"
msgstr "Dwarf 3 (бета)"
#: lazarusidestrconsts.dlgcosymboltypestabs
msgid "Stabs"
msgstr "Stabs"
#: lazarusidestrconsts.dlgcotrashvariables
msgid "Trash variables"
msgstr "Инициализировать переменные мусором"
#: lazarusidestrconsts.dlgcounitstyle
msgid "Unit style"
msgstr "Стиль модулей"
#: lazarusidestrconsts.dlgcovalgrind
msgid "Generate code for valgrind"
msgstr "Генерировать код для Valgrind"
#: lazarusidestrconsts.dlgcoverbosity
msgid "Verbosity"
msgstr "Подробность вывода"
#: lazarusidestrconsts.dlgcppinline
msgid "C++ styled INLINE"
msgstr "INLINE в стиле C++"
#: lazarusidestrconsts.dlgcreatenewrunparameterssettings
msgid "Create new Run Parameters settings"
msgstr "Создать новый набор параметров запуска"
#: lazarusidestrconsts.dlgcurlycommenttab
msgid "Curly { }"
msgstr "Фигурные скобки { }"
#: lazarusidestrconsts.dlgcurrentlyrespectedbymessageswindow
msgid "Currently respected by messages window, jump history and search results."
msgstr "Параметр оказывает влияние на окно сообщений, диалоги истории переходов и результатов поиска"
#: lazarusidestrconsts.dlgcursorbeyondeol
msgid "Cursor beyond EOL"
msgstr "Допускать установку курсора вне конца строки"
#: lazarusidestrconsts.dlgcursormoveclearsselection
msgid "Caret left/right clears selection (no move)"
msgstr "Сбрасывать выделение без перемещения курсора"
#: lazarusidestrconsts.dlgcursorskipsselection
msgid "Caret skips selection"
msgstr "Курсор пропускает выделенное"
#: lazarusidestrconsts.dlgcursorskipstab
msgid "Caret skips tabs"
msgstr "Курсор пропускает ТАБы"
#: lazarusidestrconsts.dlgcustomext
msgid "User defined extension (.pp.xxx)"
msgstr "Расширение пользователя (.pp.xxx)"
#: lazarusidestrconsts.dlgdebugdesktop
msgid "debug"
msgstr "отладочный"
#: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption
msgid "Path Editor"
msgstr "Редактор путей"
#: lazarusidestrconsts.dlgdebugtype
msgid "Debugger type and path"
msgstr "Тип отладчика и путь"
#: lazarusidestrconsts.dlgdefaulteditorfont
msgid "Default editor font"
msgstr "Шрифт редактора по умолчанию"
#: lazarusidestrconsts.dlgdefaulttabfont
msgid "Default tab font"
msgstr "Шрифт заголовка вкладки по умолчанию"
#: lazarusidestrconsts.dlgdefaultwinpos
msgid "Default Window/Console position and size"
msgstr "Положение и размер окна/консоли по умолчанию"
#: lazarusidestrconsts.dlgdefvaluecolor
msgid "Default Value"
msgstr "Значение по умолчанию"
#: lazarusidestrconsts.dlgdeletemode
msgid "Delete mode"
msgstr "Удалить режим"
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption
msgctxt "lazarusidestrconsts.dlgdeleteselecteddesktopbtncaption"
msgid "Delete"
msgstr "Удалить"
#: lazarusidestrconsts.dlgdeleteselecteddesktopbtnhint
msgid "Delete selected desktop"
msgstr "Удалить выбранный рабочий стол"
#: lazarusidestrconsts.dlgdeltemplate
msgid "Delete template "
msgstr "Удалить шаблон "
#: lazarusidestrconsts.dlgdesktopbuttons
msgid "Buttons - "
msgstr "Кнопок - "
#: lazarusidestrconsts.dlgdesktophints
msgid "Hints"
msgstr "Подсказки"
#: lazarusidestrconsts.dlgdesktopmenus
msgid "Menus - "
msgstr "Меню - "
#: lazarusidestrconsts.dlgdesktopname
msgid "Desktop name"
msgstr "Имя рабочего стола"
#: lazarusidestrconsts.dlgdesktopsexported
#, object-pascal-format
msgid "%d desktop(s) successfully exported to \"%s\""
msgstr "Рабочие столы (%d шт.) успешно экспортированы в \"%s\""
#: lazarusidestrconsts.dlgdesktopsimported
#, object-pascal-format
msgid "%d desktop(s) successfully imported from \"%s\""
msgstr "Рабочие столы (%d шт.) успешно импортированы из \"%s\""
#: lazarusidestrconsts.dlgdifferentvaluebackgroundcolor
msgid "Different values background"
msgstr "Фон различающихся значений"
#: lazarusidestrconsts.dlgdirection
msgid "Direction"
msgstr "Направление"
#: lazarusidestrconsts.dlgdisableantialiasing
msgid "Disable anti-aliasing"
msgstr "Отключить сглаживание"
#: lazarusidestrconsts.dlgdistancebetweengridpointsissmalleststep
msgid "Distance between grid points is the smallest step when moving a control."
msgstr "Расстояние между точками сетки является минимальным шагом перемещения компонента"
#: lazarusidestrconsts.dlgdividercolordefault
msgid "Use right margin color"
msgstr "Использовать цвет правой границы"
#: lazarusidestrconsts.dlgdividerdrawdepth
msgid "Draw divider level"
msgstr "Уровень отображения разделителя"
#: lazarusidestrconsts.dlgdividernestcolor
msgid "Nested line color"
msgstr "Цвет вложенной линии"
#: lazarusidestrconsts.dlgdividertopcolor
msgid "Line color"
msgstr "Цвет линии"
#: lazarusidestrconsts.dlgdivpasbeginendname
msgid "Begin/End"
msgstr "Begin/End"
#: lazarusidestrconsts.dlgdivpasprocedurename
msgid "Procedure/Function"
msgstr "Процедура/функция"
#: lazarusidestrconsts.dlgdivpasstructglobalname
msgid "Class/Struct"
msgstr "Класс/объект/запись"
#: lazarusidestrconsts.dlgdivpasstructlocalname
msgid "Class/Struct (local)"
msgstr "Класс/объект/запись (локальные)"
#: lazarusidestrconsts.dlgdivpastryname
msgid "Try/Except"
msgstr "Try/Except"
#: lazarusidestrconsts.dlgdivpasunitsectionname
msgid "Unit sections"
msgstr "Разделы модуля"
#: lazarusidestrconsts.dlgdivpasusesname
msgid "Uses clause"
msgstr "Выражение Uses"
#: lazarusidestrconsts.dlgdivpasvarglobalname
msgid "Var/Type"
msgstr "Секции Var/Type"
#: lazarusidestrconsts.dlgdivpasvarlocalname
msgctxt "lazarusidestrconsts.dlgdivpasvarlocalname"
msgid "Var/Type (local)"
msgstr "Секции Var/Type (локальные)"
#: lazarusidestrconsts.dlgdrawcomponentsnamebelowit
msgid "Draw the component's name below it."
msgstr "Отображать имя компонента под ним"
#: lazarusidestrconsts.dlgedback
msgid "Back"
msgstr "Назад"
#: lazarusidestrconsts.dlgedbold
msgid "Bold"
msgstr "Жирный"
#: lazarusidestrconsts.dlgedbsubdir
msgid "Sub directory"
msgstr "Подкаталог"
#: lazarusidestrconsts.dlgedcodetempl
msgctxt "lazarusidestrconsts.dlgedcodetempl"
msgid "Code Templates"
msgstr "Шаблоны кода"
#: lazarusidestrconsts.dlgedcompleteblocks
msgid "Add close statement for Pascal blocks"
msgstr "Добавлять к блокам Паскаля завершающий оператор"
#: lazarusidestrconsts.dlgedcustomext
msgid "User defined extension"
msgstr "Расширение пользователя"
#: lazarusidestrconsts.dlgeddelayinsec
#, object-pascal-format
msgid "(%s sec delay)"
msgstr "(задержка %s сек)"
#: lazarusidestrconsts.dlgeddisplay
msgid "Display"
msgstr "Отображение"
#: lazarusidestrconsts.dlgedfiles
msgid "Editor Files"
msgstr "Файлы редактора"
#: lazarusidestrconsts.dlgedidcomlet
msgctxt "lazarusidestrconsts.dlgedidcomlet"
msgid "Identifier completion"
msgstr "Завершить идентификатор"
#: lazarusidestrconsts.dlgedinvert
msgid "Invert"
msgstr "Обратить"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedoldedit
msgid "Ignore Locks, use longest unused editor"
msgstr "Игнорировать фиксацию для не использовавшегося наибольшее время редактора"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactedit
msgid "Ignore Locks, if editor is current"
msgstr "Игнорировать фиксацию для текущего редактора"
#: lazarusidestrconsts.dlgeditaccesscaptionignlockedonlyactwin
msgid "Ignore Locks, if editor in current window"
msgstr "Игнорировать фиксацию для редактора в текущем окне"
#: lazarusidestrconsts.dlgeditaccesscaptionlockedinview
msgid "Locked, if text in view"
msgstr "Зафиксированный, если текст в области просмотра"
#: lazarusidestrconsts.dlgeditaccesscaptionunlocked
msgid "Unlocked"
msgstr "Незафиксированный"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedinsoftview
msgid "Unlocked, if text in centered view"
msgstr "Незафиксированный, если текст в центре области просмотра"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinanywin
msgid "New tab, existing or new window"
msgstr "Новая вкладка в существующем или новом окне"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinnewwin
msgid "New tab in new window"
msgstr "Новая вкладка в новом окне"
#: lazarusidestrconsts.dlgeditaccesscaptionunlockedopennewinoldwin
msgid "New tab in existing window"
msgstr "Новая вкладка в существующем окне"
#: lazarusidestrconsts.dlgeditaccessdescignlockedoldedit
msgid "This option will use the longest unused editor for the file, even if it is locked and/or needs scrolling. The determination of the longest unused editor does not look at the order in which the windows were focused, even if this is set by the setting for \"same criteria order\". This option will always succeed, further options are never tested."
msgstr "Использование этого критерия приводит к выбору не использовавшегося наибольшее время редактора для файла, даже если он зафиксирован и/или ему требуется прокрутка. При этом не учитывается порядок перевода фокуса в окна, даже если он переводился по тому же набору критериев. Критерий всегда имеет соответствия, поэтому следующие за ним не анализируются."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactedit
msgid "This option will check if the current active editor has the target file and if it is, it will use the current editor, even if it is locked and/or needs scrolling."
msgstr "Использование этого критерия приводит к проверке наличия целевого файла в текущем редакторе. Если файл открыт, будет использоваться текущий редактор, даже если он зафиксирован и/или ему требуется прокрутка."
#: lazarusidestrconsts.dlgeditaccessdescignlockedonlyactwin
msgid "This option will check if there is an editor for the target file in the current window and if there is, it will use this editor, even if it is locked and/or needs scrolling."
msgstr "Использование этого критерия приводит к проверке наличия редактора для целевого файла в текущем окне. Найденный редактор будет использован, даже если он зафиксирован и/или ему требуется прокрутка."
#: lazarusidestrconsts.dlgeditaccessdesclockedinview
msgid "This option will use a locked (and only a locked) Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen area)."
msgstr "Использование этого критерия приводит к выбору зафиксированного (и только зафиксированного) редактора, которому не требуется прокрутка для отображения целевой точки перехода (она уже находится в области просмотра)."
#: lazarusidestrconsts.dlgeditaccessdescunlocked
msgid "This option will use any not locked Editor."
msgstr "Использование этого критерия приводит к выбору любого незафиксированного редактора."
#: lazarusidestrconsts.dlgeditaccessdescunlockedinsoftview
msgid "This option will use a not locked Editor which does not need to scroll in order to display the target jump point (target jump point is already in visible screen center area, excluding 2-5 lines at the top/bottom)."
msgstr "Использование этого критерия приводит к выбору незафиксированного редактора, которому не требуется прокрутка для отображения целевой точки перехода (она уже находится в центре области просмотра, то есть исключая 2-5 строк сверху и снизу)."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinanywin
msgid "This option will open a new Tab in an existing or new Window if no unlocked tab is found. This option will always succeed, further options are never tested."
msgstr "Использование этого критерия приводит к открытию новой вкладки в существующем или новом окне, если не найдено незафиксированного редактора. Критерий всегда имеет соответствия, поэтому следующие за ним не анализируются."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinnewwin
msgid "If no unlocked tab is found, then this option will open a new Tab in a new Window (even if other existing windows could be used for the new tab). This option will always succeed, further options are never tested."
msgstr "Если не найдено незафиксированного редактора, использование этого критерия приводит к открытию новой вкладки в новом окне (даже если для этого могут быть использованы существующие окна). Критерий всегда имеет соответствия, поэтому следующие за ним не анализируются."
#: lazarusidestrconsts.dlgeditaccessdescunlockedopennewinoldwin
msgid "If no unlocked tab is found, then this option will open a new Tab in an existing (and only in an existing) Window. A tab is only opened if there is a window that has no editor for the target file yet."
msgstr "Если не найдено незафиксированного редактора, использование этого критерия приводит к открытию новой вкладки в существующем (и только в существующем) окне. Вкладка открывается только при наличии окна, ещё не имеющего редактора для целевого файла."
#: lazarusidestrconsts.dlgedital
msgid "Italic"
msgstr "Курсив"
#: lazarusidestrconsts.dlgeditexportbackcolor
msgid "Use Background color in HTML export"
msgstr "Использовать цвет фона при экспорте HTML"
#: lazarusidestrconsts.dlgeditmaxlength
msgid "(Edit Max Length)"
msgstr "(Изменить максимальную длину)"
#: lazarusidestrconsts.dlgeditorfontsize
msgid "Editor font size"
msgstr "Размер шрифта"
#: lazarusidestrconsts.dlgeditoroptions
msgctxt "lazarusidestrconsts.dlgeditoroptions"
msgid "Editor options"
msgstr "Параметры редактора"
#: lazarusidestrconsts.dlgeditschemdefaults
msgid "Scheme globals"
msgstr "Глобальная схема"
#: lazarusidestrconsts.dlgedmisc
msgctxt "lazarusidestrconsts.dlgedmisc"
msgid "Miscellaneous"
msgstr "Разное"
#: lazarusidestrconsts.dlgedoff
msgid "Off"
msgstr "Выкл."
#: lazarusidestrconsts.dlgedon
msgid "On"
msgstr "Вкл."
#: lazarusidestrconsts.dlgedtabindent
msgid "Tab and Indent"
msgstr "Табуляция и отступ"
#: lazarusidestrconsts.dlgedunder
msgid "Underline"
msgstr "Подчёркнутый"
#: lazarusidestrconsts.dlgelastictabs
msgid "Elastic tabs"
msgstr "Эластичные ТАБы"
#: lazarusidestrconsts.dlgelastictabswidths
msgid "Elastic min Widths"
msgstr "Минимальная ширина эластичного ТАБа"
#: lazarusidestrconsts.dlgelementattributes
msgid "Element Attributes"
msgstr "Атрибуты элементов"
#: lazarusidestrconsts.dlgendkeyjumpstoneareststart
msgid "End key jumps to nearest end"
msgstr "End переводит к концу текста в строке"
#: lazarusidestrconsts.dlgenvask
msgid "Ask"
msgstr "Спросить"
#: lazarusidestrconsts.dlgenvbackuphelpnote
msgid "Notes: Project files are all files in the project directory"
msgstr "Внимание, файлы проекта - все файлы в его каталоге"
#: lazarusidestrconsts.dlgenvbckup
msgid "Backup"
msgstr "Резервные копии"
#: lazarusidestrconsts.dlgenvfiles
msgid "Files"
msgstr "Файлы"
#: lazarusidestrconsts.dlgenvgrid
msgid "Grid"
msgstr "Сетка"
#: lazarusidestrconsts.dlgenvidestartup
msgid "IDE Startup"
msgstr "Запуск IDE"
#: lazarusidestrconsts.dlgenvlanguage
msgctxt "lazarusidestrconsts.dlgenvlanguage"
msgid "Language"
msgstr "Язык"
#: lazarusidestrconsts.dlgenvlanguagerestarthint
msgctxt "lazarusidestrconsts.dlgenvlanguagerestarthint"
msgid "Restart the IDE to complete the language change."
msgstr "Перезапустите IDE для завершения переключения языка."
#: lazarusidestrconsts.dlgenvlguidelines
msgid "Guide lines"
msgstr "Линии позиционирования"
#: lazarusidestrconsts.dlgenvmisc
msgctxt "lazarusidestrconsts.dlgenvmisc"
msgid "Miscellaneous"
msgstr "Разное"
#: lazarusidestrconsts.dlgenvnone
msgctxt "lazarusidestrconsts.dlgenvnone"
msgid "None"
msgstr "Нет"
#: lazarusidestrconsts.dlgenvotherfiles
msgid "Other Files"
msgstr "Прочие файлы"
#: lazarusidestrconsts.dlgenvproject
msgid "Tabs for project"
msgstr "Вкладки проекта"
#: lazarusidestrconsts.dlgenvtype
msgctxt "lazarusidestrconsts.dlgenvtype"
msgid "Type"
msgstr "Тип"
#: lazarusidestrconsts.dlgeofocusmessagesatcompilation
msgid "Focus messages at compilation"
msgstr "Переводить фокус в окно сообщений при компиляции"
#: lazarusidestrconsts.dlgextracharspacing
msgid "Extra character spacing"
msgstr "Дополнительный межсимвольный интервал"
#: lazarusidestrconsts.dlgextralinespacing
msgid "Extra line spacing"
msgstr "Межстрочный интервал"
#: lazarusidestrconsts.dlgextsymb
msgid "Use external debug symbols file"
msgstr "Использовать внешний файл отладочных символов"
#: lazarusidestrconsts.dlgfileassociationinos
msgid "Opening Files from OS"
msgstr "Открытие файлов из ОС"
#: lazarusidestrconsts.dlgfileexts
msgid "File extensions"
msgstr "Расширения файлов"
#: lazarusidestrconsts.dlgfiles
#, object-pascal-format
msgid "%s files"
msgstr "Файлов: %s"
#: lazarusidestrconsts.dlgfilterall
msgctxt "lazarusidestrconsts.dlgfilterall"
msgid "All files"
msgstr "Все файлы"
#: lazarusidestrconsts.dlgfiltercodetoolstemplatefile
msgctxt "lazarusidestrconsts.dlgfiltercodetoolstemplatefile"
msgid "CodeTools template file"
msgstr "Файл шаблонов CodeTools"
#: lazarusidestrconsts.dlgfilterdcifile
msgid "DCI file"
msgstr "Файл DCI"
#: lazarusidestrconsts.dlgfilterdelphiform
msgid "Delphi form"
msgstr "Форма Delphi"
#: lazarusidestrconsts.dlgfilterdelphipackage
msgctxt "lazarusidestrconsts.dlgfilterdelphipackage"
msgid "Delphi package"
msgstr "Пакет Delphi"
#: lazarusidestrconsts.dlgfilterdelphiproject
msgctxt "lazarusidestrconsts.dlgfilterdelphiproject"
msgid "Delphi project"
msgstr "Проект Delphi"
#: lazarusidestrconsts.dlgfilterdelphiunit
msgctxt "lazarusidestrconsts.dlgfilterdelphiunit"
msgid "Delphi unit"
msgstr "Модуль Delphi"
#: lazarusidestrconsts.dlgfilterexecutable
msgctxt "lazarusidestrconsts.dlgfilterexecutable"
msgid "Executable"
msgstr "Исполнимый файл"
#: lazarusidestrconsts.dlgfilterfpcmessagefile
msgctxt "lazarusidestrconsts.dlgfilterfpcmessagefile"
msgid "FPC message file"
msgstr "Файл сообщений FPC"
#: lazarusidestrconsts.dlgfilterfppkgconfigurationfile
msgid "Fppkg configuration file"
msgstr "Файл настройки Fppkg"
#: lazarusidestrconsts.dlgfilterhtml
msgid "HTML files"
msgstr "Файлы HTML"
#: lazarusidestrconsts.dlgfilterimagesbitmap
msgid "Bitmap images"
msgstr "Изображения Bitmap"
#: lazarusidestrconsts.dlgfilterimagespixmap
msgid "Pixmap images"
msgstr "Изображения Pixmap"
#: lazarusidestrconsts.dlgfilterimagespng
msgid "PNG images"
msgstr "Изображения PNG"
#: lazarusidestrconsts.dlgfilterlazarusdesktopsettings
msgctxt "lazarusidestrconsts.dlgfilterlazarusdesktopsettings"
msgid "Lazarus Desktop Settings"
msgstr "Параметры рабочего стола Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruseditorfile
msgctxt "lazarusidestrconsts.dlgfilterlazaruseditorfile"
msgid "Editor file types"
msgstr "Типы файлов редактора"
#: lazarusidestrconsts.dlgfilterlazarusfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusfile"
msgid "Lazarus file"
msgstr "Файл Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusform
msgctxt "lazarusidestrconsts.dlgfilterlazarusform"
msgid "Lazarus form"
msgstr "Форма Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusinclude
msgctxt "lazarusidestrconsts.dlgfilterlazarusinclude"
msgid "Lazarus include file"
msgstr "Включаемый файл Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusotherfile
msgctxt "lazarusidestrconsts.dlgfilterlazarusotherfile"
msgid "Lazarus other file"
msgstr "Иной файл Lazarus"
#: lazarusidestrconsts.dlgfilterlazaruspackage
msgctxt "lazarusidestrconsts.dlgfilterlazaruspackage"
msgid "Lazarus package"
msgstr "Пакет Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusproject
msgctxt "lazarusidestrconsts.dlgfilterlazarusproject"
msgid "Lazarus project"
msgstr "Проект Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusprojectsource
msgctxt "lazarusidestrconsts.dlgfilterlazarusprojectsource"
msgid "Lazarus project source"
msgstr "Исходный код проекта Lazarus"
#: lazarusidestrconsts.dlgfilterlazarussession
msgid "Lazarus session"
msgstr "Сеанс работы в Lazarus"
#: lazarusidestrconsts.dlgfilterlazarusunit
msgctxt "lazarusidestrconsts.dlgfilterlazarusunit"
msgid "Lazarus unit"
msgstr "Модуль Lazarus"
#: lazarusidestrconsts.dlgfilterpackagelistfiles
msgid "Package list files"
msgstr "Файлы списков пакетов"
#: lazarusidestrconsts.dlgfilterpascalfile
msgctxt "lazarusidestrconsts.dlgfilterpascalfile"
msgid "Pascal file"
msgstr "Файл Паскаля"
#: lazarusidestrconsts.dlgfilterprograms
msgctxt "lazarusidestrconsts.dlgfilterprograms"
msgid "Programs"
msgstr "Программы"
#: lazarusidestrconsts.dlgfilterxml
msgctxt "lazarusidestrconsts.dlgfilterxml"
msgid "XML files"
msgstr "Файлы XML"
#: lazarusidestrconsts.dlgfindtextatcursor
msgid "Find text at cursor"
msgstr "Поиск текста под курсором"
#: lazarusidestrconsts.dlgfolddiffchunk
msgid "Chunk"
msgstr "Последовательность"
#: lazarusidestrconsts.dlgfolddiffchunksect
msgid "Chunk section"
msgstr "Секция последовательности"
#: lazarusidestrconsts.dlgfoldhtmlasp
msgid "ASP"
msgstr "ASP"
#: lazarusidestrconsts.dlgfoldhtmlcomment
msgctxt "lazarusidestrconsts.dlgfoldhtmlcomment"
msgid "Comment"
msgstr "Комментарий"
#: lazarusidestrconsts.dlgfoldhtmlnode
msgctxt "lazarusidestrconsts.dlgfoldhtmlnode"
msgid "Node"
msgstr "Элемент"
#: lazarusidestrconsts.dlgfoldlfmitem
msgid "Item"
msgstr "Элемент"
#: lazarusidestrconsts.dlgfoldlfmlist
msgid "List <>"
msgstr "Список <>"
#: lazarusidestrconsts.dlgfoldlfmobject
msgid "Object (inherited, inline)"
msgstr "Объект (унаследованный, вложенный)"
#: lazarusidestrconsts.dlgfoldlocalpasvartype
msgctxt "lazarusidestrconsts.dlgfoldlocalpasvartype"
msgid "Var/Type (local)"
msgstr "Секции Var/Type (локальные)"
#: lazarusidestrconsts.dlgfoldpasanonprocedure
msgid "Anonymous Procedure"
msgstr "Анонимная процедура"
#: lazarusidestrconsts.dlgfoldpasansicomment
msgid "Comment (* *)"
msgstr "Комментарий (* *)"
#: lazarusidestrconsts.dlgfoldpasasm
msgid "Asm"
msgstr "Секция Asm"
#: lazarusidestrconsts.dlgfoldpasbeginend
msgid "Begin/End (nested)"
msgstr "Begin/End (вложенная)"
#: lazarusidestrconsts.dlgfoldpasborcomment
msgid "Comment { }"
msgstr "Комментарий { }"
#: lazarusidestrconsts.dlgfoldpascase
msgid "Case"
msgstr "Case"
#: lazarusidestrconsts.dlgfoldpasclass
msgid "Class/Object"
msgstr "Класс/объект"
#: lazarusidestrconsts.dlgfoldpasclasssection
msgid "public/private"
msgstr "Секции public/private"
#: lazarusidestrconsts.dlgfoldpasexcept
msgid "Except/Finally"
msgstr "Except/Finally"
#: lazarusidestrconsts.dlgfoldpasfordo
msgid "For/Do"
msgstr "For/Do"
#: lazarusidestrconsts.dlgfoldpasifdef
msgid "{$IfDef}"
msgstr "{$IfDef}"
#: lazarusidestrconsts.dlgfoldpasifthen
msgid "If/Then/Else"
msgstr "If/Then/Else"
#: lazarusidestrconsts.dlgfoldpasnestedcomment
msgid "Nested Comment"
msgstr "Вложенный комментарий"
#: lazarusidestrconsts.dlgfoldpasprocbeginend
msgid "Begin/End (procedure)"
msgstr "Begin/End (процедура)"
#: lazarusidestrconsts.dlgfoldpasprocedure
msgctxt "lazarusidestrconsts.dlgfoldpasprocedure"
msgid "Procedure"
msgstr "Процедура"
#: lazarusidestrconsts.dlgfoldpasprogram
msgctxt "lazarusidestrconsts.dlgfoldpasprogram"
msgid "Program"
msgstr "Программа"
#: lazarusidestrconsts.dlgfoldpasrecord
msgctxt "lazarusidestrconsts.dlgfoldpasrecord"
msgid "Record"
msgstr "Запись"
#: lazarusidestrconsts.dlgfoldpasrecordcase
msgid "Record case"
msgstr "Case внутри записи"
#: lazarusidestrconsts.dlgfoldpasrecordcasesect
msgid "Record case section"
msgstr "Секция Case внутри записи"
#: lazarusidestrconsts.dlgfoldpasrepeat
msgctxt "lazarusidestrconsts.dlgfoldpasrepeat"
msgid "Repeat"
msgstr "Repeat"
#: lazarusidestrconsts.dlgfoldpasslashcomment
msgid "Comment //"
msgstr "Комментарий //"
#: lazarusidestrconsts.dlgfoldpastry
msgid "Try"
msgstr "Try"
#: lazarusidestrconsts.dlgfoldpasunit
msgctxt "lazarusidestrconsts.dlgfoldpasunit"
msgid "Unit"
msgstr "Модуль"
#: lazarusidestrconsts.dlgfoldpasunitsection
msgid "Unit section"
msgstr "Секция модуля"
#: lazarusidestrconsts.dlgfoldpasuserregion
msgid "{%Region}"
msgstr "{%Region}"
#: lazarusidestrconsts.dlgfoldpasuses
msgctxt "lazarusidestrconsts.dlgfoldpasuses"
msgid "Uses"
msgstr "Используемые модули"
#: lazarusidestrconsts.dlgfoldpasvartype
msgid "Var/Type (global)"
msgstr "Секции Var/Type (глобальные)"
#: lazarusidestrconsts.dlgfoldpaswhiledo
msgid "While/Do"
msgstr "While/Do"
#: lazarusidestrconsts.dlgfoldpaswithdo
msgid "With/Do"
msgstr "With/Do"
#: lazarusidestrconsts.dlgfoldxmlcdata
msgid "CData"
msgstr "Секция CDATA"
#: lazarusidestrconsts.dlgfoldxmlcomment
msgctxt "lazarusidestrconsts.dlgfoldxmlcomment"
msgid "Comment"
msgstr "Комментарий"
#: lazarusidestrconsts.dlgfoldxmldoctype
msgid "DocType"
msgstr "Секция DOCTYPE"
#: lazarusidestrconsts.dlgfoldxmlnode
msgctxt "lazarusidestrconsts.dlgfoldxmlnode"
msgid "Node"
msgstr "Элемент"
#: lazarusidestrconsts.dlgfoldxmlprocess
msgid "Processing Instruction"
msgstr "Команда обработки"
#: lazarusidestrconsts.dlgforcedpiscalingindesigntime
msgid "Force DPI scaling in design-time"
msgstr "Всегда масштабировать DPI времени разработки"
#: lazarusidestrconsts.dlgforcedpiscalingindesigntimehint
msgid "When checked the project scaling settings will be ignored - only the form/frame/datamodule Scaled property will be taken into account."
msgstr "Если включено, параметры масштабирования для проекта не будут учитываться. Во внимание будут приниматься только свойства Scaled форм/фреймов/модулей данных."
#: lazarusidestrconsts.dlgforceuniqueinstancemodalerror
msgid "The running Lazarus instance cannot accept any files."
msgstr "Запущенный экземпляр Lazarus не может принять файлы."
#: lazarusidestrconsts.dlgforecolor
msgid "Foreground"
msgstr "Цвет текста"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspector
msgid "Change Object Inspector contents on clicking form title bar"
msgstr "Изменять содержимое инспектора объектов при щелчке по заголовку формы"
#: lazarusidestrconsts.dlgformtitlebarchangesobjectinspectorhint
msgid "Show a form's properties in Object Inspector by clicking on its title bar."
msgstr "Показывать свойства формы в инспекторе объектов при щелчке по её заголовку"
#: lazarusidestrconsts.dlgforwardprocsinsertpolicy
msgid "Procedure insert policy"
msgstr "Политика вставки процедур"
#: lazarusidestrconsts.dlgforwardprocskeeporder
msgid "Keep order of procedures"
msgstr "Сохранять порядок процедур"
#: lazarusidestrconsts.dlgfpcexecutable
#, object-pascal-format
msgid "Compiler executable (e.g. %s)"
msgstr "Исполнимый файл компилятора (например, %s)"
#: lazarusidestrconsts.dlgfpcsrcpath
msgid "FPC source directory"
msgstr "Каталог исходного кода FPC"
#: lazarusidestrconsts.dlgfppkgconfigurationfile
msgid "Fppkg configuration file (e.g. fppkg.cfg)"
msgstr "Файл настройки Fppkg (например, fppkg.cfg)"
#: lazarusidestrconsts.dlgframecolor
msgid "Text-mark"
msgstr "Рамка"
#: lazarusidestrconsts.dlgfrmeditor
msgid "Form Editor"
msgstr "Редактор форм"
#: lazarusidestrconsts.dlgfrombeginning
msgid "From b&eginning"
msgstr "С на&чала"
#: lazarusidestrconsts.dlgfromcursor
msgid "From c&ursor"
msgstr "От &курсора"
#: lazarusidestrconsts.dlgglobal
msgid "&Global"
msgstr "Во всём т&ексте"
#: lazarusidestrconsts.dlggprof
msgid "Generate code for gprof"
msgstr "Генерировать код для gprof"
#: lazarusidestrconsts.dlggrabbercolor
msgid "Grabber color"
msgstr "Узел захвата"
#: lazarusidestrconsts.dlggrayeddesktopsdocked
msgid "Grayed desktops are for docked environment."
msgstr "Серым отмечены рабочие столы для стыкуемого окружения."
#: lazarusidestrconsts.dlggrayeddesktopsundocked
msgid "Grayed desktops are for undocked environment."
msgstr "Серым отмечены рабочие столы для нестыкуемого окружения."
#: lazarusidestrconsts.dlggridcolor
msgid "Grid color"
msgstr "Сетка"
#: lazarusidestrconsts.dlggridconsistsofsmalldots
msgid "Grid consists of small dots which help aligning controls."
msgstr "Сетка состоит из точек, помогающих выравнивать компоненты"
#: lazarusidestrconsts.dlggridx
msgid "Grid size X"
msgstr "Размер X сетки"
#: lazarusidestrconsts.dlggridxhint
msgid "Horizontal grid step size"
msgstr "Шаг сетки по горизонтали"
#: lazarusidestrconsts.dlggridy
msgid "Grid size Y"
msgstr "Размер Y сетки"
#: lazarusidestrconsts.dlggridyhint
msgid "Vertical grid step size"
msgstr "Шаг сетки по вертикали"
#: lazarusidestrconsts.dlggroupcodeexplorer
msgctxt "lazarusidestrconsts.dlggroupcodeexplorer"
msgid "Code Explorer"
msgstr "Обозреватель кода"
#: lazarusidestrconsts.dlggroupcodetools
msgid "Codetools"
msgstr "CodeTools"
#: lazarusidestrconsts.dlggroupdebugger
msgctxt "lazarusidestrconsts.dlggroupdebugger"
msgid "Debugger"
msgstr "Отладчик"
#: lazarusidestrconsts.dlggroupeditor
msgid "Editor"
msgstr "Редактор"
#: lazarusidestrconsts.dlggroupenvironment
msgctxt "lazarusidestrconsts.dlggroupenvironment"
msgid "Environment"
msgstr "Окружение"
#: lazarusidestrconsts.dlggroupundo
msgid "Group Undo"
msgstr "Групповая отмена"
#: lazarusidestrconsts.dlgguidelines
msgid "Show Guide Lines"
msgstr "Показывать линии позиционирования"
#: lazarusidestrconsts.dlgguidelineshint
msgid "When a control is aligned horizontally or vertically with another controls, a blue guide line is shown."
msgstr "Когда компонент выровнен по горизонтали либо по вертикали с остальными, отображается линия позиционирования"
#: lazarusidestrconsts.dlggutter
msgctxt "lazarusidestrconsts.dlggutter"
msgid "Gutter"
msgstr "Боковое поле"
#: lazarusidestrconsts.dlgguttercollapsedcolor
msgid "Collapsed"
msgstr "Свёрнутый"
#: lazarusidestrconsts.dlgguttercolor
msgid "Gutter Color"
msgstr "Цвет бокового поля"
#: lazarusidestrconsts.dlgguttercurrentlinenumber
msgid "Current Line (number)"
msgstr "Текущая строка (номер)"
#: lazarusidestrconsts.dlgguttercurrentlineother
msgid "Current Line (other)"
msgstr "Текущая строка (прочее)"
#: lazarusidestrconsts.dlggutteredgecolor
msgid "Gutter Edge Color"
msgstr "Цвет границы бокового поля"
#: lazarusidestrconsts.dlggutterseparatorindex
msgid "Gutter separator index"
msgstr "Положение отделителя бокового поля"
#: lazarusidestrconsts.dlghalfpagescroll
msgid "Half page scroll"
msgstr "Прокрутка на половину страницы"
#: lazarusidestrconsts.dlgheapandstacksize
msgid "Heap and stack sizes"
msgstr "Размеры кучи и стека"
#: lazarusidestrconsts.dlgheapsize
msgid "Heap size"
msgstr "Размер кучи"
#: lazarusidestrconsts.dlgheightofonepropertyingrid
msgid "Height of one property in the grid."
msgstr "Высота строки в инспекторе объектов"
#: lazarusidestrconsts.dlgheightpos
msgid "Height:"
msgstr "Высота:"
#: lazarusidestrconsts.dlghideideonrun
msgid "Hide IDE windows on Run/Debug"
msgstr "Скрывать окна IDE при запуске/отладке"
#: lazarusidestrconsts.dlghideideonrunhint
msgid "Do not show the IDE at all while program is running."
msgstr "Не показывать IDE во время исполнения программы"
#: lazarusidestrconsts.dlghidesingletabinnotebook
msgid "Hide tab in single page windows"
msgstr "Скрывать заголовок одиночной вкладки"
#: lazarusidestrconsts.dlghighlightcolor
msgid "Highlight Color"
msgstr "Выделение"
#: lazarusidestrconsts.dlghighlightfontcolor
msgid "Highlight Font Color"
msgstr "Шрифт выделенного"
#: lazarusidestrconsts.dlghighlightleftofcursor
msgid "Left Of Caret"
msgstr "Слева от курсора"
#: lazarusidestrconsts.dlghighlightrightofcursor
msgid "Right Of Caret"
msgstr "Справа от курсора"
#: lazarusidestrconsts.dlghintsparametersendernotused
msgid "Show hints for parameter \"Sender\" not used"
msgstr "Подсказки 'Parameter \"Sender\" not used'"
#: lazarusidestrconsts.dlghintsunused
msgid "Show hints for unused units in main"
msgstr "Подсказки о неиспользуемых модулях"
#: lazarusidestrconsts.dlghomekeyjumpstoneareststart
msgid "Home key jumps to nearest start"
msgstr "Home переводит к началу текста в строке"
#: lazarusidestrconsts.dlghostapplication
msgid "Host application"
msgstr "Главное приложение"
#: lazarusidestrconsts.dlgidentifiercompletion
msgctxt "lazarusidestrconsts.dlgidentifiercompletion"
msgid "Identifier Completion"
msgstr "Завершение идентификаторов"
#: lazarusidestrconsts.dlgidentifierpolicy
msgid "Identifier policy"
msgstr "Политика идентификаторов"
#: lazarusidestrconsts.dlgideoptions
msgid "IDE Options"
msgstr "Параметры IDE"
#: lazarusidestrconsts.dlgifdefblockactive
msgid "Active $IFDEF code"
msgstr "Активный код внутри $IFDEF"
#: lazarusidestrconsts.dlgifdefblockinactive
msgid "Inactive $IFDEF code"
msgstr "Неактивный код внутри $IFDEF"
#: lazarusidestrconsts.dlgifdefblocktmpactive
msgid "Included mixed state $IFDEF code"
msgstr "Подключаемый внутри $IFDEF условно активный код"
#: lazarusidestrconsts.dlgifdefnodeactive
msgid "Active $IFDEF node"
msgstr "Активная директива $IFDEF"
#: lazarusidestrconsts.dlgifdefnodeinactive
msgid "Inactive $IFDEF node"
msgstr "Неактивная директива $IFDEF"
#: lazarusidestrconsts.dlgifdefnodetmpactive
msgid "Included mixed state $IFDEF node"
msgstr "Директива $IFDEF подключаемого условно активного кода"
#: lazarusidestrconsts.dlgimportdesktopexists
msgid ""
"A desktop with the same name already exists.\n"
"Please confirm the desktop name:"
msgstr ""
"Рабочий стол с таким именем уже имеется.\n"
"Подтвердите это имя:"
#: lazarusidestrconsts.dlgincludecodetemplatestoidentcompl
msgid "Include code templates"
msgstr "Добавлять шаблоны кода"
#: lazarusidestrconsts.dlgincludeidentifierscontainingprefix
msgid "Include identifiers containing prefix"
msgstr "Добавлять идентификаторы, содержащие префикс"
#: lazarusidestrconsts.dlgincludekeywordstoidentcompl
msgid "Include all keywords and operators"
msgstr "Добавлять все ключевые слова и операторы"
#: lazarusidestrconsts.dlgincludesystemvariables
msgid "Include system variables"
msgstr "Включить системные переменные"
#: lazarusidestrconsts.dlgincludewordstoidentcompl
msgid "Include words"
msgstr "Добавлять слова"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_dontinclude
msgid "don't include"
msgstr "не добавлять"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromallunits
msgid "from all units"
msgstr "из всех модулей"
#: lazarusidestrconsts.dlgincludewordstoidentcompl_includefromcurrentunit
msgid "from current unit"
msgstr "из текущего модуля"
#: lazarusidestrconsts.dlgindentsindentgroupoptions
msgid "Indent"
msgstr "Отступ"
#: lazarusidestrconsts.dlgindentstabsgroupoptions
msgid "Tabs"
msgstr "Табуляция"
#: lazarusidestrconsts.dlginfrontofmethods
msgid "In front of methods"
msgstr "Перед методами"
#: lazarusidestrconsts.dlginitdoneonly
msgid "Constructor name must be 'init' (destructor must be 'done')"
msgstr "Конструктор должен называться 'init' (деструктор - 'done')"
#: lazarusidestrconsts.dlginsertclassparts
msgid "Insert class parts"
msgstr "Вставлять элементы класса"
#: lazarusidestrconsts.dlginsertimplementation
msgid "Implementation"
msgstr "Implementation"
#: lazarusidestrconsts.dlginsertinterface
msgid "Interface"
msgstr "Interface"
#: lazarusidestrconsts.dlginsertmethods
msgid "Insert method implementations"
msgstr "Вставлять реализации методов"
#: lazarusidestrconsts.dlginsertsection
msgid "Insert into Uses section of"
msgstr "Вставить в выражение Uses секции"
#: lazarusidestrconsts.dlginsspaceafter
msgid "Insert space after"
msgstr "Вставлять пробелы после"
#: lazarusidestrconsts.dlginsspacefront
msgid "Insert space in front of"
msgstr "Вставлять пробелы перед"
#: lazarusidestrconsts.dlgintvinsec
msgid "Interval in secs"
msgstr "Интервал в сек"
#: lazarusidestrconsts.dlgjumpcodeblockpos
msgid "Vertical position for a code block jump in % (0=top, 100=bottom)"
msgstr "Вертикальное положение при переходе к блоку кода в процентах (0=вверху, 100=внизу)"
#: lazarusidestrconsts.dlgjumpingetc
msgid "Jumping (e.g. Method Jumping)"
msgstr "Переход (например, по методу)"
#: lazarusidestrconsts.dlgjumpsinglelinepos
msgid "Vertical position for a single line jump in % (0=top, 100=bottom)"
msgstr "Вертикальное положение при переходе к строке в процентах (0=вверху, 100=внизу)"
#: lazarusidestrconsts.dlgjumptomethodbody
msgid "Jump directly to method body"
msgstr "Переходить непосредственно к телу метода"
#: lazarusidestrconsts.dlgkeepcursorx
msgid "Keep caret X position when navigating up/down"
msgstr "Сохранять позицию курсора по оси X при перемещении вверх/вниз"
#: lazarusidestrconsts.dlgkeylink
msgid "(Edit Key)"
msgstr "(Изменить клавиши)"
#: lazarusidestrconsts.dlgkeymapping
msgid "Key Mappings"
msgstr "Комбинации клавиш"
#: lazarusidestrconsts.dlgkeymappingerrors
msgid "Key mapping errors"
msgstr "Ошибки комбинаций клавиш"
#: lazarusidestrconsts.dlgkeywordpolicy
msgid "Keyword policy"
msgstr "Политика ключевых слов"
#: lazarusidestrconsts.dlglabelgoto
msgid "Allow LABEL and GOTO"
msgstr "Разрешить LABEL и GOTO"
#: lazarusidestrconsts.dlglang
msgctxt "lazarusidestrconsts.dlglang"
msgid "Language"
msgstr "Язык"
#: lazarusidestrconsts.dlglast
msgid "Last (i.e. at end of source)"
msgstr "Последними (т.е. в конце исходного кода)"
#: lazarusidestrconsts.dlglazarusdir
msgid "Lazarus directory (default for all projects)"
msgstr "Каталог Lazarus (общий для всех проектов)"
#: lazarusidestrconsts.dlglazarusinstances
msgid "Lazarus instances"
msgstr "Экземпляры Lazarus"
#: lazarusidestrconsts.dlglefttopclr
msgid "Guide lines Left,Top"
msgstr "Левая и верхняя линии позиционирования"
#: lazarusidestrconsts.dlglevel1opt
msgid "1 (quick, debugger friendly with small limitations)"
msgstr "1 (быстро и, с небольшими ограничениями, дружественно к отладчику)"
#: lazarusidestrconsts.dlglevel2opt
msgid "2 (-O1 + quick optimizations)"
msgstr "2 (-O1 + быстрые оптимизации)"
#: lazarusidestrconsts.dlglevel3opt
msgid "3 (-O2 + slow optimizations)"
msgstr "3 (-O2 + медленные оптимизации)"
#: lazarusidestrconsts.dlglevel4opt
msgid "4 (-O3 + aggressive optimizations, beware)"
msgstr "4 (-O3 + агрессивные оптимизации, будьте осторожны)"
#: lazarusidestrconsts.dlglevelnoneopt
msgid "0 (no optimization, for debugging)"
msgstr "0 (без оптимизации, для отладки)"
#: lazarusidestrconsts.dlglinesplitting
msgid "Line Splitting"
msgstr "Разрыв строк"
#: lazarusidestrconsts.dlglinksmart
msgid "Link smart"
msgstr "Умная компоновка"
#: lazarusidestrconsts.dlglnumsbct
msgid "Display line numbers in run-time error backtraces"
msgstr "Выдавать номера строк в ошибках времени исполнения"
#: lazarusidestrconsts.dlgmainviewforms
msgid "View Project Forms"
msgstr "Показать формы проекта"
#: lazarusidestrconsts.dlgmainviewframes
msgid "View Project Frames"
msgstr "Показать фреймы проекта"
#: lazarusidestrconsts.dlgmainviewunits
msgctxt "lazarusidestrconsts.dlgmainviewunits"
msgid "View Project Units"
msgstr "Показать модули проекта"
#: lazarusidestrconsts.dlgmakeexecutable
msgid "\"Make\" executable"
msgstr "Исполнимый файл \"Make\""
#: lazarusidestrconsts.dlgmanagedesktops
msgid "Manage desktops"
msgstr "Управление рабочими столами"
#: lazarusidestrconsts.dlgmargingutter
msgid "Margin and gutter"
msgstr "Границы"
#: lazarusidestrconsts.dlgmarkercolor
msgid "Marker color"
msgstr "Маркер"
#: lazarusidestrconsts.dlgmarkupcurrentworddelayinsec
#, object-pascal-format
msgid "(%s sec delay after caret move)"
msgstr "(задержка в %s сек. после перемещения курсора)"
#: lazarusidestrconsts.dlgmarkupfoldcolor
msgid "Vertical-mark"
msgstr "Вертикальная черта"
#: lazarusidestrconsts.dlgmarkupgroup
msgid "Highlight all occurrences of Word under Caret"
msgstr "Подсветка всех экземпляров слова под курсором"
#: lazarusidestrconsts.dlgmarkupoutline
msgid "Outline (global)"
msgstr "Отображать контур блока (глобально)"
#: lazarusidestrconsts.dlgmarkupoutlinewarnnocolor
msgid "Warning: There are no colors configured for the selected language"
msgstr "Предупреждение: цвета для выбранного языка не настроены"
#: lazarusidestrconsts.dlgmarkupuserdefined
msgctxt "lazarusidestrconsts.dlgmarkupuserdefined"
msgid "User defined markup"
msgstr "Пользовательская разметка"
#: lazarusidestrconsts.dlgmarkupuserdefineddelcaption
msgctxt "lazarusidestrconsts.dlgmarkupuserdefineddelcaption"
msgid "Delete"
msgstr "Удалить"
#: lazarusidestrconsts.dlgmarkupuserdefineddelprompt
#, object-pascal-format
msgid "Delete list \"%s\"?"
msgstr "Удалить список \"%s\"?"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyadd
msgid "Add Word or Term by key"
msgstr "Добавление слова или терма клавишами"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeyremove
msgid "Remove Word or Term by key"
msgstr "Удаление слова или терма клавишами"
#: lazarusidestrconsts.dlgmarkupuserdefineddivkeytoggle
msgid "Toggle Word or Term by key"
msgstr "Переключение слова или терма клавишами"
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicate
msgid "Duplicate Term"
msgstr "Дублирующийся терм"
#: lazarusidestrconsts.dlgmarkupuserdefinedduplicatemsg
#, object-pascal-format
msgid "The term %s already exists. Duplicates will be removed when the list is saved."
msgstr "Терм %s уже существует. Дубликаты будут удалены при сохранении списка."
#: lazarusidestrconsts.dlgmarkupuserdefinedgloballist
msgid "Add/Remove in all editors"
msgstr "Добавлять/удалять во всех редакторах"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistdel
msgid "Delete list"
msgstr "Удалить список"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistname
msgctxt "lazarusidestrconsts.dlgmarkupuserdefinedlistname"
msgid "Name"
msgstr "Имя"
#: lazarusidestrconsts.dlgmarkupuserdefinedlistnew
msgid "Add list"
msgstr "Добавить список"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchcase
msgid "Case sensitive"
msgstr "Учитывать регистр"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchendbound
msgid "Set bound at term end"
msgstr "Установить границу в конце терма"
#: lazarusidestrconsts.dlgmarkupuserdefinedmatchstartbound
msgid "Set bound at term start"
msgstr "Установить границу в начале терма"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylen
msgid "Ignore bounds for terms longer than"
msgstr "Игнорировать границы термов длиннее, чем"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenselect
msgid "selection"
msgstr "выделение"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeylenword
msgid "current word"
msgstr "текущее слово"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeyopts
msgid "Settings for terms added by key"
msgstr "Параметры термов, добавленных клавишами"
#: lazarusidestrconsts.dlgmarkupuserdefinednewbykeysmartselect
msgid "Smart match selection bounds"
msgstr "Умное назначение границ"
#: lazarusidestrconsts.dlgmarkupuserdefinednewname
msgid "New list"
msgstr "Новый список"
#: lazarusidestrconsts.dlgmarkupuserdefinednolists
msgid "No lists"
msgstr "Нет списков"
#: lazarusidestrconsts.dlgmarkupuserdefinednolistssel
msgid "Select ..."
msgstr "Выбрать ..."
#: lazarusidestrconsts.dlgmarkupuserdefinedpagekeys
msgid "Key mappings"
msgstr "Комбинации клавиш"
#: lazarusidestrconsts.dlgmarkupuserdefinedpagemain
msgid "Main settings"
msgstr "Основные параметры"
#: lazarusidestrconsts.dlgmarkupwordbracket
msgid "Keyword brackets on caret (global)"
msgstr "Подсвечивать операторные скобки при установке курсора (глобально)"
#: lazarusidestrconsts.dlgmarkupwordfulllen
msgid "Match whole words, if length is less or equal to:"
msgstr "Подсвечивать слова полностью при длине не более:"
#: lazarusidestrconsts.dlgmarkupwordkeycombo
#, object-pascal-format
msgid "Markup current word by key: %s"
msgstr "Подсвечивать текущее слово комбинацией клавиш: %s"
#: lazarusidestrconsts.dlgmarkupwordnokeyword
msgid "Ignore keywords"
msgstr "Игнорировать зарезервированные слова"
#: lazarusidestrconsts.dlgmarkupwordoncaretmove
msgid "Automatically markup current word on caret move"
msgstr "Автоматически подсвечивать текущее слово при перемещении курсора"
#: lazarusidestrconsts.dlgmarkupwordtrim
msgid "Trim spaces (when highlighting current selection)"
msgstr "Обрезать пробелы (при подсветке текущего выделения)"
#: lazarusidestrconsts.dlgmaxcntr
msgid "Maximum counter"
msgstr "Максимум счетчика"
#: lazarusidestrconsts.dlgmaxlinelength
msgid "Max line length:"
msgstr "max длина строки:"
#: lazarusidestrconsts.dlgmaxrecentfiles
msgid "Max recent files"
msgstr "Максимальное количество недавних файлов"
#: lazarusidestrconsts.dlgmaxrecenthint
msgid "Value 0 means unlimited."
msgstr "Значение \"0\" соответствует неограниченному количеству."
#: lazarusidestrconsts.dlgmaxrecentprojs
msgid "Max recent project files"
msgstr "Максимальное количество недавних проектов"
#: lazarusidestrconsts.dlgmiddletabcloseotherpagesmod
msgid "Middle-click-modifier to close all other tabs"
msgstr "Закрывать прочие вкладки средней кнопкой мыши при нажатии"
#: lazarusidestrconsts.dlgmiddletabcloserightpagesmod
msgid "Middle-click-modifier to close tabs on the right"
msgstr "Закрывать вкладки справа средней кнопкой мыши при нажатии"
#: lazarusidestrconsts.dlgmixmethodsandproperties
msgid "Mix methods and properties"
msgstr "Смешивать методы и свойства"
#: lazarusidestrconsts.dlgmode
msgid "Mode"
msgstr "Режим"
#: lazarusidestrconsts.dlgmouseaction
msgid "Mouse Action"
msgstr "Реакция на действия мышью"
#: lazarusidestrconsts.dlgmouseoptbtn1
msgctxt "lazarusidestrconsts.dlgmouseoptbtn1"
msgid "Single"
msgstr "Одинарный"
#: lazarusidestrconsts.dlgmouseoptbtn2
msgctxt "lazarusidestrconsts.dlgmouseoptbtn2"
msgid "Double"
msgstr "Двойной"
#: lazarusidestrconsts.dlgmouseoptbtn3
msgctxt "lazarusidestrconsts.dlgmouseoptbtn3"
msgid "Triple"
msgstr "Тройной"
#: lazarusidestrconsts.dlgmouseoptbtn4
msgctxt "lazarusidestrconsts.dlgmouseoptbtn4"
msgid "Quad"
msgstr "Четверной"
#: lazarusidestrconsts.dlgmouseoptbtnany
msgid "Any"
msgstr "Любой"
#: lazarusidestrconsts.dlgmouseoptbtnextra1
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra1"
msgid "Extra 1"
msgstr "Дополнительная 1"
#: lazarusidestrconsts.dlgmouseoptbtnextra2
msgctxt "lazarusidestrconsts.dlgmouseoptbtnextra2"
msgid "Extra 2"
msgstr "Дополнительная 2"
#: lazarusidestrconsts.dlgmouseoptbtnleft
msgctxt "lazarusidestrconsts.dlgmouseoptbtnleft"
msgid "Left"
msgstr "Левая"
#: lazarusidestrconsts.dlgmouseoptbtnmiddle
msgctxt "lazarusidestrconsts.dlgmouseoptbtnmiddle"
msgid "Middle"
msgstr "Средняя"
#: lazarusidestrconsts.dlgmouseoptbtnmoddef
msgid "Make Fallback"
msgstr "Сброс"
#: lazarusidestrconsts.dlgmouseoptbtnright
msgctxt "lazarusidestrconsts.dlgmouseoptbtnright"
msgid "Right"
msgstr "Правая"
#: lazarusidestrconsts.dlgmouseoptbtnwheeldown
msgid "Wheel down"
msgstr "Колёсико назад"
#: lazarusidestrconsts.dlgmouseoptbtnwheelleft
msgid "Wheel left"
msgstr "Колёсико налево"
#: lazarusidestrconsts.dlgmouseoptbtnwheelright
msgid "Wheel right"
msgstr "Колёсико направо"
#: lazarusidestrconsts.dlgmouseoptbtnwheelup
msgid "Wheel up"
msgstr "Колёсико вперёд"
#: lazarusidestrconsts.dlgmouseoptcapture
msgid "Capture"
msgstr "Область захвата"
#: lazarusidestrconsts.dlgmouseoptcaretmove
msgid "Move Caret (extra)"
msgstr "Перемещать курсор (дополнительно)"
#: lazarusidestrconsts.dlgmouseoptcheckupdown
msgid "Act on Mouse up"
msgstr "При отпускании"
#: lazarusidestrconsts.dlgmouseoptdescaction
msgctxt "lazarusidestrconsts.dlgmouseoptdescaction"
msgid "Action"
msgstr "Действие"
#: lazarusidestrconsts.dlgmouseoptdescbutton
msgctxt "lazarusidestrconsts.dlgmouseoptdescbutton"
msgid "Click"
msgstr "Щелчок"
#: lazarusidestrconsts.dlgmouseoptdlgtitle
msgid "Edit Mouse"
msgstr "Редактор действия"
#: lazarusidestrconsts.dlgmouseopterrordup
msgid "Duplicate Entry"
msgstr "Дублирующийся элемент"
#: lazarusidestrconsts.dlgmouseopterrorduptext
msgid "This entry conflicts with an existing entry"
msgstr "Этот элемент противоречит уже существующему"
#: lazarusidestrconsts.dlgmouseoptheadalt
msgctxt "lazarusidestrconsts.dlgmouseoptheadalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptheadbtn
msgctxt "lazarusidestrconsts.dlgmouseoptheadbtn"
msgid "Button"
msgstr "Кнопка"
#: lazarusidestrconsts.dlgmouseoptheadcaret
msgctxt "lazarusidestrconsts.dlgmouseoptheadcaret"
msgid "Caret"
msgstr "Курсор"
#: lazarusidestrconsts.dlgmouseoptheadcontext
msgid "Context"
msgstr "Контекст"
#: lazarusidestrconsts.dlgmouseoptheadcount
msgctxt "lazarusidestrconsts.dlgmouseoptheadcount"
msgid "Click"
msgstr "Щелчок"
#: lazarusidestrconsts.dlgmouseoptheadctrl
msgctxt "lazarusidestrconsts.dlgmouseoptheadctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptheaddesc
msgctxt "lazarusidestrconsts.dlgmouseoptheaddesc"
msgid "Action"
msgstr "Действие"
#: lazarusidestrconsts.dlgmouseoptheaddir
msgid "Up/Down"
msgstr "Фаза щелчка"
#: lazarusidestrconsts.dlgmouseoptheadopt
msgid "Option"
msgstr "Параметр"
#: lazarusidestrconsts.dlgmouseoptheadorder
msgctxt "lazarusidestrconsts.dlgmouseoptheadorder"
msgid "Order"
msgstr "Порядок"
#: lazarusidestrconsts.dlgmouseoptheadpriority
msgctxt "lazarusidestrconsts.dlgmouseoptheadpriority"
msgid "Priority"
msgstr "Приоритет"
#: lazarusidestrconsts.dlgmouseoptheadshift
msgctxt "lazarusidestrconsts.dlgmouseoptheadshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptions
msgctxt "lazarusidestrconsts.dlgmouseoptions"
msgid "Mouse"
msgstr "Мышь"
#: lazarusidestrconsts.dlgmouseoptionsadv
msgid "Advanced"
msgstr "Расширенные"
#: lazarusidestrconsts.dlgmouseoptionsyncommand
msgid "IDE-Command"
msgstr "Команда IDE"
#: lazarusidestrconsts.dlgmouseoptmodalt
msgctxt "lazarusidestrconsts.dlgmouseoptmodalt"
msgid "Alt"
msgstr "Alt"
#: lazarusidestrconsts.dlgmouseoptmodctrl
msgctxt "lazarusidestrconsts.dlgmouseoptmodctrl"
msgid "Ctrl"
msgstr "Ctrl"
#: lazarusidestrconsts.dlgmouseoptmodkeyfalse
msgid "n"
msgstr "н"
#: lazarusidestrconsts.dlgmouseoptmodkeyignore
msgid "-"
msgstr "-"
#: lazarusidestrconsts.dlgmouseoptmodkeytrue
msgctxt "lazarusidestrconsts.dlgmouseoptmodkeytrue"
msgid "Y"
msgstr "Д"
#: lazarusidestrconsts.dlgmouseoptmodshift
msgctxt "lazarusidestrconsts.dlgmouseoptmodshift"
msgid "Shift"
msgstr "Shift"
#: lazarusidestrconsts.dlgmouseoptmovemousetrue
msgctxt "lazarusidestrconsts.dlgmouseoptmovemousetrue"
msgid "Y"
msgstr "Д"
#: lazarusidestrconsts.dlgmouseoptnodeall
msgctxt "lazarusidestrconsts.dlgmouseoptnodeall"
msgid "All"
msgstr "Все"
#: lazarusidestrconsts.dlgmouseoptnodegutter
msgctxt "lazarusidestrconsts.dlgmouseoptnodegutter"
msgid "Gutter"
msgstr "Боковое поле"
#: lazarusidestrconsts.dlgmouseoptnodegutterchanges
msgid "Line Changes"
msgstr "Маркеры изменений"
#: lazarusidestrconsts.dlgmouseoptnodegutterfold
msgid "Fold Tree"
msgstr "Дерево сворачиваний"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol
msgid "Collapsed [+]"
msgstr "Свёрнутые [+]"
#: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp
msgid "Expanded [-]"
msgstr "Развёрнутые [-]"
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverview
msgid "Overview"
msgstr "Поле обзора"
#: lazarusidestrconsts.dlgmouseoptnodegutterlineoverviewmarks
msgid "Overview Mark"
msgstr "Маркер в поле обзора"
#: lazarusidestrconsts.dlgmouseoptnodegutterlines
msgid "Line Numbers"
msgstr "Номера строк"
#: lazarusidestrconsts.dlgmouseoptnodemain
msgctxt "lazarusidestrconsts.dlgmouseoptnodemain"
msgid "Text"
msgstr "Текст"
#: lazarusidestrconsts.dlgmouseoptnodeselect
msgctxt "lazarusidestrconsts.dlgmouseoptnodeselect"
msgid "Selection"
msgstr "Выделение"
#: lazarusidestrconsts.dlgmouseoptopt2label
msgid "Opt"
msgstr "Параметр"
#: lazarusidestrconsts.dlgmouseoptotheract
msgid "Other actions using the same button"
msgstr "Другие действия по той же кнопке мыши"
#: lazarusidestrconsts.dlgmouseoptotheracthint
msgid "They may be executed depending on the Modifier Keys, Fallthrough settings, Single/Double, Up/Down ..."
msgstr "Эти действия могут быть выполнены в зависимости от нажатия клавиш-модификаторов и других установленных для них параметров"
#: lazarusidestrconsts.dlgmouseoptotheracttoggle
msgid "Filter Mod-Keys"
msgstr "Фильтровать по модификаторам"
#: lazarusidestrconsts.dlgmouseoptpriorlabel
msgctxt "lazarusidestrconsts.dlgmouseoptpriorlabel"
msgid "Priority"
msgstr "Приоритет"
#: lazarusidestrconsts.dlgmsgwincolorurgentdebug
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentdebug"
msgid "Debug"
msgstr "Отладочное"
#: lazarusidestrconsts.dlgmsgwincolorurgenterror
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenterror"
msgid "Error"
msgstr "Ошибка"
#: lazarusidestrconsts.dlgmsgwincolorurgentfatal
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentfatal"
msgid "Fatal"
msgstr "Фатальная ошибка"
#: lazarusidestrconsts.dlgmsgwincolorurgenthint
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgenthint"
msgid "Hint"
msgstr "Подсказка"
#: lazarusidestrconsts.dlgmsgwincolorurgentimportant
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentimportant"
msgid "Important"
msgstr "Важное"
#: lazarusidestrconsts.dlgmsgwincolorurgentnone
msgid "Normal"
msgstr "Обычное"
#: lazarusidestrconsts.dlgmsgwincolorurgentnote
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentnote"
msgid "Note"
msgstr "Заметка"
#: lazarusidestrconsts.dlgmsgwincolorurgentpanic
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentpanic"
msgid "Panic"
msgstr "Чрезвычайное"
#: lazarusidestrconsts.dlgmsgwincolorurgentprogress
msgid "Time and statistics"
msgstr "Время и статистика"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentverbose"
msgid "Verbose"
msgstr "Подробное"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose2
msgid "Verbose 2"
msgstr "Подробное 2"
#: lazarusidestrconsts.dlgmsgwincolorurgentverbose3
msgid "Verbose 3"
msgstr "Подробное 3"
#: lazarusidestrconsts.dlgmsgwincolorurgentwarning
msgctxt "lazarusidestrconsts.dlgmsgwincolorurgentwarning"
msgid "Warning"
msgstr "Предупреждение"
#: lazarusidestrconsts.dlgmulticaretcolumnmode
msgid "Navigation keys move all carets (column-select)"
msgstr "Перемещать все курсоры за основным при выделении столбца"
#: lazarusidestrconsts.dlgmulticaretdelskipcr
msgid "Skip delete key at EOL (do not join lines)"
msgstr "Не удалять конец строки клавишей Delete (не объединять строки)"
#: lazarusidestrconsts.dlgmulticaretgroupoptions
msgid "Multi-caret"
msgstr "Несколько курсоров"
#: lazarusidestrconsts.dlgmulticaretmode
msgid "Navigation keys move all carets"
msgstr "Перемещать все курсоры за основным"
#: lazarusidestrconsts.dlgmulticaretoncolumnselection
msgid "Enable multi-caret for column selection"
msgstr "Включить несколько курсоров при выделении столбца"
#: lazarusidestrconsts.dlgmultipleinstances_alwaysstartnew
msgid "always start a new instance"
msgstr "всегда запускать новый экземпляр"
#: lazarusidestrconsts.dlgmultipleinstances_forcesingleinstance
msgid "do not allow multiple instances"
msgstr "не разрешать несколько экземпляров"
#: lazarusidestrconsts.dlgmultipleinstances_openfilesinrunning
msgid "open files in a running instance"
msgstr "открывать файлы в запущенном экземпляре"
#: lazarusidestrconsts.dlgmultiselect
msgid "Multi Select"
msgstr "Множественное выделение"
#: lazarusidestrconsts.dlgmultiwinaccessgroup
msgid "Jump target priority between multiple editors"
msgstr "Приоритет перехода между редакторами"
#: lazarusidestrconsts.dlgmultiwinaccessorder
msgid "Order to use for editors matching the same criteria"
msgstr "Порядок использования редакторов, отвечающих одинаковым критериям"
#: lazarusidestrconsts.dlgmultiwinaccessorderedit
msgid "Most recent focused editor for this file"
msgstr "Последний выбранный редактор для данного файла"
#: lazarusidestrconsts.dlgmultiwinaccessorderwin
msgid "Editor (for file) in most recent focused window"
msgstr "Редактор (для файла) в последнем выбранном окне"
#: lazarusidestrconsts.dlgmultiwinaccesstype
msgid "Priority list of criteria to choose an editor:"
msgstr "Список критериев выбора редактора по приоритету:"
#: lazarusidestrconsts.dlgmultiwinoptions
msgid "Pages and Windows"
msgstr "Вкладки и окна"
#: lazarusidestrconsts.dlgmultiwintabgroup
msgid "Notebook Tabs"
msgstr "Вкладки редакторов"
#: lazarusidestrconsts.dlgnaming
msgid "Naming"
msgstr "Именование"
#: lazarusidestrconsts.dlgnewdesktop
msgid "New desktop ..."
msgstr "Новый рабочий стол ..."
#: lazarusidestrconsts.dlgnewprojecttype
msgid "New Project Type"
msgstr "Тип нового проекта"
#: lazarusidestrconsts.dlgnoautomaticrenaming
msgid "No automatic renaming"
msgstr "Не переименовывать автоматически"
#: lazarusidestrconsts.dlgnoavailableunits
msgid "No available units to add."
msgstr "Доступные для добавления модули отсутствуют."
#: lazarusidestrconsts.dlgnobrackethighlight
msgid "No Highlight"
msgstr "Не подсвечивать"
#: lazarusidestrconsts.dlgnonformbackgroundcolor
msgid "Other Designer background (e. g. TDataModule)"
msgstr "Фон прочих редакторов (например, TDataModule)"
#: lazarusidestrconsts.dlgnotebooktabpos
msgid "Source notebook tabs position"
msgstr "Положение заголовков вкладок редактора"
#: lazarusidestrconsts.dlgnotsplitlineafter
msgid "Do not split line after"
msgstr "Не разрывать строку после"
#: lazarusidestrconsts.dlgnotsplitlinefront
msgid "Do not split line in front of"
msgstr "Не разрывать строку перед"
#: lazarusidestrconsts.dlgnsprincipalclass
msgid "NSPrincipalClass"
msgstr "NSPrincipalClass"
#: lazarusidestrconsts.dlgobjinsp
msgctxt "lazarusidestrconsts.dlgobjinsp"
msgid "Object Inspector"
msgstr "Инспектор объектов"
#: lazarusidestrconsts.dlgoiitemheight
msgid "Item height (0 = auto)"
msgstr "Высота элемента (0 = выбрать автоматически)"
#: lazarusidestrconsts.dlgoimiscellaneous
msgctxt "lazarusidestrconsts.dlgoimiscellaneous"
msgid "Miscellaneous"
msgstr "Разное"
#: lazarusidestrconsts.dlgoispeedsettings
msgid "Speed settings"
msgstr "Быстрая настройка"
#: lazarusidestrconsts.dlgoiusedefaultdelphisettings
msgid "Use default Delphi settings"
msgstr "Использовать параметры по умолчанию Delphi"
#: lazarusidestrconsts.dlgoiusedefaultlazarussettings
msgid "Use default Lazarus settings"
msgstr "Использовать параметры по умолчанию Lazarus"
#: lazarusidestrconsts.dlgoptimizationlevels
msgid "Optimization levels"
msgstr "Уровни оптимизации"
#: lazarusidestrconsts.dlgotheroptimizations
msgid "Other optimizations"
msgstr "Прочие оптимизации"
#: lazarusidestrconsts.dlgotherunitfiles
msgid "Other unit files (-Fu):"
msgstr "Другие модули (-Fu):"
#: lazarusidestrconsts.dlgoverviewgutterback1color
msgid "Background 1"
msgstr "Фон 1"
#: lazarusidestrconsts.dlgoverviewgutterback2color
msgid "Background 2"
msgstr "Фон 2"
#: lazarusidestrconsts.dlgoverviewguttercolor
msgid "Overview Gutter"
msgstr "Поле обзора"
#: lazarusidestrconsts.dlgoverviewgutterpagecolor
msgctxt "lazarusidestrconsts.dlgoverviewgutterpagecolor"
msgid "Page"
msgstr "Страница"
#: lazarusidestrconsts.dlgoverwriteblock
msgid "Overwrite block"
msgstr "Заменять выделение"
#: lazarusidestrconsts.dlgoverwritedesktop
#, object-pascal-format
msgid ""
"Desktop with the name \"%s\" was found.\n"
"Should the old desktop be overwritten?"
msgstr ""
"Рабочий стол с именем \"%s\" уже имеется.\n"
"Перезаписать его?"
#: lazarusidestrconsts.dlgpalhints
msgid "Hints for component palette"
msgstr "Подсказки палитры компонентов"
#: lazarusidestrconsts.dlgpasext
msgid "Default Pascal extension"
msgstr "Стандартное расширение Паскаля"
#: lazarusidestrconsts.dlgpasextkeywords
msgid "Highlight control statements as keywords"
msgstr "Подсвечивать операторы управления как ключевые слова"
#: lazarusidestrconsts.dlgpasextkeywordsgroup
msgid "Extended Pascal Keyword Options"
msgstr "Расширенные параметры ключевых слов Паскаля"
#: lazarusidestrconsts.dlgpaskeywordsmarkup
msgid "Markup (on caret)"
msgstr "Подсвечивать при установке курсора"
#: lazarusidestrconsts.dlgpaskeywordsmatches
msgid "Matching Keywords"
msgstr "Связанные ключевые слова"
#: lazarusidestrconsts.dlgpaskeywordsoutline
msgid "Outline"
msgstr "Отображать контур"
#: lazarusidestrconsts.dlgpassoptslinker
msgid "Pass options to linker with \"-k\", delimiter is space"
msgstr "Передавать параметры компоновщику с префиксом \"-k\" (разделитель - пробел)"
#: lazarusidestrconsts.dlgpasstringkeywords
msgid "Highlight \"String\" keyword(s)"
msgstr "Подсветка ключевого слова String"
#: lazarusidestrconsts.dlgpasstringkeywordsoptdefault
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptdefault"
msgid "Default"
msgstr "По умолчанию"
#: lazarusidestrconsts.dlgpasstringkeywordsoptnone
msgctxt "lazarusidestrconsts.dlgpasstringkeywordsoptnone"
msgid "None"
msgstr "Нет"
#: lazarusidestrconsts.dlgpasstringkeywordsoptstring
msgid "Only \"String\""
msgstr "Только \"String\""
#: lazarusidestrconsts.dlgpersistentblock
msgid "Persistent block"
msgstr "Постоянное выделение"
#: lazarusidestrconsts.dlgpersistentcursor
msgid "Visible caret in unfocused editor"
msgstr "Показывать курсор в неактивном редакторе"
#: lazarusidestrconsts.dlgpersistentcursornoblink
msgid "Caret in unfocused editor does not blink"
msgstr "Не мигать курсором в неактивном редакторе"
#: lazarusidestrconsts.dlgpoansiutf8
msgid "ANSI codepage is UTF-8 (Windows 10 1903+)"
msgstr "Кодовая страница ANSI в режиме UTF-8 (Windows 10 1903+)"
#: lazarusidestrconsts.dlgpoapplication
msgid "Application"
msgstr "Приложение"
#: lazarusidestrconsts.dlgpoasinvoker
msgid "as invoker (asInvoker)"
msgstr "вызывающего процесса (asInvoker)"
#: lazarusidestrconsts.dlgpoclearicon
msgid "&Clear Icon"
msgstr "О&чистить значок"
#: lazarusidestrconsts.dlgpocreateappbundle
msgid "Create Application Bundle"
msgstr "Создать Application Bundle"
#: lazarusidestrconsts.dlgpodebugger
msgctxt "lazarusidestrconsts.dlgpodebugger"
msgid "Debugger"
msgstr "Отладчик"
#: lazarusidestrconsts.dlgpodefaulticon
msgid "Load &Default"
msgstr "Загрузить по &умолчанию"
#: lazarusidestrconsts.dlgpodpiawareness
msgid "DPI awareness"
msgstr "Поддержка DPI"
#: lazarusidestrconsts.dlgpodpiawarenessoff
msgid "off"
msgstr "выключена"
#: lazarusidestrconsts.dlgpodpiawarenessoldoffnewpermonitor
msgid "Vista-8: off, 8.1+: per monitor"
msgstr "Vista-8: выключена, 8.1+: отдельно для каждого монитора"
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitor
msgid "Vista-8: on, 8.1+: per monitor"
msgstr "Vista-8: включена, 8.1+: отдельно для каждого монитора"
#: lazarusidestrconsts.dlgpodpiawarenessoldonnewpermonitorv2
msgid "Vista-8: on, 8.1/10+: per monitor/V2"
msgstr "Vista-8: включена, 8.1/10+: отдельно для каждого монитора/V2"
#: lazarusidestrconsts.dlgpodpiawarenesson
msgid "on"
msgstr "включена"
#: lazarusidestrconsts.dlgpoexecutionlevel
msgid "Execution Level"
msgstr "Уровень исполнения"
#: lazarusidestrconsts.dlgpofroms
msgid "Forms"
msgstr "Формы"
#: lazarusidestrconsts.dlgpohighestavailable
msgid "highest available (highestAvailable)"
msgstr "наивысший доступный (highestAvailable)"
#: lazarusidestrconsts.dlgpoi18n
msgid "i18n"
msgstr "i18n"
#: lazarusidestrconsts.dlgpoicon
msgid "Icon:"
msgstr "Значок:"
#: lazarusidestrconsts.dlgpoicondesc
#, object-pascal-format
msgid "(size: %d:%d, bpp: %d)"
msgstr "(размер: %d:%d, бит/пиксель: %d)"
#: lazarusidestrconsts.dlgpoicondescnone
msgctxt "lazarusidestrconsts.dlgpoicondescnone"
msgid "(none)"
msgstr "(нет)"
#: lazarusidestrconsts.dlgpointertypecheck
msgid "@<pointer> returns a typed pointer"
msgstr "@<pointer> возвращает типизированный указатель"
#: lazarusidestrconsts.dlgpoloadicon
msgid "&Load Icon"
msgstr "&Загрузить значок"
#: lazarusidestrconsts.dlgpolongpathaware
msgid "Long path awareness (Windows 10 1607+)"
msgstr "Поддержка длинных путей (Windows 10 1607+)"
#: lazarusidestrconsts.dlgpomisc
msgctxt "lazarusidestrconsts.dlgpomisc"
msgid "Miscellaneous"
msgstr "Разное"
#: lazarusidestrconsts.dlgporequireadministrator
msgid "require administrator (requireAdministrator)"
msgstr "с правами администратора (requireAdministrator)"
#: lazarusidestrconsts.dlgporesources
msgid "Resources"
msgstr "Ресурсы"
#: lazarusidestrconsts.dlgposaveicon
msgid "&Save Icon"
msgstr "Сох&ранить значок"
#: lazarusidestrconsts.dlgposavesession
msgid "Session"
msgstr "Сеанс работы"
#: lazarusidestrconsts.dlgpotitle
msgid "Title:"
msgstr "Заголовок:"
#: lazarusidestrconsts.dlgpouiaccess
msgid "UI Access (uiAccess)"
msgstr "Доступ к интерфейсу пользователя (uiAccess)"
#: lazarusidestrconsts.dlgpouseappbundle
msgid "Use Application Bundle for running and debugging"
msgstr "Использовать Application Bundle для запуска и отладки"
#: lazarusidestrconsts.dlgpouselclscaling
msgid "Use LCL scaling (Hi-DPI)"
msgstr "Использовать масштабирование LCL (Hi-DPI)"
#: lazarusidestrconsts.dlgpousemanifest
msgid "Use manifest resource (and enable themes)"
msgstr "Использовать ресурс manifest (включить поддержку тем)"
#: lazarusidestrconsts.dlgpreferdoubleclickoversingleclick
msgid "Prefer double-click over single-click"
msgstr "Предпочитать двойной щелчок одинарному"
#: lazarusidestrconsts.dlgpriorities
msgid "Priorities"
msgstr "Приоритеты"
#: lazarusidestrconsts.dlgproject
msgctxt "lazarusidestrconsts.dlgproject"
msgid "Project"
msgstr "Проект"
#: lazarusidestrconsts.dlgprojectoptionsfor
#, object-pascal-format
msgid "Options for Project: %s"
msgstr "Параметры проекта: %s"
#: lazarusidestrconsts.dlgprojecttoopenorcreate
msgid "Project to Open or Create"
msgstr "Открываемый или создаваемый проект"
#: lazarusidestrconsts.dlgprojfiles
msgid "Project Files"
msgstr "Файлы проекта"
#: lazarusidestrconsts.dlgpromptonreplace
msgid "&Prompt on replace"
msgstr "Спрашивать при &замене"
#: lazarusidestrconsts.dlgpropertycompletion
msgid "Property completion"
msgstr "Завершение свойств"
#: lazarusidestrconsts.dlgpropnamecolor
msgid "Property Name"
msgstr "Имя свойства"
#: lazarusidestrconsts.dlgqopenlastprj
msgid "Open last project and packages at start"
msgstr "Открывать последние проект и пакеты при запуске"
#: lazarusidestrconsts.dlgqshowborderspacing
msgid "Show border spacing"
msgstr "Показывать зазор у границ"
#: lazarusidestrconsts.dlgqshowgrid
msgid "Show grid"
msgstr "Показывать сетку"
#: lazarusidestrconsts.dlgqsnaptogrid
msgid "Snap to grid"
msgstr "Выравнивать по сетке"
#: lazarusidestrconsts.dlgreallydeletedesktop
#, object-pascal-format
msgid "Really delete desktop \"%s\"?"
msgstr "Вы действительно хотите удалить рабочий стол \"%s\"?"
#: lazarusidestrconsts.dlgredirappend
msgid "To file (append)"
msgstr "В файл (добавить)"
#: lazarusidestrconsts.dlgredirinput
msgid "From file"
msgstr "Из файла"
#: lazarusidestrconsts.dlgredirinputend
msgid "From file (at EOF)"
msgstr "Из файла (при EOF)"
#: lazarusidestrconsts.dlgrediroff
msgid "No redirection"
msgstr "Не перенаправлять"
#: lazarusidestrconsts.dlgrediroverwrite
msgid "To file (overwrite)"
msgstr "В файл (перезаписать)"
#: lazarusidestrconsts.dlgredirstderr
msgid "Redirect StdErr"
msgstr "Перенаправить StdErr"
#: lazarusidestrconsts.dlgredirstdin
msgid "Redirect StdIn"
msgstr "Перенаправить StdIn"
#: lazarusidestrconsts.dlgredirstdnotsupported
msgid "Current debugger does not support redirection."
msgstr "Текущий отладчик не поддерживает перенаправление."
#: lazarusidestrconsts.dlgredirstdout
msgid "Redirect StdOut"
msgstr "Перенаправить StdOut"
#: lazarusidestrconsts.dlgreferencecolor
msgid "Reference"
msgstr "Ссылка"
#: lazarusidestrconsts.dlgregularexpressions
msgid "Regular e&xpressions"
msgstr "&Регулярные выражения"
#: lazarusidestrconsts.dlgrenamedesktop
msgid "Rename desktop"
msgstr "Переименовать рабочий стол"
#: lazarusidestrconsts.dlgrenameselecteddesktopbtncaption
msgctxt "lazarusidestrconsts.dlgrenameselecteddesktopbtncaption"
msgid "Rename"
msgstr "Переименовать"
#: lazarusidestrconsts.dlgrenameselecteddesktopbtnhint
msgid "Rename selected desktop"
msgstr "Переименовать выбранный рабочий стол"
#: lazarusidestrconsts.dlgreplaceall
msgid "Replace &All"
msgstr "Заменить &Все"
#: lazarusidestrconsts.dlgreplacewith
msgid "Replace wit&h"
msgstr "За&менить на"
#: lazarusidestrconsts.dlgreport
msgid "Report"
msgstr "Отчёт"
#: lazarusidestrconsts.dlgreset
msgctxt "lazarusidestrconsts.dlgreset"
msgid "Reset"
msgstr "Сбросить"
#: lazarusidestrconsts.dlgresetall
msgid "Reset all"
msgstr "Сбросить всё"
#: lazarusidestrconsts.dlgrightbottomclr
msgid "Guide lines Right,Bottom"
msgstr "Правая и нижняя линии позиционирования"
#: lazarusidestrconsts.dlgrightclickselects
msgid "Right click selects"
msgstr "Выделять правым щелчком мыши"
#: lazarusidestrconsts.dlgrightmargin
msgid "Right margin"
msgstr "Правая граница"
#: lazarusidestrconsts.dlgroworkingdirectory
msgid "Working directory"
msgstr "Рабочий каталог"
#: lazarusidestrconsts.dlgrubberbandselectsgrandchildren
msgid "Select grandchildren"
msgstr "Выделять внуков"
#: lazarusidestrconsts.dlgruberbandcreationcolor
msgid "Rubberband Creation"
msgstr "Прямоугольник создания"
#: lazarusidestrconsts.dlgruberbandselectioncolor
msgctxt "lazarusidestrconsts.dlgruberbandselectioncolor"
msgid "Rubberband Selection"
msgstr "Прямоугольник выделения"
#: lazarusidestrconsts.dlgrunninginstancemodalerror
#, object-pascal-format
msgid ""
"The running Lazarus instance cannot accept any files.\n"
"Do you want to open them in a new IDE instance?\n"
"\n"
"%s"
msgstr ""
"Запущенный экземпляр Lazarus не может принять файлы.\n"
"Хотите открыть их в новом экземпляре IDE?\n"
"\n"
"%s"
#: lazarusidestrconsts.dlgrunninginstancenotrespondingerror
msgid "Lazarus instance is running but not responding."
msgstr "Экземпляр Lazarus запущен, но не отвечает."
#: lazarusidestrconsts.dlgrunodisplay
msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)"
msgstr "Дисплей (не для win32, например, 198.112.45.11:0, x.org:1, hydra:0.1)"
#: lazarusidestrconsts.dlgrunoenvironment
msgctxt "lazarusidestrconsts.dlgrunoenvironment"
msgid "Environment"
msgstr "Окружение"
#: lazarusidestrconsts.dlgrunolocal
msgid "Local"
msgstr "Локальные"
#: lazarusidestrconsts.dlgrunosystemvariables
msgid "System variables"
msgstr "Системные переменные"
#: lazarusidestrconsts.dlgrunousedisplay
msgid "Use display"
msgstr "Использовать дисплей"
#: lazarusidestrconsts.dlgrunouseroverrides
msgid "User overrides"
msgstr "Пользовательские перекрытия"
#: lazarusidestrconsts.dlgrunparameters
msgid "Run Parameters"
msgstr "Параметры запуска"
#: lazarusidestrconsts.dlgrunwithdebug
msgid "Run uses the debugger (disable for release-mode)"
msgstr "Запускать в отладчике (отключите в режиме сборки Release)"
#: lazarusidestrconsts.dlgsavecurrentdesktop
msgid "Save current desktop"
msgstr "Сохранить текущий рабочий стол"
#: lazarusidestrconsts.dlgsavecurrentdesktopas
msgid "Save current desktop as"
msgstr "Сохранить текущий рабочий стол как"
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtncaption
msgid "Save active desktop as ..."
msgstr "Сохранить активный как ..."
#: lazarusidestrconsts.dlgsavecurrentdesktopasbtnhint
msgid "Save active desktop as"
msgstr "Сохранить активный рабочий стол как"
#: lazarusidestrconsts.dlgsavedlinecolor
msgid "Saved line"
msgstr "Сохранённая строка"
#: lazarusidestrconsts.dlgsaveeditorinfo
msgid "Save editor info for closed files"
msgstr "Сохранять сведения о закрываемых файлах"
#: lazarusidestrconsts.dlgsaveeditorinfohint
msgid "The files are available in the \"Open Recent\" history list."
msgstr "Файлы доступны в списке \"Открыть недавний\""
#: lazarusidestrconsts.dlgsaveeditorinfoproject
msgid "Save editor info only for project files"
msgstr "Сохранять сведения только о файлах проекта"
#: lazarusidestrconsts.dlgsaveeditorinfoprojecthint
msgid "Only files that belong to this project."
msgstr "Только файлы, принадлежащие проекту"
#: lazarusidestrconsts.dlgsavein
msgid "Save in"
msgstr "Сохранить в"
#: lazarusidestrconsts.dlgscrollbarpasteolfixed
msgid "Force 1024 columns minimum for horizontal scroll range"
msgstr "Задать минимум пространства по горизонтали в 1024 столбца"
#: lazarusidestrconsts.dlgscrollbarpasteolnone
msgid "Do not add any permanent space to horizontal scroll range"
msgstr "Не добавлять пространства по горизонтали"
#: lazarusidestrconsts.dlgscrollbarpasteolpage
msgid "Always add one page to horizontal scroll range"
msgstr "Всегда добавлять одну страницу к пространству по горизонтали"
#: lazarusidestrconsts.dlgscrollbyoneless
msgid "Scroll by one less"
msgstr "Прокручивать на строку меньше"
#: lazarusidestrconsts.dlgscrollgroupoptions
msgid "Scrolling"
msgstr "Прокрутка"
#: lazarusidestrconsts.dlgscrollhint
msgctxt "lazarusidestrconsts.dlgscrollhint"
msgid "Show scroll hint"
msgstr "Показывать подсказку при прокрутке"
#: lazarusidestrconsts.dlgscrollpastendfile
msgid "Scroll past end of file"
msgstr "Прокручивать за конец файла"
#: lazarusidestrconsts.dlgscrollpastendline
msgid "Allow Caret to move past the end of line"
msgstr "Разрешать выход курсора за конец строки"
#: lazarusidestrconsts.dlgseachdirectorynotfound
#, object-pascal-format
msgid "Search directory \"%s\" not found."
msgstr "Каталог поиска \"%s\" не найден."
#: lazarusidestrconsts.dlgsearchabort
msgid "Search terminated by user."
msgstr "Поиск прерван пользователем."
#: lazarusidestrconsts.dlgsearchcaption
msgid "Searching ..."
msgstr "Поиск ..."
#: lazarusidestrconsts.dlgsearchpaths
msgid "Paths"
msgstr "Пути"
#: lazarusidestrconsts.dlgsearchscope
msgid "Search scope"
msgstr "Область поиска"
#: lazarusidestrconsts.dlgselectallchildcontrols
msgid "Select all child controls together with their parent."
msgstr "Выделять все компоненты-потомки вместе с их родителями"
#: lazarusidestrconsts.dlgselectallnoscroll
msgid "Do not scroll on Select-All / Paragraph or To-Brace"
msgstr "Не прокручивать при выделении текста полностью / абзаца / до скобки"
#: lazarusidestrconsts.dlgselectedtext
msgid "&Selected text"
msgstr "В вы&деленном"
#: lazarusidestrconsts.dlgsetactivedesktopbtncaption
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtncaption"
msgid "Set active"
msgstr "Сделать активным"
#: lazarusidestrconsts.dlgsetactivedesktopbtnhint
msgctxt "lazarusidestrconsts.dlgsetactivedesktopbtnhint"
msgid "Set active"
msgstr "Сделать активным"
#: lazarusidestrconsts.dlgsetallelementdefault
msgid "Set all elements to default"
msgstr "Установить все элементы по умолчанию"
#: lazarusidestrconsts.dlgsetelementdefault
msgid "Set element to default"
msgstr "Установить элемент по умолчанию"
#: lazarusidestrconsts.dlgsetpropertyvariable
msgid "Set property Variable"
msgstr "Переменная свойства"
#: lazarusidestrconsts.dlgsetpropertyvariablehint
msgid "The parameter name for the default setter procedure."
msgstr "Имя параметра для процедуры установки свойства по умолчанию."
#: lazarusidestrconsts.dlgsetpropertyvariableisprefix
msgid "is prefix"
msgstr "префикс"
#: lazarusidestrconsts.dlgsetpropertyvariableisprefixhint
msgid "If checked, the \"Set property Variable\" is a prefix. Otherwise it is a fixed name."
msgstr "При выборе \"переменная свойства\" будет префиксом. В противном случае это будет фиксированное имя."
#: lazarusidestrconsts.dlgsetpropertyvariableuseconst
msgid "use const"
msgstr "использовать const"
#: lazarusidestrconsts.dlgsetpropertyvariableuseconsthint
msgid "If checked, the setter parameter is marked with \"const\"."
msgstr "При выборе параметр помечается \"const\"."
#: lazarusidestrconsts.dlgshowallunits
msgid "Show all units"
msgstr "Показывать все модули"
#: lazarusidestrconsts.dlgshowcaptionsofnonvisuals
msgid "Show captions of nonvisual components"
msgstr "Показывать заголовки невизуальных компонентов"
#: lazarusidestrconsts.dlgshowcompiledprocedures
msgid "Show compiled procedures"
msgstr "Показывать компилируемые процедуры"
#: lazarusidestrconsts.dlgshowcompilinglinenumbers
msgctxt "lazarusidestrconsts.dlgshowcompilinglinenumbers"
msgid "Show line numbers"
msgstr "Показывать номера строк"
#: lazarusidestrconsts.dlgshowconditionals
msgid "Show conditionals"
msgstr "Показывать условия"
#: lazarusidestrconsts.dlgshowdebuginfo
msgid "Show debug info"
msgstr "Показывать отладочную информацию"
#: lazarusidestrconsts.dlgshowdesignerhints
msgid "Show designer hints"
msgstr "Отображать подсказки редактора форм"
#: lazarusidestrconsts.dlgshowdesignerhintshint
msgid "Hint shows control's position or size while moving or resizing it."
msgstr "Подсказка отображает положение и размер компонента при их изменении"
#: lazarusidestrconsts.dlgshoweverything
msgid "Show everything"
msgstr "Показывать всё"
#: lazarusidestrconsts.dlgshowexecutableinfo
msgid "Show executable info (Win32 only)"
msgstr "Показывать сведения об exe (только Win32)"
#: lazarusidestrconsts.dlgshowfilenameincaption
msgid "Show file name in caption"
msgstr "Показывать имя файла в заголовке"
#: lazarusidestrconsts.dlgshowgeneralinfo
msgid "Show general info"
msgstr "Показывать общие сведения"
#: lazarusidestrconsts.dlgshowgutterhints
msgid "Show gutter hints"
msgstr "Всплывающие подсказки бокового поля"
#: lazarusidestrconsts.dlgshowhint
msgctxt "lazarusidestrconsts.dlgshowhint"
msgid "Show hints"
msgstr "Показывать подсказки"
#: lazarusidestrconsts.dlgshowingwindows
msgid "Showing Windows"
msgstr "Отображение окон"
#: lazarusidestrconsts.dlgshowlinenumbers
msgctxt "lazarusidestrconsts.dlgshowlinenumbers"
msgid "Show line numbers"
msgstr "Показывать номера строк"
#: lazarusidestrconsts.dlgshowmessagesicons
msgid "Show Messages Icons"
msgstr "Показывать значки для сообщений"
#: lazarusidestrconsts.dlgshownotes
msgid "Show notes"
msgstr "Показывать заметки"
#: lazarusidestrconsts.dlgshowtriedfiles
msgid "Show tried files"
msgstr "Показывать опробованные файлы"
#: lazarusidestrconsts.dlgshowusedfiles
msgid "Show used files"
msgstr "Показывать используемые файлы"
#: lazarusidestrconsts.dlgshowwarnings
msgid "Show warnings"
msgstr "Показывать предупреждения"
#: lazarusidestrconsts.dlgsingletaskbarbutton
msgid "Show single button in TaskBar"
msgstr "Показывать одну кнопку в панели задач"
#: lazarusidestrconsts.dlgskipforwardclassdeclarations
msgid "Skip forward class declarations"
msgstr "Пропускать предваряющие объявления классов"
#: lazarusidestrconsts.dlgslashcommenttab
msgid "Slash //"
msgstr "Косые черты //"
#: lazarusidestrconsts.dlgsmarttabs
msgid "Smart tabs"
msgstr "Умные ТАБы"
#: lazarusidestrconsts.dlgsmbbehind
msgid "Symbol behind (.pp~)"
msgstr "Символ сзади (.pp~)"
#: lazarusidestrconsts.dlgsmbcounter
msgid "Counter (.pp;1)"
msgstr "Счетчик (.pp;1)"
#: lazarusidestrconsts.dlgsmbfront
msgid "Symbol in front (.~pp)"
msgstr "Символ спереди (.~pp)"
#: lazarusidestrconsts.dlgsnapguidelines
msgid "Snap to Guide Lines"
msgstr "Выравнивать по линиям позиционирования"
#: lazarusidestrconsts.dlgsnapguidelineshint
msgid "When a control is close to being aligned with another control, it snaps to the aligned position."
msgstr "Когда компонент уже почти выровнен с другим, он перемещается в выровненное положение"
#: lazarusidestrconsts.dlgsourceedittabmultiline
msgid "Multiline tabs"
msgstr "Многострочный список вкладок"
#: lazarusidestrconsts.dlgspacenotcosmos
msgctxt "lazarusidestrconsts.dlgspacenotcosmos"
msgid "Space"
msgstr "Пробел"
#: lazarusidestrconsts.dlgspbhints
msgid "Hints for main speed buttons (open, save, ...)"
msgstr "Подсказки командных кнопок (открыть, сохранить и т.д.)"
#: lazarusidestrconsts.dlgsrorigin
msgid "Origin"
msgstr "Начинать"
#: lazarusidestrconsts.dlgstacksize
msgid "Stack size"
msgstr "Размер стека"
#: lazarusidestrconsts.dlgstopafternrerr
msgid "Stop after number of errors:"
msgstr "Останов после числа ошибок"
#: lazarusidestrconsts.dlgstringautoappend
msgid "Append text to close string"
msgstr "Закрывающий текст строки"
#: lazarusidestrconsts.dlgstringautoprefix
msgid "Prefix string on new line"
msgstr "Префикс новой строки"
#: lazarusidestrconsts.dlgstringbreakindenttab
msgid "String ''"
msgstr "Строка ''"
#: lazarusidestrconsts.dlgstringenableautocontinue
msgid "Extend strings on linebreak"
msgstr "Добавлять новую строку при разрыве текущей"
#: lazarusidestrconsts.dlgsubpropcolor
msgid "SubProperties"
msgstr "Подсвойства"
#: lazarusidestrconsts.dlgsyntaxoptions
msgid "Syntax options"
msgstr "Параметры синтаксиса"
#: lazarusidestrconsts.dlgtabindent
msgid "Tab indents blocks"
msgstr "ТАБ меняет отступ блоков"
#: lazarusidestrconsts.dlgtabnumbersnotebook
msgid "Show tab numbers in notebook"
msgstr "Показывать номера вкладок"
#: lazarusidestrconsts.dlgtabstospaces
msgid "Tabs to spaces"
msgstr "Преобразование ТАБ в пробелы"
#: lazarusidestrconsts.dlgtabwidths
msgctxt "lazarusidestrconsts.dlgtabwidths"
msgid "Tab widths"
msgstr "Ширина ТАБа"
#: lazarusidestrconsts.dlgtargetcpufamily
msgid "Target CPU family"
msgstr "Целевое семейство процессоров"
#: lazarusidestrconsts.dlgtargetos
msgctxt "lazarusidestrconsts.dlgtargetos"
msgid "Target OS"
msgstr "Операционная система"
#: lazarusidestrconsts.dlgtargetplatform
msgid "Target platform"
msgstr "Целевая платформа"
#: lazarusidestrconsts.dlgtargetproc
msgid "Target processor"
msgstr "Целевой процессор"
#: lazarusidestrconsts.dlgtargetspecificoptions
msgid "Target-specific options"
msgstr "Частные параметры цели"
#: lazarusidestrconsts.dlgtestprjdir
msgid "Directory for building test projects"
msgstr "Каталог для сборки пробных проектов"
#: lazarusidestrconsts.dlgtextstyle
msgid "Text-Style"
msgstr "Начертание"
#: lazarusidestrconsts.dlgtexttofind
msgctxt "lazarusidestrconsts.dlgtexttofind"
msgid "Search s&tring"
msgstr "Строка &поиска"
#: lazarusidestrconsts.dlgthiselementusescolor
msgid "The element uses (and edits) the schemes:"
msgstr "Этот элемент использует (и меняет) схемы:"
#: lazarusidestrconsts.dlgtoggledebugdesktopbtncaption
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtncaption"
msgid "Toggle as debug desktop"
msgstr "Режим отладочного"
#: lazarusidestrconsts.dlgtoggledebugdesktopbtnhint
msgctxt "lazarusidestrconsts.dlgtoggledebugdesktopbtnhint"
msgid "Toggle as debug desktop"
msgstr "Переключить режим отладочного рабочего стола"
#: lazarusidestrconsts.dlgtopinfohint
msgid "Current Class/Proc Hint"
msgstr "Подсказка о текущих классе/процедуре"
#: lazarusidestrconsts.dlgtrimspacetypecaption
msgid "Trim spaces style"
msgstr "Метод обрезки пробелов"
#: lazarusidestrconsts.dlgtrimspacetypecaretmove
msgid "Caret or Edit"
msgstr "При курсоре или правке"
#: lazarusidestrconsts.dlgtrimspacetypeeditline
msgid "Line Edited"
msgstr "При правке строки"
#: lazarusidestrconsts.dlgtrimspacetypeleaveline
msgid "Leave line"
msgstr "При покидании строки"
#: lazarusidestrconsts.dlgtrimspacetypeposonly
msgid "Position Only"
msgstr "Только позиция курсора"
#: lazarusidestrconsts.dlgtrimtrailingspaces
msgid "Trim trailing spaces"
msgstr "Обрезать хвостовые пробелы"
#: lazarusidestrconsts.dlgundoaftersave
msgid "Undo after save"
msgstr "Список отмен после сохранения"
#: lazarusidestrconsts.dlgundogroupoptions
msgid "Undo / Redo"
msgstr "Отмена и возврат"
#: lazarusidestrconsts.dlgundolimit
msgid "Undo limit"
msgstr "Лимит отмен"
#: lazarusidestrconsts.dlgunitdeprefresh
msgctxt "lazarusidestrconsts.dlgunitdeprefresh"
msgid "Refresh"
msgstr "Обновить"
#: lazarusidestrconsts.dlgunitoutp
msgid "Unit output directory (-FU):"
msgstr "Каталог вывода модулей (-FU):"
#: lazarusidestrconsts.dlgunsavedlinecolor
msgid "Unsaved line"
msgstr "Несохранённая строка"
#: lazarusidestrconsts.dlgusecodefolding
msgid "Code Folding"
msgstr "Сворачивание кода"
#: lazarusidestrconsts.dlguseconsolebuffer
msgid "Set Columns/Rows"
msgstr "Задать столбцы/строки"
#: lazarusidestrconsts.dlguseconsolepos
msgid "Set Left/Top"
msgstr "Задать лево/верх"
#: lazarusidestrconsts.dlguseconsolesize
msgid "Set Width/Height"
msgstr "Задать ширину/высоту"
#: lazarusidestrconsts.dlgusecustomconfig
msgid "Use additional compiler config file"
msgstr "Использовать дополнительный файл настройки компилятора"
#: lazarusidestrconsts.dlgusedividerdraw
msgid "Divider Drawing"
msgstr "Отображение разделителя"
#: lazarusidestrconsts.dlgusefpccfg
msgid "Use standard compiler config file (fpc.cfg)"
msgstr "Использовать стандартный файл настройки компилятора (fpc.cfg)"
#: lazarusidestrconsts.dlgusehighlight
msgid "Use Highlight"
msgstr "Включить подсветку"
#: lazarusidestrconsts.dlguseiconsincompletionbox
msgid "Icons in code completion box"
msgstr "Значки в окне автозавершения кода"
#: lazarusidestrconsts.dlguselaunchingapp
msgid "Use launching application"
msgstr "Использовать приложение для запуска"
#: lazarusidestrconsts.dlguseminimumime
msgid "IME handled by System"
msgstr "Системный редактор метода ввода"
#: lazarusidestrconsts.dlguserschemeerror
#, object-pascal-format
msgid "Failed to load user-scheme file %s"
msgstr "Не удалось загрузить файл пользовательской схемы %s"
#: lazarusidestrconsts.dlguseschemedefaults
msgid "- Scheme globals -"
msgstr "- Глобальная схема -"
#: lazarusidestrconsts.dlguseschemelocal
msgid "selected language"
msgstr "выбранный язык"
#: lazarusidestrconsts.dlgusesyntaxhighlight
msgid "Use syntax highlight"
msgstr "Подсветка синтаксиса"
#: lazarusidestrconsts.dlgusetabshistory
msgid "Use tab history when closing tabs"
msgstr "Учитывать историю вкладок при их закрытии"
#: lazarusidestrconsts.dlguseunitcaption
msgid "Add unit to Uses section"
msgstr "Добавить модуль в выражение Uses"
#: lazarusidestrconsts.dlgvaluecolor
msgctxt "lazarusidestrconsts.dlgvaluecolor"
msgid "Value"
msgstr "Значение"
#: lazarusidestrconsts.dlgverbosity
msgid "Verbosity during compilation:"
msgstr "Подробность вывода при компиляции"
#: lazarusidestrconsts.dlgvisiblegutter
msgid "Visible gutter"
msgstr "Показывать боковое поле"
#: lazarusidestrconsts.dlgvisiblerightmargin
msgid "Visible right margin"
msgstr "Правая видимая граница"
#: lazarusidestrconsts.dlgwholewordsonly
msgid "&Whole words only"
msgstr "&Только целые слова"
#: lazarusidestrconsts.dlgwidthpos
msgid "Width:"
msgstr "Ширина:"
#: lazarusidestrconsts.dlgwin32guiapp
msgid "Win32 gui application"
msgstr "Графическое приложение Win32"
#: lazarusidestrconsts.dlgwindow
msgctxt "lazarusidestrconsts.dlgwindow"
msgid "Window"
msgstr "Окно"
#: lazarusidestrconsts.dlgwordexceptions
msgid "Exceptions"
msgstr "Исключения"
#: lazarusidestrconsts.dlgwordspolicies
msgctxt "lazarusidestrconsts.dlgwordspolicies"
msgid "Words"
msgstr "Слова"
#: lazarusidestrconsts.dlgwrdpreview
msgctxt "lazarusidestrconsts.dlgwrdpreview"
msgid "Preview"
msgstr "Предпросмотр"
#: lazarusidestrconsts.dlgwritefpclogo
msgid "Write FPC logo"
msgstr "Выводить логотип FPC"
#: lazarusidestrconsts.drsignoringprojectdebuggersettings
msgid " (Ignoring project settings below)"
msgstr " (параметры проекта ниже игнорируются)"
#: lazarusidestrconsts.drsstoreconverterconfiginses
msgid "Store converter config in session"
msgstr "Сохранять параметры преобразования в сеансе работы"
#: lazarusidestrconsts.drsstoredispformatconfiginses
msgid "Store display formats config in session"
msgstr "Сохранять параметры формата отображения в сеансе работы"
#: lazarusidestrconsts.drsstoreformatterconfiginses
msgid "Store formatter config in session"
msgstr "Сохранять параметры форматирования в сеансе работы"
#: lazarusidestrconsts.drsstoreprojectdebuggerconfi
msgid "Store project debugger configs in session"
msgstr "Сохранять параметры отладчика проекта в сеансе работы"
#: lazarusidestrconsts.drsthedebuggerbackendselecti
msgid "The \"Debugger Backend\" selection from the dropdown (list of IDE debugger backends) is always stored in the session. The project specific backends (below) are by default stored in the LPI."
msgstr "Выбранный механизм отладки в раскрывающемся списке (механизмов отладки IDE) всегда сохраняется в сеансе работы. Механизмы отладки проекта (ниже) по умолчанию хранятся в LPI."
#: lazarusidestrconsts.drsthisonlyaffectsdispformats
msgid "This only affects the display formats below. The settings which formats to use are always stored in the session."
msgstr "Затрагивает только список параметров формата отображения ниже. Параметры, задающие используемый список, всегда хранятся в сеансе работы."
#: lazarusidestrconsts.drsthisonlyaffectsthelistofc
msgid "This only affects the list of converters below. The settings which list to use are always stored in the session."
msgstr "Затрагивает только список элементов преобразования ниже. Параметры, задающие используемый список, всегда хранятся в сеансе работы."
#: lazarusidestrconsts.drsthisonlyaffectsthelistofformatter
msgid "This only affects the list of formatters below. The settings which list to use are always stored in the session."
msgstr "Затрагивает только список элементов форматирования ниже. Параметры, задающие используемый список, всегда хранятся в сеансе работы."
#: lazarusidestrconsts.drsuseideglobaldispformats
msgid "Use the IDEs-global display formats"
msgstr "Использовать список параметров формата отображения IDE"
#: lazarusidestrconsts.drsuseprojecfdispformats
msgid "Use the projects display formats"
msgstr "Использовать список параметров формата отображения проекта"
#: lazarusidestrconsts.drsusetheidegloballistofconv
msgid "Use the IDE-Global list of converters"
msgstr "Использовать список элементов преобразования IDE"
#: lazarusidestrconsts.drsusetheidegloballistofformatter
msgid "Use the IDE-Global list of formatters"
msgstr "Использовать список элементов форматирования IDE"
#: lazarusidestrconsts.drsusetheprojectlistofconver
msgid "Use the project list of converters"
msgstr "Использовать список элементов преобразования проекта"
#: lazarusidestrconsts.drsusetheprojectlistofformatter
msgid "Use the project list of formatters"
msgstr "Использовать список элементов форматирования проекта"
#: lazarusidestrconsts.drsusingidedefaultdebuggerse
msgid "Using IDE default debugger settings"
msgstr "Используются параметры отладчика IDE по умолчанию"
#: lazarusidestrconsts.drsusingselectedidedebuggers
msgid "Using selected IDE debugger settings"
msgstr "Используются параметры выбранного отладчика IDE"
#: lazarusidestrconsts.fdinvalidmultiselectiontext
msgid "Multiselected components must be of a single form."
msgstr "Множественный выбор компонентов должен быть на одной форме"
#: lazarusidestrconsts.fdmalignmenu
msgid "Align ..."
msgstr "Выровнять ..."
#: lazarusidestrconsts.fdmdeleteselection
msgid "Delete Selection"
msgstr "Удалить выбранное"
#: lazarusidestrconsts.fdmmirrorhorizontal
msgid "Mirror Horizontal"
msgstr "Отразить по горизонтали"
#: lazarusidestrconsts.fdmmirrorvertical
msgid "Mirror Vertical"
msgstr "Отразить по вертикали"
#: lazarusidestrconsts.fdmorderbackone
msgid "Back One"
msgstr "На один назад"
#: lazarusidestrconsts.fdmorderforwardone
msgid "Forward One"
msgstr "На один вперёд"
#: lazarusidestrconsts.fdmordermovetoback
msgid "Move to Back"
msgstr "Поместить сзади"
#: lazarusidestrconsts.fdmordermovetofront
msgid "Move to Front"
msgstr "Поместить cпереди"
#: lazarusidestrconsts.fdmresetmenu
msgid "Reset ..."
msgstr "Сбросить ..."
#: lazarusidestrconsts.fdmsaveformasxml
msgid "Save Form as XML"
msgstr "Сохранить форму в виде XML"
#: lazarusidestrconsts.fdmscalemenu
msgid "Scale ..."
msgstr "Масштабировать ..."
#: lazarusidestrconsts.fdmscaleword
msgid "Scale"
msgstr "Масштаб"
#: lazarusidestrconsts.fdmselectall
msgctxt "lazarusidestrconsts.fdmselectall"
msgid "Select All"
msgstr "Выделить все"
#: lazarusidestrconsts.fdmsizemenu
msgid "Size ..."
msgstr "Изменить размер ..."
#: lazarusidestrconsts.fdmsizeword
msgid "Size"
msgstr "Размер"
#: lazarusidestrconsts.fdmsnaptogridoption
msgid "Option: Snap to grid"
msgstr "Параметр: Выровнять по сетке"
#: lazarusidestrconsts.fdmsnaptoguidelinesoption
msgid "Option: Snap to guide lines"
msgstr "Параметр: Выровнять по линиям позиционирования"
#: lazarusidestrconsts.fdmzorder
msgid "Z-order"
msgstr "Z-порядок"
#: lazarusidestrconsts.gldhighlightbothsidesofcursor
msgid "On Both Sides"
msgstr "С обеих сторон"
#: lazarusidestrconsts.initdlgdebugchangepath
msgid "Change path"
msgstr "Изменить путь"
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfigured
msgid "Error: The backend is not configured."
msgstr "Ошибка: механизм отладки не настроен."
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotconfiguredmissingpackage
msgid "(The configured backend's package is not installed.)"
msgstr "(Пакет выбранного механизма отладки не установлен.)"
#: lazarusidestrconsts.initdlgdebugclassnoteerrornotsupported
msgid "Error: Your current config uses a backend that is not supported on your OS/Arch."
msgstr "Ошибка: выбранный в настоящий момент механизм отладки не поддерживается вашей архитектурой/ОС."
#: lazarusidestrconsts.initdlgdebugclassnotehintnotrecommended
msgid "Hint: The backend type is OK, but not the recommended type."
msgstr "Подсказка: выбранный тип механизма отладки корректен, но не является рекомендуемым."
#: lazarusidestrconsts.initdlgdebugcreateanewrecommendedback
msgid "Create a new recommended backend"
msgstr "Создать новый рекомендуемый механизм отладки"
#: lazarusidestrconsts.initdlgdebugcurrent
msgctxt "lazarusidestrconsts.initdlgdebugcurrent"
msgid "Current"
msgstr "Текущий"
#: lazarusidestrconsts.initdlgdebugexternalexepathdisplay
msgid "The selected backend uses the external executable:"
msgstr "Выбранный механизм отладки использует внешний исполнимый файл:"
#: lazarusidestrconsts.initdlgdebugexternalexepathprompt
#, object-pascal-format
msgid "The selected backend requires an external executable: \"%s\""
msgstr "Выбранный механизм отладки требует внешний исполнимый файл: \"%s\""
#: lazarusidestrconsts.initdlgdebugheaderdefaultforyourosarchiss
#, object-pascal-format
msgid "Default for your OS/Arch is: \"%s\"."
msgstr "Значение по умолчанию для вашей архитектуры/ОС: \"%s\"."
#: lazarusidestrconsts.initdlgdebugignore
msgctxt "lazarusidestrconsts.initdlgdebugignore"
msgid "Ignore"
msgstr "Пропустить"
#: lazarusidestrconsts.initdlgdebugkeepbackend
msgid "Keep backend"
msgstr "Сохранить выбор механизма отладки"
#: lazarusidestrconsts.initdlgdebugnew
msgctxt "lazarusidestrconsts.initdlgdebugnew"
msgid "New"
msgstr "Новый"
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexeisdirectory
msgid "Error: External executable is a directory, not a file."
msgstr "Ошибка: внешний исполнимый файл на самом деле является каталогом."
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotfound
msgid "Error: External executable not found."
msgstr "Ошибка: внешний исполнимый файл не найден."
#: lazarusidestrconsts.initdlgdebugpathnoteerrorexenotrunnable
msgid "Error: External file is not executable."
msgstr "Ошибка: внешний файл не является исполнимым."
#: lazarusidestrconsts.initdlgdebugpathnoteerrornodefaultfound
msgid "Error: No default for external executable found."
msgstr "Ошибка: не найдено варианта по умолчанию для внешнего исполнимого файла."
#: lazarusidestrconsts.initdlgdebugpathnoteerrornoexespecified
msgid "Error: No external executable specified."
msgstr "Ошибка: не указан внешний исполнимый файл."
#: lazarusidestrconsts.initdlgdebugpopupinformation
#, object-pascal-format
msgid "A backend provides OS and architecture specific implementations for the debugger.%0:sDefault for your OS/Arch is: \"%1:s\".%0:s%0:sOther backends are provided for special tasks (e.g. cross debugging on some platforms) or as generic alternatives.%0:sThe debugger can have different features, depending on the backend.%0:s%0:sSome backends require an external exe (such as gdb or lldb). This exe may be part of your OS (Linux/Mac), or be provided by the Lazarus installer (Windows).%0:s%0:sIf you have just upgraded your installation, you may have to rebuild the IDE before your previously configured backend can be used (if you used a 3rd-party or optional backend). In that case you may choose \"Ignore\"."
msgstr "Механизмы отладки предоставляют реализации отладчика для конкретных архитектур и ОС.%0:sЗначение по умолчанию для вашей архитектуры/ОС: \"%1:s\".%0:s%0:sПрочие механизмы отладки поставляются для конкретных целей (например, кросс-отладки на некоторых платформах), либо в качестве стандартной альтернативы.%0:sВ зависимости от механизма, отладчик может иметь разные возможности.%0:s%0:sНекоторые механизмы требуют внешнего файла (такого, как gdb либо lldb). Этот исполнимый файл может быть частью вашей ОС (Linux/Mac) или поставляться в дистрибутиве Lazarus (Windows).%0:s%0:sПри обновлении Lazarus может потребоваться пересобрать IDE, чтобы продолжать использовать свой механизм отладки (если использовался сторонний либо не являющийся обязательным механизм). В этом случае выберите \"Пропустить\"."
#: lazarusidestrconsts.initdlgdebugselectanexistingbackend
msgid "Select an existing backend"
msgstr "Выбрать механизм отладки из имеющихся"
#: lazarusidestrconsts.initdlgdebugstatemissingpackagefooter
msgid "Note: There are more backend configurations available, but their packages (LPK) are not installed. You may want to rebuild the IDE with the packages installed. After the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr "Примечание: доступны дополнительные варианты механизмов отладки, но их пакеты (LPK) не установлены. Может потребоваться установить их и пересобрать IDE. После этого механизм отладки можно будет поменять в меню: Сервис -> Параметры."
#: lazarusidestrconsts.initdlgdebugstatemissingpackagerebuild
#, object-pascal-format
msgid "If you decide to rebuild the IDE first and install missing packages, then select \"Ignore\" for now.%0:sAfter the rebuild, the debugger backend can be changed in the menu: Tools -> Options."
msgstr "Если вы решите установить отсутствующие пакеты и пересобрать IDE, выберите \"Пропустить\".%0:sПосле пересборки механизм отладки можно будет поменять в меню: Сервис -> Параметры."
#: lazarusidestrconsts.initdlgdebugstatemissingpackages
msgid "There may be packages (LPK) missing from your IDE installation. You may need to rebuild the IDE and install them, before making changes to the setup."
msgstr "В IDE могут быть не установлены некоторые пакеты (LPK). Может потребоваться установить их и пересобрать IDE перед настройкой."
#: lazarusidestrconsts.initdlgdebugstaterecommendedfoundinlist
msgid "There is a backend of recommended type in the list of existing debuggers. You may pick this instead of creating a new backend."
msgstr "Механизм отладки рекомендуемого типа уже имеется в списке. Можно выбрать его вместо создания нового."
#: lazarusidestrconsts.initdlgdebugstaterecommendednotinlist
msgid "There is no backend of recommended type in the list of existing debuggers. Consider creating a new backend."
msgstr "Механизм отладки рекомендуемого типа отсутствует в списке. Следует создать новый."
#: lazarusidestrconsts.initdlgdebugstatesetupok
msgid "Setup is OK."
msgstr "Параметры верны."
#: lazarusidestrconsts.initdlgdebugstateupdatebackend
msgid "You are using an older backend. This may not give you the best debugging experience. Consider upgrading to the recommended backend."
msgstr "Используется более старый механизм отладки. Это может уменьшить комфортность процесса отладки. Следует использовать рекомендуемый механизм отладки."
#: lazarusidestrconsts.lis0no1drawdividerlinesonlyfortoplevel2drawlinesforfi
msgid "0 = no, 1 = draw divider lines only for top level, 2 = draw lines for first two levels, ..."
msgstr "0 = не отображать, 1 = отображать только для верхнего уровня, 2 = отображать для первых двух уровней и т.д."
#: lazarusidestrconsts.lisa2paddfiles
msgid "Add Files"
msgstr "Добавить файлы"
#: lazarusidestrconsts.lisa2pambiguousancestortype
msgid "Ambiguous Ancestor Type"
msgstr "Неясный тип предка"
#: lazarusidestrconsts.lisa2pambiguousclassname
msgid "Ambiguous Class Name"
msgstr "Дублирующееся имя класса"
#: lazarusidestrconsts.lisa2pambiguousunitname
msgid "Ambiguous Unit Name"
msgstr "Дублирующееся имя модуля"
#: lazarusidestrconsts.lisa2pancestortype
msgid "Ancestor type"
msgstr "Тип предка"
#: lazarusidestrconsts.lisa2pbrokendependencies
msgid "Broken Dependencies"
msgstr "Нарушенные зависимости"
#: lazarusidestrconsts.lisa2pclassnamealreadyexists
msgid "Class Name already exists"
msgstr "Имя класса уже существует"
#: lazarusidestrconsts.lisa2pcreatenewcomp
msgid "Create New Component"
msgstr "Создать новый компонент"
#: lazarusidestrconsts.lisa2pdependency
msgid "Dependency"
msgstr "Зависимость"
#: lazarusidestrconsts.lisa2pdirectoryforunitfile
msgid "Directory for unit file:"
msgstr "Каталог файла модуля:"
#: lazarusidestrconsts.lisa2pexistingfile2
#, object-pascal-format
msgid "Existing file: \"%s\""
msgstr "Существующий файл: \"%s\""
#: lazarusidestrconsts.lisa2pfilealreadyexists
msgid "File already exists"
msgstr "Файл уже существует"
#: lazarusidestrconsts.lisa2pfilealreadyexistsinthepackage
#, object-pascal-format
msgid "File \"%s\" already exists in the package."
msgstr "Файл \"%s\" уже имеется в пакете."
#: lazarusidestrconsts.lisa2pfileisused
msgid "File is used"
msgstr "Файл используется"
#: lazarusidestrconsts.lisa2pfilename2
msgid "Filename/URL"
msgstr "Имя файла либо адрес"
#: lazarusidestrconsts.lisa2pfilenotunit
msgid "File not unit"
msgstr "Файл не является модулем"
#: lazarusidestrconsts.lisa2picon24x24
msgid "Icon 24x24:"
msgstr "Значок 24x24:"
#: lazarusidestrconsts.lisa2picon36x36
msgid "Icon 36x36:"
msgstr "Значок 36x36:"
#: lazarusidestrconsts.lisa2picon48x48
msgid "Icon 48x48:"
msgstr "Значок 48x48:"
#: lazarusidestrconsts.lisa2pinvalidancestortype
msgid "Invalid Ancestor Type"
msgstr "Неверный тип предка"
#: lazarusidestrconsts.lisa2pinvalidcirculardependency
msgid "Invalid Circular Dependency"
msgstr "Порочный круг зависимостей"
#: lazarusidestrconsts.lisa2pinvalidclassname
msgid "Invalid Class Name"
msgstr "Неверное имя класса"
#: lazarusidestrconsts.lisa2pinvalidfile
msgid "Invalid file"
msgstr "Неверный файл"
#: lazarusidestrconsts.lisa2pinvalidfilename
msgid "Invalid filename"
msgstr "Неверное имя файла"
#: lazarusidestrconsts.lisa2pinvalidunitname
msgid "Invalid Unit Name"
msgstr "Неверное имя модуля"
#: lazarusidestrconsts.lisa2pisnotavalidunitname
#, object-pascal-format
msgid "\"%s\" is not a valid unit name."
msgstr "\"%s\" не является корректным именем модуля."
#: lazarusidestrconsts.lisa2pnewclassname
msgid "New class name:"
msgstr "Новое имя класса:"
#: lazarusidestrconsts.lisa2pnewfile
msgid "New File"
msgstr "Новый файл"
#: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting
#, object-pascal-format
msgid "No package found for dependency \"%s\".%sPlease choose an existing package."
msgstr "Не найдено пакета для зависимости \"%s\".%sВыберите существующий пакет."
#: lazarusidestrconsts.lisa2ppackageorproject
msgid "Package/Project"
msgstr "Пакет/проект"
#: lazarusidestrconsts.lisa2ppagenametoolong
msgid "Page Name too long"
msgstr "Имя вкладки слишком длинное"
#: lazarusidestrconsts.lisa2ppalettepage
msgid "Palette page:"
msgstr "Вкладка палитры:"
#: lazarusidestrconsts.lisa2pshortenorexpandfilename
msgid "Shorten or expand filename"
msgstr "Сократить или развернуть имя файла"
#: lazarusidestrconsts.lisa2pshowall
msgctxt "lazarusidestrconsts.lisa2pshowall"
msgid "Show all"
msgstr "Показать все"
#: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit
#, object-pascal-format
msgid "The ancestor type \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Название типа предка \"%s\" совпадает с%sмодулем \"%s\"."
#: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier
#, object-pascal-format
msgid "The ancestor type \"%s\" is not a valid Pascal identifier."
msgstr "Тип предка \"%s\" не является корректным идентификатором Паскаля."
#: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame
#, object-pascal-format
msgid "The class name \"%s\" and ancestor type \"%s\" are the same."
msgstr "Имя класса \"%s\" и тип предка \"%s\" совпадают."
#: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile
#, object-pascal-format
msgid "The class name \"%s\" exists already in%sPackage %s%sFile: \"%s\""
msgstr "Имя класса \"%s\" уже имеется в%sпакете %s%sФайл: \"%s\""
#: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit
#, object-pascal-format
msgid "The class name \"%s\" has the same name as%sthe unit \"%s\"."
msgstr "Имя класса \"%s\" совпадает с%sименем модуля \"%s\"."
#: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier
#, object-pascal-format
msgid "The class name \"%s\" is not a valid Pascal identifier."
msgstr "Имя класса \"%s\" не является корректным идентификатором Паскаля."
#: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea
#, object-pascal-format
msgid "The file \"%s\" is part of the current project.%sIt is a bad idea to share files between projects and packages."
msgstr "Файл \"%s\" уже принадлежит текущему проекту.%sИметь общие файлы в проектах и пакетах запрещается."
#: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename
#, object-pascal-format
msgid "The filename \"%s\" is ambiguous because the package has no default directory yet.%sPlease specify a filename with full path."
msgstr "Полное имя файла \"%s\" не определено, так как пакет ещё не имеет каталога по умолчанию.%sУкажите имя файла с полным путём."
#: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Максимальная версия меньше минимальной."
#: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe
#, object-pascal-format
msgid "The package already has a dependency on the package \"%s\"."
msgstr "Пакет уже имеет зависимость от пакета \"%s\"."
#: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars
#, object-pascal-format
msgid "The page name \"%s\" is too long (max 100 chars)."
msgstr "Имя вкладки \"%s\" слишком длинное. Оно не должно превышать 100 символов."
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in the package:%s%s"
msgstr "Имя модуля \"%s\" уже существует в этом пакете:%s%s"
#: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage
#, object-pascal-format
msgid "The unitname \"%s\" already exists in this package."
msgstr "Имя модуля \"%s\" уже существует в этом пакете."
#: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer
#, object-pascal-format
msgid "The unit name \"%s\"%sand filename \"%s\" differ."
msgstr "Имя модуля \"%s\"%sи имя файла \"%s\" различаются."
#: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent
#, object-pascal-format
msgid "The unit name \"%s\" is the same as a registered component.%sUsing this can cause strange error messages."
msgstr "Имя модуля \"%s\" совпадает с зарегистрированным компонентом.%sЭто может привести к странным сообщениям об ошибках."
#: lazarusidestrconsts.lisa2punitname
msgid "Unit name:"
msgstr "Имя модуля:"
#: lazarusidestrconsts.lisa2punitnamealreadyexists
msgid "Unitname already exists"
msgstr "Модуль с таким именем уже существует"
#: lazarusidestrconsts.lisabandonchanges
msgid "Abandon changes?"
msgstr "Отбросить изменения?"
#: lazarusidestrconsts.lisabortallloading
msgid "Abort all loading"
msgstr "Прервать всю загрузку"
#: lazarusidestrconsts.lisaborted
msgid "Aborted"
msgstr "Прервано"
#: lazarusidestrconsts.lisabortloadingproject
msgid "Abort loading project"
msgstr "Прервать загрузку проекта"
#: lazarusidestrconsts.lisabout
msgctxt "lazarusidestrconsts.lisabout"
msgid "About"
msgstr "О действии"
#: lazarusidestrconsts.lisabout2
#, object-pascal-format
msgid "About %s"
msgstr "О действии \"%s\""
#: lazarusidestrconsts.lisaboutdocumentation
msgid "Documentation:"
msgstr "Документация:"
#: lazarusidestrconsts.lisaboutide
msgid "About IDE"
msgstr "Об IDE"
#: lazarusidestrconsts.lisaboutlazarus
msgid "About Lazarus"
msgstr "О проекте Lazarus"
#: lazarusidestrconsts.lisaboutlazarusmsg
#, object-pascal-format
msgid "License: GPL/LGPL. See Lazarus and Free Pascal sources for license details.%sLazarus is an IDE to create graphical and console applications with Free Pascal. Free Pascal is a Pascal and Object Pascal compiler that runs on Windows, Linux, macOS, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi-like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing, we need more developers."
msgstr "Лицензия: GPL/LGPL. Обратитесь к исходному коду Lazarus и Free Pascal за подробностями.%sLazarus - это IDE для создания графических и консольных приложений при помощи компилятора Free Pascal. Free Pascal - это компилятор языков Pascal и Object Pascal, работающий под Windows, Linux, macOS, FreeBSD и другими ОС.%sLazarus - это недостающий элемент, который позволит вам разрабатывать программы для всех вышеперечисленных платформ в Delphi-подобном окружении. Эта IDE является инструментом RAD, включающим в себя редактор форм.%sТак как проект Lazarus растёт, он нуждается в большем количестве разработчиков."
#: lazarusidestrconsts.lisaboutnocontributors
msgid "Cannot find contributors list."
msgstr "Невозможно найти список участников"
#: lazarusidestrconsts.lisaboutofficial
msgid "Official:"
msgstr "Официальный сайт:"
#: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen
#, object-pascal-format
msgid "A %s cannot hold TControls.%sYou can only put nonvisual components on it."
msgstr "%s не может содержать компоненты TControl.%sВ него можно помещать только невизуальные компоненты."
#: lazarusidestrconsts.lisacknowledgements
msgid "Acknowledgements"
msgstr "Благодарности"
#: lazarusidestrconsts.lisaction
msgid "Action:"
msgstr "Действие:"
#: lazarusidestrconsts.lisactivate
msgid "Activate"
msgstr "Активировать"
#: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme
msgid "Activate regular expression syntax for text and replacement (pretty much like perl)"
msgstr "Включить синтаксис регулярных выражений для текста и замены (почти как в Perl)"
#: lazarusidestrconsts.lisactivateselected
msgid "Activate Selected"
msgstr "Активировать выделенный"
#: lazarusidestrconsts.lisactive
msgid "Active"
msgstr "Активен"
#: lazarusidestrconsts.lisactivefilter
msgid "Active Filter"
msgstr "Текущий фильтр"
#: lazarusidestrconsts.lisaddanewseparatoraboveselecteditem
msgid "Add a new separator above selected item"
msgstr "Добавить новый разделитель над выделенным элементом"
#: lazarusidestrconsts.lisaddanewseparatorbelowselecteditem
msgid "Add a new separator below selected item"
msgstr "Добавить новый разделитель под выделенным элементом"
#: lazarusidestrconsts.lisadddelphidefine
msgid "Add defines simulating Delphi7"
msgstr "Добавить определения для эмуляции Delphi 7"
#: lazarusidestrconsts.lisadddelphidefinehint
msgid "Useful when the code has checks for supported compiler versions"
msgstr "Полезно при наличии в коде проверок поддерживаемых версий компилятора"
#: lazarusidestrconsts.lisaddedmissingobjectstopascalsource
#, object-pascal-format
msgid "Added missing object \"%s\" to pascal source."
msgstr "В исходный код на Паскале добавлен отсутствующий объект \"%s\"."
#: lazarusidestrconsts.lisaddedpropertysfors
#, object-pascal-format
msgid "Added property \"%s\" for %s."
msgstr "Добавлено свойство \"%s\" для %s."
#: lazarusidestrconsts.lisaddfcutf8
msgid "Add -FcUTF8"
msgstr "Добавить -FcUTF8"
#: lazarusidestrconsts.lisaddfcutf8hint
msgid "May be needed if source files have non-ansistring literals."
msgstr "Может понадобиться, если файлы исходного кода содержат литералы, не являющиеся Ansistring."
#: lazarusidestrconsts.lisaddfilter
msgid "Add Filter ..."
msgstr "Добавить фильтр ..."
#: lazarusidestrconsts.lisadditiondoesnotfitthecurrentmessage
msgid "Addition does not fit the current message"
msgstr "Дополнение не соответствует текущему сообщению"
#: lazarusidestrconsts.lisadditionfitsthecurrentmessage
msgid "Addition fits the current message"
msgstr "Дополнение соответствует текущему сообщению"
#: lazarusidestrconsts.lisadditions
msgid "Additions"
msgstr "Справочные дополнения"
#: lazarusidestrconsts.lisaddkeyworddo
msgid "Add keyword \"do\""
msgstr "Добавлять ключевое слово \"do\""
#: lazarusidestrconsts.lisaddmodifieroverload
msgid "Add modifier \"overload\""
msgstr "Добавить модификатор \"overload\""
#: lazarusidestrconsts.lisaddmodifieroverride
msgid "Add modifier \"override\""
msgstr "Добавить модификатор \"override\""
#: lazarusidestrconsts.lisaddmodifierreintroduce
msgid "Add modifier \"reintroduce\""
msgstr "Добавить модификатор \"reintroduce\""
#: lazarusidestrconsts.lisaddnewbuildmodecopyingsettingsfrom
#, object-pascal-format
msgid "Add new build mode, copying settings from \"%s\""
msgstr "Добавить новый режим сборки с параметрами режима \"%s\""
#: lazarusidestrconsts.lisaddnewdiskfiles
msgid "Add new disk files?"
msgstr "Добавить новые файлы с диска?"
#: lazarusidestrconsts.lisaddnewfilesfromfilesystem
msgid "Add New Files from File System"
msgstr "Добавить новые файлы с диска"
#: lazarusidestrconsts.lisaddnewmacro
msgid "Add new macro"
msgstr "Добавить новый макрос"
#: lazarusidestrconsts.lisaddnewset
msgid "Add new set"
msgstr "Добавить новый набор"
#: lazarusidestrconsts.lisaddpackagerequirement
msgid "Add package requirement?"
msgstr "Добавить зависимость от пакета?"
#: lazarusidestrconsts.lisaddpackagestolistofinstalledpackagescombinewithbui
msgid "Add package(s) to the list of installed packages (combine with --build-ide to rebuild IDE)."
msgstr "Добавить пакет(ы) в список установленных (использовать совместно с --build-ide для пересборки IDE)."
#: lazarusidestrconsts.lisaddpackagetoproject2
msgid "Add package to project"
msgstr "Добавить пакет к проекту"
#: lazarusidestrconsts.lisaddparameterbrackets
msgid "Add parameter brackets"
msgstr "Добавлять скобки для параметров"
#: lazarusidestrconsts.lisaddthefollowingfiles
msgid "Add the following files:"
msgstr "Добавить следующие файлы:"
#: lazarusidestrconsts.lisaddtoincludesearchpath
msgid "Add to include search path?"
msgstr "Добавить к путям поиска включаемых файлов?"
#: lazarusidestrconsts.lisaddtoproject
#, object-pascal-format
msgid "Add %s to project?"
msgstr "Добавить %s к проекту?"
#: lazarusidestrconsts.lisaddtostartupcomponents
msgid "Add to startup components?"
msgstr "Добавить компонент к создаваемым при запуске?"
#: lazarusidestrconsts.lisaddtounitsearchpath
msgid "Add to unit search path?"
msgstr "Добавить к путям поиска модулей?"
#: lazarusidestrconsts.lisaddunitinterfaces
msgid "Add unit interfaces"
msgstr "Добавить модуль Interfaces"
#: lazarusidestrconsts.lisaddunitnotrecommended
msgid "Add unit (not recommended)"
msgstr "Добавить модуль (не рекомендуется)"
#: lazarusidestrconsts.lisaddvaluetomacro
#, object-pascal-format
msgid "Add value to macro %s"
msgstr "Добавить значение в макрос %s"
#: lazarusidestrconsts.lisaf2paddfiletoapackage
msgid "Add File to Package"
msgstr "Добавить файл к пакету"
#: lazarusidestrconsts.lisaf2pdestinationpackage
msgid "Destination package"
msgstr "Целевой пакет"
#: lazarusidestrconsts.lisaf2pfiletype
msgid "File type"
msgstr "Тип файла"
#: lazarusidestrconsts.lisaf2pinvalidpackage
msgid "Invalid Package"
msgstr "Неверный пакет"
#: lazarusidestrconsts.lisaf2pinvalidpackageid
#, object-pascal-format
msgid "Invalid package ID: \"%s\""
msgstr "Неверный идентификатор пакета: \"%s\""
#: lazarusidestrconsts.lisaf2ppackageisreadonly
msgid "Package is read only"
msgstr "Пакет только для чтения"
#: lazarusidestrconsts.lisaf2ppackagenotfound
#, object-pascal-format
msgid "Package \"%s\" not found."
msgstr "Пакет \"%s\" не найден."
#: lazarusidestrconsts.lisaf2pshowall
msgctxt "lazarusidestrconsts.lisaf2pshowall"
msgid "Show all"
msgstr "Показать все"
#: lazarusidestrconsts.lisaf2pthepackageisreadonly
#, object-pascal-format
msgid "The package %s is read only."
msgstr "Пакет %s только для чтения."
#: lazarusidestrconsts.lisafilterwiththenamealreadyexists
#, object-pascal-format
msgid "A filter with the name \"%s\" already exists."
msgstr "Фильтр с именем \"%s\" уже имеется."
#: lazarusidestrconsts.lisaftercleaningupswitchtoautomaticclean
msgid "After cleaning up (clean all or clean common files), switch to clean automatically"
msgstr "После выполнения очистки (всех файлов или только типичных) переключаться в автоматический режим"
#: lazarusidestrconsts.lisalignment
msgid "Alignment"
msgstr "Выравнивание"
#: lazarusidestrconsts.lisallblockslooksok
msgid "All blocks look ok."
msgstr "Все блоки выглядят нормально."
#: lazarusidestrconsts.lisallbuildmodes
msgid "<All build modes>"
msgstr "<Все режимы сборки>"
#: lazarusidestrconsts.lisallinheritedoptions
msgid "All inherited options"
msgstr "Все унаследованные параметры"
#: lazarusidestrconsts.lisalloptions
#, object-pascal-format
msgid "All options of FPC%s (\"%s\")"
msgstr "Все параметры FPC%s (\"%s\")"
#: lazarusidestrconsts.lisallowsearchingformultiplelines
msgid "Allow searching for multiple lines"
msgstr "Разрешить поиск для нескольких строк"
#: lazarusidestrconsts.lisallparametersofthisfunctionarealreadysetatthiscall
msgid "All parameters of this function are already set at this call. Nothing to add."
msgstr "Все параметры в вызове данной функции уже определены. Добавлять нечего."
#: lazarusidestrconsts.lisallpaspppincinunitincludepatharealreadyinaprojectp
msgid "All .pas, .pp, .p, .inc in unit/include path are already in a project/package."
msgstr "Все файлы .pas, .pp, .p, .inc, найденные в каталогах модулей и включаемых файлов, уже имеются в проекте/пакете."
#: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened
#, object-pascal-format
msgid "All your modifications to \"%s\"%swill be lost and the file reopened."
msgstr "Все изменения в \"%s\"%sбудут утеряны и файл откроется повторно."
#: lazarusidestrconsts.lisalpha
msgid "Alpha"
msgstr "Прозрачность"
#: lazarusidestrconsts.lisalternativekey
msgid "Alternative key"
msgstr "Альтернативная клавиша"
#: lazarusidestrconsts.lisalternativekeyor2keysequence
msgid "Alternative key (or 2 key sequence)"
msgstr "Альтернативная клавиша (или двухклавишная комбинация)"
#: lazarusidestrconsts.lisalwaysconvertsuggesteddefaultfilenametolowercase
msgid "Always convert suggested default file name to lowercase"
msgstr "Всегда преобразовывать предлагаемое по умолчанию имя файла в нижний регистр"
#: lazarusidestrconsts.lisalwaysdrawselecteditemsfocused
msgid "Always draw selected items focused"
msgstr "Всегда отрисовывать выделенное как находящееся в фокусе"
#: lazarusidestrconsts.lisalwaysignore
msgid "Always ignore"
msgstr "Всегда игнорировать"
#: lazarusidestrconsts.lisamacrowiththisnamealreadyexists
msgid "A macro with this name already exists."
msgstr "Макрос с таким именем уже имеется."
#: lazarusidestrconsts.lisambiguousfilefound
msgid "Ambiguous file found"
msgstr "Найден файл с дублирующимся именем"
#: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete
#, object-pascal-format
msgid "Ambiguous file found: \"%s\"%sThis file can be mistaken with \"%s\"%sDelete the ambiguous file?"
msgstr "Найден файл с дублирующимся именем: \"%s\"%sОн может быть перепутан с \"%s\"%sУдалить этот файл?"
#: lazarusidestrconsts.lisanchorbottomtobottomside
msgid "Anchor bottom side to bottom side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Привязать низ компонента к низу соседа. Используйте зазор для задания расстояния. Зазор соседа игнорируется."
#: lazarusidestrconsts.lisanchorbottomtotopside
msgid "Anchor bottom side to top side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Привязать низ компонента к верху соседа. Расстояние между компонентами задаётся зазорами данного компонента и соседа."
#: lazarusidestrconsts.lisanchoreditornocontrolselected
msgid "Anchor Editor - no control selected"
msgstr "Редактор привязок - не выбран компонент"
#: lazarusidestrconsts.lisanchorenabledhint
#, object-pascal-format
msgid "Enabled = Include %s in Anchors"
msgstr "Включена = Добавить %s к привязкам"
#: lazarusidestrconsts.lisanchorlefttoleftside
msgid "Anchor left side to left side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Привязать левую сторону компонента к левой стороне соседа. Используйте зазор для задания расстояния. Зазор соседа игнорируется."
#: lazarusidestrconsts.lisanchorlefttorightside
msgid "Anchor left side to right side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Привязать левую сторону компонента к правой стороне соседа. Расстояние между компонентами задаётся зазорами данного компонента и соседа."
#: lazarusidestrconsts.lisanchorrighttoleftside
msgid "Anchor right side to left side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Привязать правую сторону компонента к левой стороне соседа. Расстояние между компонентами задаётся зазорами данного компонента и соседа."
#: lazarusidestrconsts.lisanchorrighttorightside
msgid "Anchor right side to right side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Привязать правую сторону компонента к правой стороне соседа. Используйте зазор для задания расстояния. Зазор соседа игнорируется."
#: lazarusidestrconsts.lisanchorsof
#, object-pascal-format
msgid "Anchors of %s"
msgstr "Привязки %s"
#: lazarusidestrconsts.lisanchorsofselectedcontrols
msgid "Anchors of selected controls"
msgstr "Привязки выбранных компонентов"
#: lazarusidestrconsts.lisanchortoptobottomside
msgid "Anchor top side to bottom side of sibling. The kept distance is defined by both BorderSpacing properties of this and sibling."
msgstr "Привязать верх компонента к низу соседа. Расстояние между компонентами задаётся зазорами данного компонента и соседа."
#: lazarusidestrconsts.lisanchortoptotopside
msgid "Anchor top side to top side of sibling. Use BorderSpacing to set a distance. BorderSpacing of sibling is ignored."
msgstr "Привязать верх компонента к верху соседа. Используйте зазор для задания расстояния. Зазор соседа игнорируется."
#: lazarusidestrconsts.lisanerroroccurredatlaststartupwhileloadingloadthispro
#, object-pascal-format
msgid "An error occurred at last startup while loading %s!%sLoad this project again?"
msgstr "Во время загрузки %s при последнем запуске произошла ошибка!%sЗагрузить проект снова?"
#: lazarusidestrconsts.lisappearance
msgid "Appearance"
msgstr "Внешний вид"
#: lazarusidestrconsts.lisapplicationclassname
msgid "&Application class name"
msgstr "&Название класса приложения"
#: lazarusidestrconsts.lisapplicationprogramdescriptor
msgid "A graphical Free Pascal application using the cross-platform LCL library for its GUI."
msgstr "Графическое приложение на Free Pascal, использующее кроссплатформенную библиотеку LCL для своего графического интерфейса пользователя."
#: lazarusidestrconsts.lisapply
msgctxt "lazarusidestrconsts.lisapply"
msgid "Apply"
msgstr "Применить"
#: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo
msgid "Apply build flags (-B) to dependencies too."
msgstr "Использовать флаг сборки (-B) также для зависимостей."
#: lazarusidestrconsts.lisapplyconventions
msgid "Apply conventions"
msgstr "Применять соглашения по именованию"
#: lazarusidestrconsts.lisapplyconventionshint
msgid "Adjust name extension and character case for platform and file type."
msgstr "Корректировать расширение и регистр символов в зависимости от платформы и типа файла"
#: lazarusidestrconsts.lisaprojectunitcannotbeusedbyotherpackagesprojects
msgid "A project unit can not be used by other packages/projects"
msgstr "Модуль проекта не может использоваться другими пакетами/проектами"
#: lazarusidestrconsts.lisaroundborderspacehint
msgid "Borderspace around the control. The other four borderspaces are added to this value."
msgstr "Зазор вокруг компонента. Остальные четыре значения зазоров добавляются к этому."
#: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext
msgid "Ask before replacing each found text"
msgstr "Спросить перед заменой каждого фрагмента"
#: lazarusidestrconsts.lisaskbeforesavingprojectssession
msgid "Ask before saving project's session"
msgstr "Спрашивать перед сохранением сеанса работы с проектом"
#: lazarusidestrconsts.lisaskforcomponentnameafterputtingitonform
msgid "Ask for component name after putting it on a designer form."
msgstr "Спрашивать имя компонента при помещении его на форму"
#: lazarusidestrconsts.lisaskforfilenameonnewfile
msgid "Ask for file name on new file"
msgstr "Спрашивать имя нового файла при его создании"
#: lazarusidestrconsts.lisasknameoncreate
msgid "Ask name on create"
msgstr "Спрашивать имя при создании"
#: lazarusidestrconsts.lisautoadjustideheight
msgid "Automatically adjust IDE main window height"
msgstr "Выставлять высоту главного окна IDE автоматически"
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalette
msgid "Show complete component palette"
msgstr "Показывать палитру компонентов полностью"
#: lazarusidestrconsts.lisautoadjustideheightfullcomponentpalettehint
msgid "If component palette spans over more lines, show them all and not only one."
msgstr "Показывать все строки палитры компонентов, если она занимает несколько."
#: lazarusidestrconsts.lisautocompletionoff
msgid "Auto completion: off"
msgstr "Автодополнение: выключено"
#: lazarusidestrconsts.lisautocompletionon
msgid "Auto completion: on"
msgstr "Автодополнение: включено"
#: lazarusidestrconsts.lisautomarkup
msgid "Markup and Matches"
msgstr "Подсветка и соответствия"
#: lazarusidestrconsts.lisautomatic
msgctxt "lazarusidestrconsts.lisautomatic"
msgid "Automatic"
msgstr "Автоматически"
#: lazarusidestrconsts.lisautomatically
msgid "Automatically"
msgstr "Автоматическая"
#: lazarusidestrconsts.lisautomaticallyconvertlfmtolrs
msgid "Automatically convert .lfm files to .lrs resource files"
msgstr "Автоматически преобразовывать файлы .lfm в файлы ресурсов .lrs"
#: lazarusidestrconsts.lisautomaticallyignoreforselection
msgid "do not complete selection"
msgstr "не завершать выделенное"
#: lazarusidestrconsts.lisautomaticallyinvokeafterpoint
msgid "Automatically invoke after point"
msgstr "Автоматически вызывать после ввода точки"
#: lazarusidestrconsts.lisautomaticallyinvokeontype
msgid "Automatically invoke on typing"
msgstr "Автоматически вызывать при наборе текста"
#: lazarusidestrconsts.lisautomaticallyinvokeontypeminlength
msgid "Only complete if word is longer or equal"
msgstr "Завершать только слова не короче"
#: lazarusidestrconsts.lisautomaticallyinvokeontypeonlywordend
msgid "Only complete when at end of word"
msgstr "Завершать только в конце слова"
#: lazarusidestrconsts.lisautomaticallyinvokeontypeusetimer
msgid "Use completion box delay"
msgstr "Использовать задержку вывода окна автозавершения"
#: lazarusidestrconsts.lisautomaticallyonlinebreak
msgid "line break"
msgstr "конца строки"
#: lazarusidestrconsts.lisautomaticallyonspace
msgid "space"
msgstr "пробела"
#: lazarusidestrconsts.lisautomaticallyontab
msgid "tab"
msgstr "символа табуляции"
#: lazarusidestrconsts.lisautomaticallyonwordend
msgid "word end"
msgstr "конца слова"
#: lazarusidestrconsts.lisautomaticallyremovecharacter
msgid "do not add character"
msgstr "не добавлять сам символ"
#: lazarusidestrconsts.lisautomaticallyusesinglepossibleident
msgid "Automatically use single possible identifier"
msgstr "Автоматически выбирать единственный возможный идентификатор"
#: lazarusidestrconsts.lisautomaticfeatures
msgid "Completion and Hints"
msgstr "Автозавершение и подсказки"
#: lazarusidestrconsts.lisautoshowobjectinspector
msgid "Auto show"
msgstr "Показывать инспектор объектов автоматически"
#: lazarusidestrconsts.lisavailableforinstallation
msgid "Available for installation"
msgstr "Доступные для установки"
#: lazarusidestrconsts.lisavailableprojectbuildmodes
msgid "Available project build modes"
msgstr "Доступные режимы сборки проекта"
#: lazarusidestrconsts.lisbackupchangedfiles
msgid "Make backup of changed files"
msgstr "Делать резервные копии изменённых файлов"
#: lazarusidestrconsts.lisbackupfilefailed
msgid "Backup file failed"
msgstr "Не удалось создать резервную копию"
#: lazarusidestrconsts.lisbackuphint
msgid "Creates a Backup directory under project directory"
msgstr "Создаёт каталог для резервных копий в каталоге проекта"
#: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies
#, object-pascal-format
msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue."
msgstr "Изменение имени пакета или версии нарушит зависимости. Требуется ли изменить их?%sНажмите Да, чтобы изменить все перечисленные зависимости.%sНажмите Пропустить, чтобы отбросить зависимости и продолжить."
#: lazarusidestrconsts.lisbegins
msgid "begins"
msgstr "начинается"
#: lazarusidestrconsts.lisbehindrelated
msgid "Behind related"
msgstr "После связанных"
#: lazarusidestrconsts.lisbelessverbosecanbegivenmultipletimes
msgid "Be less verbose. Can be given multiple times."
msgstr "Выводить меньше подробностей. Может задаваться несколько раз."
#: lazarusidestrconsts.lisbemoreverbosecanbegivenmultipletimes
msgid "Be more verbose. Can be given multiple times."
msgstr "Выводить больше подробностей. Может задаваться несколько раз."
#: lazarusidestrconsts.lisbestviewedbyinstallingahtmlcontrolliketurbopowerip
msgid "Best viewed by installing a HTML control like turbopoweriprodsgn"
msgstr "Отображается наилучшим образом при установленном компоненте HTML, например, turbopoweriprodsgn"
#: lazarusidestrconsts.lisbfalwaysbuildbeforerun
msgid "Always build before run"
msgstr "Всегда собирать перед запуском"
#: lazarusidestrconsts.lisbfbuildcommand
msgid "Build Command"
msgstr "Команда Собрать"
#: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead
msgid "On build project execute the Build File command instead"
msgstr "При сборке проекта выполнить 'Собрать Файл'"
#: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead
msgid "On run project execute the Run File command instead"
msgstr "При запуске проекта выполнить 'Запустить Файл'"
#: lazarusidestrconsts.lisbfruncommand
msgid "Run Command"
msgstr "Команда запуска"
#: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor
msgid "When this file is active in source editor"
msgstr "Когда этот файл является текущим в редакторе исходного кода ..."
#: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath
msgid "Working directory (leave empty for file path)"
msgstr "Рабочий каталог (оставить пустым для пути к файлу)"
#: lazarusidestrconsts.lisboldnondefaultobjectinspector
msgid "Bold non default values"
msgstr "Выделять значения не по умолчанию жирным"
#: lazarusidestrconsts.lisborderspace
msgid "Border space"
msgstr "Зазор"
#: lazarusidestrconsts.lisbottom
msgctxt "lazarusidestrconsts.lisbottom"
msgid "Bottom"
msgstr "Снизу"
#: lazarusidestrconsts.lisbottomborderspacespinedithint
msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control."
msgstr "Нижний зазор. Его значение добавляется к базовуму зазору и используется для определения пространства под компонентом."
#: lazarusidestrconsts.lisbottomgroupboxcaption
msgid "Bottom anchoring"
msgstr "Нижняя привязка"
#: lazarusidestrconsts.lisbottoms
msgid "Bottoms"
msgstr "Нижние края"
#: lazarusidestrconsts.lisbottomsiblingcomboboxhint
msgid "This is the sibling control to which the bottom side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Это сосед, к которому привязывается нижняя граница. Оставьте пустым для привязки к родителю в стиле Delphi (BorderSpacing и ReferenceSide не имеют значения)."
#: lazarusidestrconsts.lisbottomspaceequally
msgid "Bottom space equally"
msgstr "Равномерно по нижним краям"
#: lazarusidestrconsts.lisbrowseandselectacompiler
msgid "Browse and select a compiler (e.g. ppcx64"
msgstr "Просмотреть и выбрать компилятор (например, ppcx64"
#: lazarusidestrconsts.lisbtnapply
msgid "&Apply"
msgstr "&Применить"
#: lazarusidestrconsts.lisbtnclose
msgctxt "lazarusidestrconsts.lisbtnclose"
msgid "&Close"
msgstr "&Закрыть"
#: lazarusidestrconsts.lisbtndlgreplace
msgctxt "lazarusidestrconsts.lisbtndlgreplace"
msgid "&Replace ..."
msgstr "&Заменить ..."
#: lazarusidestrconsts.lisbtnfind
msgid "&Find"
msgstr "&Найти"
#: lazarusidestrconsts.lisbtnquit
msgctxt "lazarusidestrconsts.lisbtnquit"
msgid "&Quit"
msgstr "В&ыход"
#: lazarusidestrconsts.lisbtnremove
msgctxt "lazarusidestrconsts.lisbtnremove"
msgid "&Remove"
msgstr "&Удалить"
#: lazarusidestrconsts.lisbtnrename
msgid "&Rename"
msgstr "&Переименовать"
#: lazarusidestrconsts.lisbtnreplace
msgid "&Replace"
msgstr "&Заменить"
#: lazarusidestrconsts.lisbuild
msgctxt "lazarusidestrconsts.lisbuild"
msgid "Build"
msgstr "Собрать"
#: lazarusidestrconsts.lisbuildallfilesofprojectpackageide
msgid "Build all files of project/package/IDE."
msgstr "Собрать все файлы проекта/пакета/IDE."
#: lazarusidestrconsts.lisbuildcaption
msgctxt "lazarusidestrconsts.lisbuildcaption"
msgid "Build"
msgstr "Сборка"
#: lazarusidestrconsts.lisbuilddate
msgid "Build Date"
msgstr "Дата сборки"
#: lazarusidestrconsts.lisbuildide
msgid "Build IDE"
msgstr "Сборка IDE"
#: lazarusidestrconsts.lisbuildidewithpackages
msgid "Build IDE with packages. Optional compiler options will be passed after the options from used build mode and can be specified here or with the --opt option."
msgstr "Собрать IDE с пакетами. Необязательные дополнительные параметры компиляции будут переданы после параметров используемого режима сборки и могут быть указаны здесь либо в --opt."
#: lazarusidestrconsts.lisbuilding
msgid "Building"
msgstr "Сборка"
#: lazarusidestrconsts.lisbuildinglazarusfailed
msgid "Building Lazarus failed"
msgstr "Сборка Lazarus не удалась"
#: lazarusidestrconsts.lisbuildmode
#, object-pascal-format
msgid "Build Mode: %s"
msgstr "Режим сборки: %s"
#: lazarusidestrconsts.lisbuildmodediffdifferencesbetweenbuildmodes
msgid "Differences between build modes"
msgstr "Различия между режимами сборки"
#: lazarusidestrconsts.lisbuildmodediffdifferencestootherbuildmodes
msgid "Differences from other build modes"
msgstr "Отличия от других режимов сборки"
#: lazarusidestrconsts.lisbuildmodediffmode
msgid "Mode:"
msgstr "Режим:"
#: lazarusidestrconsts.lisbuildmodes
msgid "Build mode"
msgstr "Режим сборки"
#: lazarusidestrconsts.lisbuildnewproject
msgid "Build new project"
msgstr "Собрать новый проект"
#: lazarusidestrconsts.lisbuildnumber
msgid "Build number"
msgstr "Номер сборки"
#: lazarusidestrconsts.lisbuildstage
msgctxt "lazarusidestrconsts.lisbuildstage"
msgid "Build"
msgstr "сборке"
#: lazarusidestrconsts.lisbusy
msgid "Busy"
msgstr "Приложение занято"
#: lazarusidestrconsts.lisbyte
#, object-pascal-format
msgid "%s byte"
msgstr "%s байт"
#: lazarusidestrconsts.liscancelloadingthiscomponent
msgid "Cancel loading this component"
msgstr "Отменить загрузку этого компонента"
#: lazarusidestrconsts.liscancelloadingunit
msgid "Cancel loading unit"
msgstr "Отменить загрузку модуля"
#: lazarusidestrconsts.liscancelrenaming
msgid "Cancel renaming"
msgstr "Отменить переименование"
#: lazarusidestrconsts.liscannotcompileproject
msgid "Cannot compile project"
msgstr "Невозможно собрать проект"
#: lazarusidestrconsts.liscannotcopytoplevelcomponent
msgid "Cannot copy top level component."
msgstr "Невозможно скопировать компонент верхнего уровня."
#: lazarusidestrconsts.liscannotcreatefile
#, object-pascal-format
msgid "Cannot create file \"%s\""
msgstr "Невозможно создать файл \"%s\""
#: lazarusidestrconsts.liscannotdeletelastmode
msgid "Cannot delete last mode."
msgstr "Невозможно удалить последний режим."
#: lazarusidestrconsts.liscannotexecute
#, object-pascal-format
msgid "cannot execute \"%s\""
msgstr "невозможно запустить на исполнение \"%s\""
#: lazarusidestrconsts.liscannotfind
#, object-pascal-format
msgid "Cannot find %s"
msgstr "Невозможно найти %s"
#: lazarusidestrconsts.liscannotfindexecutable
#, object-pascal-format
msgid "cannot find executable \"%s\""
msgstr "невозможно найти исполнимый файл \"%s\""
#: lazarusidestrconsts.liscannotfindlazarusstarter
#, object-pascal-format
msgid "Cannot find Lazarus starter:%s%s"
msgstr "Невозможно найти программу запуска Lazarus:%s%s"
#: lazarusidestrconsts.liscannotopenform
#, object-pascal-format
msgid "Cannot open form \"%s\"."
msgstr "Невозможно открыть форму \"%s\"."
#: lazarusidestrconsts.liscannotsaveform
#, object-pascal-format
msgid "Cannot save form \"%s\"."
msgstr "Невозможно сохранить форму \"%s\"."
#: lazarusidestrconsts.liscannotsubstitutemacros
#, object-pascal-format
msgid "Cannot substitute macro \"%s\"."
msgstr "Невозможно раскрыть макрос \"%s\"."
#: lazarusidestrconsts.liscannottestthecompilerwhiledebuggingorcompiling
msgid "Cannot test the compiler while debugging or compiling."
msgstr "Проверка компилятора невозможна во время отладки или компиляции."
#: lazarusidestrconsts.liscanonlychangetheclassoftcomponents
msgid "Can only change the class of TComponents."
msgstr "Возможно только изменить класс TComponents."
#: lazarusidestrconsts.liscantfindavalidppu
#, object-pascal-format
msgid "Can't find a valid %s.ppu"
msgstr "Невозможно найти корректный %s.ppu"
#: lazarusidestrconsts.liscaptioncomparefiles
msgid "Compare files (not for creating patches)"
msgstr "Сравнение файлов (не для создания файлов разницы)"
#: lazarusidestrconsts.liscaptionofactivebuildmode
msgid "Caption of active build mode"
msgstr "Заголовок активного режима сборки"
#: lazarusidestrconsts.liscbpfiles
#, object-pascal-format
msgid "%s (%s files)"
msgstr "%s (файлов: %s)"
#: lazarusidestrconsts.liscbpreallydeletesourcefiles
#, object-pascal-format
msgid "Really delete %s source files%s%s"
msgstr "Удалить %s файлов исходного кода%s%s"
#: lazarusidestrconsts.lisccdchangeclassof
#, object-pascal-format
msgid "Change Class of %s"
msgstr "Сменить класс %s"
#: lazarusidestrconsts.lisccdnoclass
msgid "no class"
msgstr "класс отсутствует"
#: lazarusidestrconsts.lisccoambiguouscompiler
msgid "Ambiguous compiler"
msgstr "Дублирующийся компилятор"
#: lazarusidestrconsts.lisccochecktestdir
#, object-pascal-format
msgid "Please check the Test directory under %sTools -> Options -> Files -> Directory for building test projects"
msgstr "Проверьте каталог для сборки пробных проектов в меню %sСервис -> Параметры -> Файлы -> Каталог для сборки пробных проектов"
#: lazarusidestrconsts.lisccocompilernotanexe
#, object-pascal-format
msgid "The compiler \"%s\" is not an executable file.%sDetails: %s"
msgstr "Компилятор \"%s\" не является исполнимым файлом.%sПодробности: %s"
#: lazarusidestrconsts.lisccocontains
msgid "contains "
msgstr "содержит "
#: lazarusidestrconsts.lisccocopyoutputtocliboard
msgid "Copy output to clipboard"
msgstr "Копировать вывод в буфер обмена"
#: lazarusidestrconsts.lisccodatesdiffer
#, object-pascal-format
msgid "The dates of the .ppu files of FPC differ by more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s"
msgstr "Даты файлов .ppu FPC отличаются более, чем на один час.%sЭто может означать, что они принадлежат разным установкам.%sФайл1: %s%sФайл2: %s"
#: lazarusidestrconsts.lisccoerrormsg
msgid "ERROR: "
msgstr "ОШИБКА: "
#: lazarusidestrconsts.lisccofpcunitpathhassource
msgid "FPC unit path contains a source: "
msgstr "путь к модулям FPC содержит файлы исходного кода: "
#: lazarusidestrconsts.lisccohasnewline
msgid "new line symbols"
msgstr "символы конца строки"
#: lazarusidestrconsts.lisccohintmsg
msgid "HINT: "
msgstr "ПОДСКАЗКА: "
#: lazarusidestrconsts.lisccoinvalidcompiler
msgid "Invalid compiler"
msgstr "Неверный компилятор"
#: lazarusidestrconsts.lisccoinvalidsearchpath
msgid "Invalid search path"
msgstr "Неверный путь поиска"
#: lazarusidestrconsts.lisccoinvalidtestdir
msgid "Invalid Test Directory"
msgstr "Неверный каталог для сборки пробных проектов"
#: lazarusidestrconsts.lisccomissingunit
msgid "Missing unit"
msgstr "Модуль отсутствует"
#: lazarusidestrconsts.lisccomsgrtlunitnotfound
#, object-pascal-format
msgid "RTL unit not found: %s"
msgstr "модуль RTL не найден: %s"
#: lazarusidestrconsts.lisccomultiplecfgfound
msgid "multiple compiler configs found: "
msgstr "найдено несколько файлов настройки компилятора: "
#: lazarusidestrconsts.liscconocfgfound
msgid "no fpc.cfg found"
msgstr "не найден fpc.cfg"
#: lazarusidestrconsts.lisccononascii
msgid "non ASCII"
msgstr "символы не-ASCII"
#: lazarusidestrconsts.lisccoppuexiststwice
#, object-pascal-format
msgid "ppu exists twice: %s, %s"
msgstr "дублирующиеся ppu: %s, %s"
#: lazarusidestrconsts.lisccoppuolderthancompiler
#, object-pascal-format
msgid "There is a .ppu file older than the compiler itself:%s%s"
msgstr "Имеется более старый, чем компилятор, файл .ppu:%s%s"
#: lazarusidestrconsts.lisccortlunitnotfounddetailed
#, object-pascal-format
msgid "The RTL unit %s was not found.%sThis typically means your %s has wrong unit paths. Or your installation is broken."
msgstr "Модуль RTL %s не найден.%sОбычно это означает, что в вашем %s содержатся неверные пути к модулям либо была некорректно выполнена установка."
#: lazarusidestrconsts.lisccoseveralcompilers
#, object-pascal-format
msgid "There are several Free Pascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?"
msgstr "В ваших путях имеется несколько компиляторов Free Pascal.%s%s%sВозможно, вы забыли удалить старый компилятор?"
#: lazarusidestrconsts.lisccoskip
msgctxt "lazarusidestrconsts.lisccoskip"
msgid "Skip"
msgstr "Пропустить"
#: lazarusidestrconsts.lisccospecialcharacters
msgid "special characters"
msgstr "специальные символы"
#: lazarusidestrconsts.lisccotestssuccess
msgid "All tests succeeded."
msgstr "Все тесты прошли успешно."
#: lazarusidestrconsts.lisccounabletocreatetestfile
msgid "Unable to create Test File"
msgstr "Невозможно создать тестовый файл"
#: lazarusidestrconsts.lisccounabletocreatetestpascalfile
#, object-pascal-format
msgid "Unable to create Test Pascal file \"%s\"."
msgstr "Невозможно создать тестовый файл Паскаля \"%s\"."
#: lazarusidestrconsts.lisccounusualchars
msgid "unusual characters"
msgstr "необычные символы"
#: lazarusidestrconsts.lisccowarningcaption
msgctxt "lazarusidestrconsts.lisccowarningcaption"
msgid "Warning"
msgstr "Предупреждение"
#: lazarusidestrconsts.lisccowarningmsg
msgid "WARNING: "
msgstr "ПРЕДУПРЕЖДЕНИЕ: "
#: lazarusidestrconsts.lisccowrongpathdelimiter
msgid "wrong path delimiter"
msgstr "неверный разделитель пути"
#: lazarusidestrconsts.liscecategories
msgid "Categories"
msgstr "Категории"
#: lazarusidestrconsts.liscecomplexitygroup
msgid "Complexity"
msgstr "Сложность"
#: lazarusidestrconsts.lisceconstants
msgid "Constants"
msgstr "Константы"
#: lazarusidestrconsts.lisceemptyblocks
msgid "Empty blocks"
msgstr "Пустые блоки"
#: lazarusidestrconsts.lisceemptyclasssections
msgid "Empty class sections"
msgstr "Пустые секции классов"
#: lazarusidestrconsts.lisceemptygroup
msgid "Empty constructs"
msgstr "Пустые конструкции"
#: lazarusidestrconsts.lisceemptyprocedures
msgid "Empty procedures"
msgstr "Пустые процедуры"
#: lazarusidestrconsts.liscefilter
msgid "(filter)"
msgstr "(фильтр)"
#: lazarusidestrconsts.liscefollowcursor
msgid "Follow cursor"
msgstr "Следовать за курсором"
#: lazarusidestrconsts.lisceisarootcontrol
msgid "Is a root control"
msgstr "Является корневым"
#: lazarusidestrconsts.liscelongparamlistcount
msgid "Parameters count treated as \"many\""
msgstr "\"Много\" параметров"
#: lazarusidestrconsts.liscelongprocedures
msgid "Long procedures"
msgstr "Длинные процедуры"
#: lazarusidestrconsts.liscelongproclinecount
msgid "Line count of procedure treated as \"long\""
msgstr "\"Много\" строк в процедуре"
#: lazarusidestrconsts.liscemanynestedprocedures
msgid "Many nested procedures"
msgstr "Много вложенных процедур"
#: lazarusidestrconsts.liscemanyparameters
msgid "Many parameters"
msgstr "Много параметров"
#: lazarusidestrconsts.liscemodeshowcategories
msgid "Show Categories"
msgstr "Показать категории"
#: lazarusidestrconsts.liscemodeshowsourcenodes
msgid "Show Source Nodes"
msgstr "Показать элементы исходного кода"
#: lazarusidestrconsts.liscenestedproccount
msgid "Nested procedures count treated as \"many\""
msgstr "\"Много\" вложенных процедур"
#: lazarusidestrconsts.liscenteralostwindow
msgid "Center a lost window"
msgstr "Расположить потерянное окно по центру"
#: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling
msgid "Center control horizontally relative to the given sibling. BorderSpacing is ignored."
msgstr "Расположить компонент по центру по горизонтали относительно данного. Зазор при этом игнорируется."
#: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling
msgid "Center control vertically relative to the given sibling. BorderSpacing is ignored."
msgstr "Расположить компонент по центру по вертикали относительно данного. Зазор при этом игнорируется."
#: lazarusidestrconsts.liscenterform
msgid "Center Form"
msgstr "Поместить форму в центре"
#: lazarusidestrconsts.liscenterinwindow
msgid "Center in window"
msgstr "Центр окна"
#: lazarusidestrconsts.liscenters
msgid "Centers"
msgstr "Центры"
#: lazarusidestrconsts.lisceomode
msgid "Preferred exhibition mode"
msgstr "Предпочтительный режим отображения"
#: lazarusidestrconsts.lisceomodecategory
msgctxt "lazarusidestrconsts.lisceomodecategory"
msgid "Category"
msgstr "Категории"
#: lazarusidestrconsts.lisceomodesource
msgctxt "lazarusidestrconsts.lisceomodesource"
msgid "Source"
msgstr "Исходный код"
#: lazarusidestrconsts.lisceoneveronlymanually
msgid "Never, only manually"
msgstr "Никогда, только вручную"
#: lazarusidestrconsts.lisceonlyusedincategorymode
msgid "Only used in category mode"
msgstr "Категории (только в режиме категорий)"
#: lazarusidestrconsts.lisceoonidle
msgid "On idle"
msgstr "При простое"
#: lazarusidestrconsts.lisceorefreshautomatically
msgid "Refresh automatically"
msgstr "Обновлять автоматически"
#: lazarusidestrconsts.lisceothergroup
msgctxt "lazarusidestrconsts.lisceothergroup"
msgid "Other"
msgstr "Другое"
#: lazarusidestrconsts.lisceoupdate
msgid "Update"
msgstr "Обновление"
#: lazarusidestrconsts.lisceowhenswitchingfile
msgid "When switching file in source editor"
msgstr "При переключении файла в редакторе исходного кода"
#: lazarusidestrconsts.lisceprocedures
msgid "Procedures"
msgstr "Процедуры"
#: lazarusidestrconsts.lisceproperties
msgctxt "lazarusidestrconsts.lisceproperties"
msgid "Properties"
msgstr "Свойства"
#: lazarusidestrconsts.liscepublishedpropertywithoutdefault
msgid "Published properties without default"
msgstr "Опубликованные свойства без default"
#: lazarusidestrconsts.lisceshowcodeobserver
msgid "Show observations about"
msgstr "Сообщения смотрителя кода"
#: lazarusidestrconsts.liscestylegroup
msgctxt "lazarusidestrconsts.liscestylegroup"
msgid "Style"
msgstr "Стиль"
#: lazarusidestrconsts.liscesurrounding
msgid "Surrounding"
msgstr "Вложенный код"
#: lazarusidestrconsts.liscetodos
msgid "ToDos"
msgstr "Элементы ToDo"
#: lazarusidestrconsts.liscetypes
msgid "Types"
msgstr "Типы"
#: lazarusidestrconsts.lisceunnamedconstants
msgid "Unnamed constants"
msgstr "Неименованные константы"
#: lazarusidestrconsts.lisceunsortedmembers
msgid "Unsorted members"
msgstr "Несортированные элементы"
#: lazarusidestrconsts.lisceunsortedvisibility
msgid "Unsorted visibility"
msgstr "Несортированные видимые"
#: lazarusidestrconsts.lisceuses
msgctxt "lazarusidestrconsts.lisceuses"
msgid "Uses"
msgstr "Используемые модули"
#: lazarusidestrconsts.liscevariables
msgid "Variables"
msgstr "Переменные"
#: lazarusidestrconsts.liscewrongindentation
msgid "Wrong indentation"
msgstr "Неверные отступы"
#: lazarusidestrconsts.liscfeanexceptionoccurredduringdeletionof
#, object-pascal-format
msgid "An exception occurred during deletion of%s\"%s:%s\"%s%s"
msgstr "Произошло исключение во время удаления%s\"%s:%s\"%s%s"
#: lazarusidestrconsts.liscfedonotknowhowtocopythisformeditingselection
msgid "Do not know how to copy this form editing selection"
msgstr "Неизвестно, как копировать выделенное при редактировании формы"
#: lazarusidestrconsts.liscfedonotknowhowtocutthisformeditingselection
msgid "Do not know how to cut this form editing selection"
msgstr "Неизвестно, как вырезать выделенное при редактировании формы"
#: lazarusidestrconsts.liscfedonotknowhowtodeletethisformeditingselection
msgid "Do not know how to delete this form editing selection"
msgstr "Неизвестно, как удалить выделенное при редактировании формы"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent
msgid "Error creating component"
msgstr "Ошибка при создании компонента"
#: lazarusidestrconsts.liscfeerrorcreatingcomponent2
#, object-pascal-format
msgid "Error creating component: %s%s%s"
msgstr "Ошибка при создании компонента: %s%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingcomponent
msgid "Error destroying component"
msgstr "Ошибка при уничтожении компонента"
#: lazarusidestrconsts.liscfeerrordestroyingcomponentoftypeofunit
#, object-pascal-format
msgid "Error destroying component of type %s of unit %s:%s%s"
msgstr "Ошибка при уничтожении компонента типа %s в модуле %s:%s%s"
#: lazarusidestrconsts.liscfeerrordestroyingmediator
msgid "Error destroying mediator"
msgstr "Ошибка при уничтожении посредника"
#: lazarusidestrconsts.liscfeerrordestroyingmediatorofunit
#, object-pascal-format
msgid "Error destroying mediator %s of unit %s:%s%s"
msgstr "Ошибка при уничтожении посредника %s в модуле %s:%s%s"
#: lazarusidestrconsts.liscfeinfile
#, object-pascal-format
msgid "In file %s"
msgstr "В файле %s"
#: lazarusidestrconsts.liscfeinvalidcomponentowner
msgid "Invalid component owner"
msgstr "Неверный владелец компонента"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformalreadyexists
msgid "TCustomFormEditor.CreateNonFormForm already exists"
msgstr "TCustomFormEditor.CreateNonFormForm уже существует"
#: lazarusidestrconsts.liscfetcustomformeditorcreatenonformformunknowntype
#, object-pascal-format
msgid "TCustomFormEditor.CreateNonFormForm Unknown type %s"
msgstr "TCustomFormEditor.CreateNonFormForm Неизвестный тип %s"
#: lazarusidestrconsts.liscfetcustomformeditordeletecomponentwhereisthetcustomn
#, object-pascal-format
msgid "TCustomFormEditor.DeleteComponent Where is the TCustomNonFormDesignerForm? %s"
msgstr "TCustomFormEditor.DeleteComponent Где TCustomNonFormDesignerForm? %s"
#: lazarusidestrconsts.liscfetcustomformeditorregisterdesignermediatoralreadyre
#, object-pascal-format
msgid "TCustomFormEditor.RegisterDesignerMediator already registered: %s"
msgstr "TCustomFormEditor.RegisterDesignerMediator уже зарегистрирован: %s"
#: lazarusidestrconsts.liscfethecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\"has created the error:%s\"%s\""
msgstr "Редактор компонента класса \"%s\" создал ошибку:%s\"%s\""
#: lazarusidestrconsts.liscfethecomponentoftypefailedtosetitsownerto
#, object-pascal-format
msgid "The component of type %s failed to set its owner to %s:%s"
msgstr "Компоненту типа %s не удалось установить значение владельца в %s:%s"
#: lazarusidestrconsts.liscfeunabletocleartheformeditingselection
#, object-pascal-format
msgid "Unable to clear the form editing selection%s%s"
msgstr "Невозможно очистить выделенное при редактировании формы%s%s"
#: lazarusidestrconsts.lischange
msgctxt "lazarusidestrconsts.lischange"
msgid "Change"
msgstr "Изменить"
#: lazarusidestrconsts.lischangebuildmode
msgid "Change build mode"
msgstr "Сменить режим сборки"
#: lazarusidestrconsts.lischangeclass
msgid "Change Class"
msgstr "Сменить класс"
#: lazarusidestrconsts.lischangedscoordofsfromdtodinsides
#, object-pascal-format
msgid "Changed %s coord of %s from \"%d\" to \"%d\" inside %s."
msgstr "Изменена координата %s компонента %s с \"%d\" на \"%d\" внутри %s."
#: lazarusidestrconsts.lischangeencoding
msgid "Change Encoding"
msgstr "Смена кодировки"
#: lazarusidestrconsts.lischangefile
msgid "Change file"
msgstr "Изменить файл"
#: lazarusidestrconsts.lischangeparent
msgid "Change Parent"
msgstr "Сменить родителя"
#: lazarusidestrconsts.lischangeswerenotsaved
msgid "Changes were not saved"
msgstr "Изменения не были сохранены"
#: lazarusidestrconsts.lischangetounix
msgid "Change to Unix /"
msgstr "Заменять на / Unix"
#: lazarusidestrconsts.lischangetowindows
msgid "Change to Windows \\"
msgstr "Заменять на \\ Windows"
#: lazarusidestrconsts.lischeckall
msgid "Check All"
msgstr "Отметить все"
#: lazarusidestrconsts.lischeckcompilerpath
msgid "Please make sure that the path to the compiler in the IDE options is correct."
msgstr "Убедитесь, что путь к компилятору в параметрах IDE указан корректно."
#: lazarusidestrconsts.lischeckfordiskfilechangesviacontent
msgctxt "lazarusidestrconsts.lischeckfordiskfilechangesviacontent"
msgid "Check for disk file changes via content rather than timestamp"
msgstr "Проверять изменения в файлах на диске по содержимому, а не по времени"
#: lazarusidestrconsts.lischeckifpackagecreatesppuchecknothingdeletesthisfil
#, object-pascal-format
msgid ". Check if package %s creates %s.ppu, check nothing deletes this file and check that no two packages have access to the unit source."
msgstr ". Проверьте, что пакет %s создаёт %s.ppu и этот файл ничем не удаляется. Также убедитесь, что два пакета одновременно не имеют доступа к исходному коду модуля."
#: lazarusidestrconsts.lischeckifpackageisinthedependencies
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischeckifpackageisinthedependencies"
msgid ". Check if package %s is in the dependencies"
msgstr ". Проверьте, что пакет %s имеется в списке зависимостей"
#: lazarusidestrconsts.lischeckifthenexttokeninsourceisanendandifnotreturnsl
msgid "Check if the next token in source is an \"end\" and if not return \"LineEnding + end; + LineEnding\"."
msgstr "Проверить, что следующий элемент исходного кода - слово \"end\", и, если нет, возвратить \"<символы конца строки> + end; + <символы конца строки>\"."
#: lazarusidestrconsts.lischeckoptions
msgid "Check options"
msgstr "Проверка параметров"
#: lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme
#, object-pascal-format
msgctxt "lazarusidestrconsts.lischecksearchpathpackagetryacleanrebuildcheckimpleme"
msgid ". Check search path of package %s, try a clean rebuild, check implementation uses sections."
msgstr ". Проверьте список путей поиска пакета %s, попробуйте пересобрать с очисткой, проверьте выражения Uses в секциях Implementation."
#: lazarusidestrconsts.lischeckthenexttokeninsourceandaddasemicolonifneeded
msgid "Check the next token in source and add a semicolon if needed."
msgstr "Проверить следующий элемент исходного кода и, при необходимости, добавить точку с запятой."
#: lazarusidestrconsts.lischeckthetargetoscpulclwidgettypemaybeyouhavetoreco
#, object-pascal-format
msgid "%s Check the target (OS, CPU, LCL widget type). Maybe you have to recompile the package for this target or set another target for the project."
msgstr "%s Проверьте целевую платформу (ОС, процессор, тип библиотеки виджетов LCL). Возможно, вам требуется пересобрать пакет для данной целевой платформы, либо назначить другую целевую платформу для проекта."
#: lazarusidestrconsts.lischeckuncheckall
msgid "Check/uncheck all"
msgstr "Выбрать всё или снять выбор"
#: lazarusidestrconsts.lischooseadifferentname
msgid "Choose a different name"
msgstr "Выберите другое имя"
#: lazarusidestrconsts.lischooseafilewithcodetoolstemplates
msgid "Choose a file with CodeTools templates"
msgstr "Выберите файл с шаблонами CodeTools"
#: lazarusidestrconsts.lischooseafpdoclink
msgid "Choose a FPDoc link"
msgstr "Выбор ссылки FPDoc"
#: lazarusidestrconsts.lischooseakey
msgid "Choose a key ..."
msgstr "Выберите клавишу ..."
#: lazarusidestrconsts.lischooseanameforthecomponent
msgid "Choose a name for the component"
msgstr "Выберите имя компонента"
#: lazarusidestrconsts.lischooseanexamplefile
msgid "Choose an example file"
msgstr "Выберите файл с примером"
#: lazarusidestrconsts.lischooseanfpcmessagefile
msgid "Choose an FPC message file"
msgstr "Выберите файл сообщений FPC"
#: lazarusidestrconsts.lischooseapascalfileforindentationexamples
msgid "Choose a Pascal file for indentation examples"
msgstr "Выберите файл Паскаля для получения образцов отступов"
#: lazarusidestrconsts.lischoosecompilerexecutable
#, object-pascal-format
msgid "Choose compiler executable (%s)"
msgstr "Выберите исполнимый файл компилятора (%s)"
#: lazarusidestrconsts.lischoosecompilermessages
msgid "Choose compiler messages file"
msgstr "Выберите файл сообщений компилятора"
#: lazarusidestrconsts.lischoosedebuggerexecutable
msgid "Choose debugger executable"
msgstr "Выберите исполнимый файл отладчика"
#: lazarusidestrconsts.lischoosedelphipackage
msgid "Choose Delphi package (*.dpk)"
msgstr "Выберите пакет Delphi (*.dpk)"
#: lazarusidestrconsts.lischoosedelphiproject
msgid "Choose Delphi project (*.dpr)"
msgstr "Выберите проект Delphi (*.dpr)"
#: lazarusidestrconsts.lischoosedelphiunit
msgid "Choose Delphi unit (*.pas)"
msgstr "Выберите модуль Delphi (*.pas)"
#: lazarusidestrconsts.lischoosedirectory
msgid "Choose directory"
msgstr "Выберите каталог"
#: lazarusidestrconsts.lischooseexecutable
msgid "Choose an executable"
msgstr "Выберите исполнимый файл"
#: lazarusidestrconsts.lischoosefpcsourcedir
msgid "Choose FPC source directory"
msgstr "Выберите каталог исходного кода FPC"
#: lazarusidestrconsts.lischoosefppkgconfigurationfile
msgid "Choose the fppkg configuration file"
msgstr "Выберите файл настройки Fppkg"
#: lazarusidestrconsts.lischooselazarussourcedirectory
msgid "Choose Lazarus Directory"
msgstr "Выберите каталог Lazarus"
#: lazarusidestrconsts.lischoosemakeexecutable
msgid "Choose \"make\" executable"
msgstr "Выберите исполнимый файл \"Make\""
#: lazarusidestrconsts.lischoosenameandtext
msgid "Choose name and text"
msgstr "Выберите имя и текст"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile
msgid "Choose one of these items to create a new File"
msgstr "Выберите один из этих элементов для создания нового файла"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage
msgid "Choose one of these items to create a new Package"
msgstr "Выберите один из этих элементов для создания нового пакета"
#: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject
msgid "Choose one of these items to create a new Project"
msgstr "Выберите один из этих элементов для создания нового проекта"
#: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone
msgid "Choose one of these items to inherit from an existing one"
msgstr "Выберите один из этих элементов для наследования от уже существующего"
#: lazarusidestrconsts.lischooseprogramsourcepppaslpr
msgid "Choose program source (*.pp,*.pas,*.lpr)"
msgstr "Выберите файл исходного кода программы (*.pp,*.pas,*.lpr)"
#: lazarusidestrconsts.lischoosestructuretoencloseselection
msgid "Choose structure to enclose selection"
msgstr "Выберите структуру для заключения в неё выделенного"
#: lazarusidestrconsts.lischoosetestbuilddir
msgid "Choose the directory for tests"
msgstr "Выберите каталог для проб"
#: lazarusidestrconsts.liscirculardependencydetected
msgid "Circular dependency detected"
msgstr "Обнаружен порочный круг зависимостей"
#: lazarusidestrconsts.lisclass
msgid "&Class"
msgstr "В классе (&C)"
#: lazarusidestrconsts.lisclasscompletion
msgid "Class Completion"
msgstr "Завершение классов"
#: lazarusidestrconsts.lisclassesandpropertiesexistvalueswerenotchecked
msgid "Classes and properties exist. Values were not checked."
msgstr "Классы и свойства существуют. Значения не проверялись."
#: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste
#, object-pascal-format
msgid "Class \"%s\" is not a registered component class.%sUnable to paste."
msgstr "Класс \"%s\" не является зарегистрированным классом компонента.%sНевозможно вставить."
#: lazarusidestrconsts.lisclassnotfound
msgid "Class not found"
msgstr "Класс не найден"
#: lazarusidestrconsts.lisclassnotfoundat
#, object-pascal-format
msgid "Class %s not found at %s(%s,%s)"
msgstr "Класс %s не найден в %s(%s,%s)"
#: lazarusidestrconsts.lisclassofmethodnotfound
#, object-pascal-format
msgid "Class \"%s\" of method \"%s\" not found."
msgstr "Класс \"%s\" метода \"%s\" не найден."
#: lazarusidestrconsts.liscldirclean
msgid "Clean"
msgstr "Очистить"
#: lazarusidestrconsts.liscldircleandirectory
msgid "Clean Directory"
msgstr "Очистить каталог"
#: lazarusidestrconsts.liscldircleansubdirectories
msgid "Clean sub directories"
msgstr "Очистить подкаталоги"
#: lazarusidestrconsts.liscldirkeepalltextfiles
msgid "Keep all text files"
msgstr "Оставить все текстовые файлы"
#: lazarusidestrconsts.liscldirkeepfilesmatchingfilter
msgid "Keep files matching filter"
msgstr "Сохранить файлы по фильтру"
#: lazarusidestrconsts.liscldirremovefilesmatchingfilter
msgid "Remove files matching filter"
msgstr "Удалить файлы по фильтру"
#: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof
msgid "Simple Syntax (e.g. * instead of .*)"
msgstr "Простой синтаксис (например, * вместо .*)"
#: lazarusidestrconsts.liscleanall
msgid "Clean all"
msgstr "Очищать всё"
#: lazarusidestrconsts.liscleanlazarussource
msgid "Clean Lazarus Source"
msgstr "Очистка каталога исходного кода Lazarus"
#: lazarusidestrconsts.liscleanonlyonce
msgid "Switch after building to automatically"
msgstr "После сборки переключаться в автоматический режим"
#: lazarusidestrconsts.liscleanup
msgid "Clean up"
msgstr "Очистка"
#: lazarusidestrconsts.liscleanupandbuild
msgctxt "lazarusidestrconsts.liscleanupandbuild"
msgid "Clean up and build"
msgstr "Очистить и собрать"
#: lazarusidestrconsts.liscleanupandbuildproject
msgid "Clean up and build project"
msgstr "Очистка и сборка проекта"
#: lazarusidestrconsts.liscleanuplazbuild
msgid "Clean up + lazbuild"
msgstr "Очистить и собрать с lazbuild"
#: lazarusidestrconsts.liscleanuppackage
#, object-pascal-format
msgid "Clean up package \"%s\"."
msgstr "Удалите пакет \"%s\"."
#: lazarusidestrconsts.liscleanupunitpath
msgid "Clean up unit path?"
msgstr "Очистить пути к модулям?"
#: lazarusidestrconsts.lisclear
msgctxt "lazarusidestrconsts.lisclear"
msgid "Clear"
msgstr "Очистить"
#: lazarusidestrconsts.liscleardirectory
msgid "Clear Directory?"
msgstr "Очистить каталог?"
#: lazarusidestrconsts.lisclearfilter
msgid "Clear filter"
msgstr "Очистить фильтр"
#: lazarusidestrconsts.lisclearthefilterforoptions
msgid "Clear the filter for options"
msgstr "Очистить фильтр параметров"
#: lazarusidestrconsts.lisclickheretobrowsethefilehint
msgid "Click here to browse the file"
msgstr "Щёлкните здесь для выбора файла"
#: lazarusidestrconsts.lisclicktoseethechoices
msgid "Click to see the choices"
msgstr "Нажмите, чтобы увидеть возможные действия"
#: lazarusidestrconsts.lisclicktoselectpalettepage
msgid "Click to Select Palette Page"
msgstr "Щёлкните для выбора вкладки палитры компонентов"
#: lazarusidestrconsts.lisclone
msgid "Clone"
msgstr "Клонировать"
#: lazarusidestrconsts.lisclose
msgctxt "lazarusidestrconsts.lisclose"
msgid "Close"
msgstr "Закрыть"
#: lazarusidestrconsts.liscloseallchecked
msgid "Close All Checked"
msgstr "Закрыть все отмеченные"
#: lazarusidestrconsts.lisclosealltabsclose
msgid "Close files"
msgstr "Закрыть файлы"
#: lazarusidestrconsts.lisclosealltabshide
msgctxt "lazarusidestrconsts.lisclosealltabshide"
msgid "Hide window"
msgstr "Скрыть окно"
#: lazarusidestrconsts.lisclosealltabsquestion
msgid "Closing a Source Editor Window. Do you want close all files or hide the window?"
msgstr "Вы закрываете окно редактора исходного кода. Закрыть все файлы или скрыть окно?"
#: lazarusidestrconsts.lisclosealltabstitle
msgid "Close Source Editor Window"
msgstr "Закрытие окна редактора исходного кода"
#: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions
msgid "LCL Interface specific options:"
msgstr "Параметры LCL, зависящие от интерфейса:"
#: lazarusidestrconsts.liscmparameter
msgid "Parameter"
msgstr "Параметр"
#: lazarusidestrconsts.liscmplstcomponents
msgctxt "lazarusidestrconsts.liscmplstcomponents"
msgid "Components"
msgstr "Компоненты"
#: lazarusidestrconsts.liscmplstinheritance
msgid "Inheritance"
msgstr "Наследование"
#: lazarusidestrconsts.liscmplstlist
msgid "List"
msgstr "Список"
#: lazarusidestrconsts.liscmplstpalette
msgid "Palette"
msgstr "Палитра"
#: lazarusidestrconsts.liscmppages
msgid "Pages"
msgstr "Вкладки"
#: lazarusidestrconsts.liscmppalettevisible
msgid "Palette is &visible"
msgstr "&Показывать палитру"
#: lazarusidestrconsts.liscmprestoredefaults
msgid "&Restore defaults"
msgstr "Сброс&ить"
#: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile
msgid "Ambiguous additional compiler config file"
msgstr "Дублирующийся файл настройки компилятора"
#: lazarusidestrconsts.liscocallon
msgid "Call on:"
msgstr "Вызов при:"
#: lazarusidestrconsts.liscoclickokifaresuretodothat
#, object-pascal-format
msgid "%s%sClick OK if you definitely want to do that."
msgstr "%s%sНажмите OK, если действительно уверены."
#: lazarusidestrconsts.liscocommand
msgctxt "lazarusidestrconsts.liscocommand"
msgid "Command:"
msgstr "Команда:"
#: lazarusidestrconsts.liscode
msgid "Code"
msgstr "Код"
#: lazarusidestrconsts.liscodebrowser
msgctxt "lazarusidestrconsts.liscodebrowser"
msgid "Code Browser"
msgstr "Браузер кода"
#: lazarusidestrconsts.liscodecreationdialogcaption
msgid "Code creation options"
msgstr "Параметры создания кода"
#: lazarusidestrconsts.liscodecreationdialogclasssection
msgid "Class section"
msgstr "Секция класса"
#: lazarusidestrconsts.liscodecreationdialoglocation
msgctxt "lazarusidestrconsts.liscodecreationdialoglocation"
msgid "Location"
msgstr "Расположение"
#: lazarusidestrconsts.liscodegenerationoptions
msgid "Code generation options"
msgstr "Параметры генерации кода"
#: lazarusidestrconsts.liscodehelpaddpathbutton
msgid "Add path"
msgstr "Добавить путь"
#: lazarusidestrconsts.liscodehelpbrowseexamplebutton
msgctxt "lazarusidestrconsts.liscodehelpbrowseexamplebutton"
msgid "Browse"
msgstr "Обзор"
#: lazarusidestrconsts.liscodehelpconfirmreplace
msgid "Confirm replace"
msgstr "Подтвердите замену"
#: lazarusidestrconsts.liscodehelpcreatebutton
msgid "Create help item"
msgstr "Создать элемент справки"
#: lazarusidestrconsts.liscodehelpdeletepathbutton
msgid "Remove path"
msgstr "Удалить путь"
#: lazarusidestrconsts.liscodehelpdescrtag
msgctxt "lazarusidestrconsts.liscodehelpdescrtag"
msgid "Description"
msgstr "Описание"
#: lazarusidestrconsts.liscodehelperrorstag
msgctxt "lazarusidestrconsts.liscodehelperrorstag"
msgid "Errors"
msgstr "Ошибки"
#: lazarusidestrconsts.liscodehelpexampletag
msgid "Example"
msgstr "Пример"
#: lazarusidestrconsts.liscodehelpgroupbox
msgid "FPDoc settings"
msgstr "Параметры FPDoc"
#: lazarusidestrconsts.liscodehelphintboldformat
msgid "Insert bold formatting tag"
msgstr "Вставить тег форматирования для полужирного шрифта"
#: lazarusidestrconsts.liscodehelphintinsertcodetag
msgid "Insert code formatting tag"
msgstr "Вставить тег форматирования для кода"
#: lazarusidestrconsts.liscodehelphintitalicformat
msgid "Insert italic formatting tag"
msgstr "Вставить тег форматирования для курсива"
#: lazarusidestrconsts.liscodehelphintremarktag
msgid "Insert remark formatting tag"
msgstr "Вставить тег форматирования для замечания"
#: lazarusidestrconsts.liscodehelphintunderlineformat
msgid "Insert underline formatting tag"
msgstr "Вставить тег форматирования для подчёркнутого шрифта"
#: lazarusidestrconsts.liscodehelphintvartag
msgid "Insert var formatting tag"
msgstr "Вставить тег форматирования для имени переменной"
#: lazarusidestrconsts.liscodehelpinherited
msgctxt "lazarusidestrconsts.liscodehelpinherited"
msgid "Inherited"
msgstr "Унаследованное"
#: lazarusidestrconsts.liscodehelpinsertalink
msgid "Insert a link ..."
msgstr "Вставить ссылку ..."
#: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag
msgid "Insert paragraph formatting tag"
msgstr "Вставить тег форматирования для абзаца"
#: lazarusidestrconsts.liscodehelpmainformcaption
msgctxt "lazarusidestrconsts.liscodehelpmainformcaption"
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"
#: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound
msgid "(no inherited description found)"
msgstr "(не найдено унаследованного описания)"
#: lazarusidestrconsts.liscodehelpnotagcaption
msgid "<NONE>"
msgstr "<НЕТ>"
#: lazarusidestrconsts.liscodehelpseealsotag
msgid "See also"
msgstr "Смотрите также"
#: lazarusidestrconsts.liscodehelpshortdescriptionof
msgid "Short description of"
msgstr "Краткое описание"
#: lazarusidestrconsts.liscodehelpshorttag
msgid "Short"
msgstr "Краткое"
#: lazarusidestrconsts.liscodeobignoreconstinfuncs
msgid "Ignore constants in next functions"
msgstr "Игнорировать константы в функциях:"
#: lazarusidestrconsts.liscodeobscharconst
msgid "Search for unnamed char constants"
msgstr "Поиск неименованных констант-символов"
#: lazarusidestrconsts.liscodeobserver
msgid "Code Observer"
msgstr "Смотритель кода"
#: lazarusidestrconsts.liscodeobsignoreeconstants
msgid "Ignore next unnamed constants"
msgstr "Игнорировать неименованные константы:"
#: lazarusidestrconsts.liscodetempladd
msgctxt "lazarusidestrconsts.liscodetempladd"
msgid "Add template"
msgstr "Добавить шаблон"
#: lazarusidestrconsts.liscodetempladdcodetemplate
msgid "Add code template"
msgstr "Добавление шаблона кода"
#: lazarusidestrconsts.liscodetemplautocompleteon
msgid "Auto complete on"
msgstr "Автозавершение при обнаружении..."
#: lazarusidestrconsts.liscodetemplcomment
msgid "Comment:"
msgstr "Комментарий:"
#: lazarusidestrconsts.liscodetempleditcodetemplate
msgid "Edit code template"
msgstr "Редактирование шаблона кода"
#: lazarusidestrconsts.liscodetemplerror
msgctxt "lazarusidestrconsts.liscodetemplerror"
msgid "Error"
msgstr "Ошибка"
#: lazarusidestrconsts.liscodetemplerroralreadyexists
msgid "A token already exists."
msgstr "Элемент уже существует."
#: lazarusidestrconsts.liscodetemplerroremptyname
msgid "The token cannot be empty."
msgstr "Элемент не может быть пустым."
#: lazarusidestrconsts.liscodetemplerrorinvalidname
msgid "The token can only contain Latin letters, numbers and underscores, and cannot begin with a number."
msgstr "Элемент может содержать только символы латинского алфавита, цифры и знак подчёркивания, и не может начинаться с цифры."
#: lazarusidestrconsts.liscodetempltoken
msgid "Token:"
msgstr "Элемент:"
#: lazarusidestrconsts.liscodetoolsdefsaction
#, object-pascal-format
msgid "Action: %s"
msgstr "Действие: %s"
#: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly
#, object-pascal-format
msgid "Auto created nodes cannot be edited,%snor can they have non auto created child nodes."
msgstr "Автосоздаваемые элементы не могут ни редактироваться,%sни содержать неавтосоздаваемые дочерние элементы."
#: lazarusidestrconsts.liscodetoolsdefsautogenerated
#, object-pascal-format
msgid "%s, auto generated"
msgstr "%s, автосоздан"
#: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited
msgid "Auto generated nodes cannot be edited."
msgstr "Автосоздаваемые элементы не могут редактироваться."
#: lazarusidestrconsts.liscodetoolsdefsblock
msgid "Block"
msgstr "Блок"
#: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor
msgid "CodeTools Defines Editor"
msgstr "Редактор определений CodeTools"
#: lazarusidestrconsts.liscodetoolsdefscompilerpath
msgid "Compiler path"
msgstr "Путь к компилятору"
#: lazarusidestrconsts.liscodetoolsdefsconvertnode
msgid "Convert node"
msgstr "Преобразовать элемент"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory
#, object-pascal-format
msgid "Create Defines for %s Directory"
msgstr "Создать определения для каталога %s"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler
msgid "Create Defines for Free Pascal Compiler"
msgstr "Создать определения для компилятора Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources
msgid "Create Defines for Free Pascal Git Sources"
msgstr "Создать определения для исходного кода Free Pascal из Git"
#: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject
#, object-pascal-format
msgid "Create Defines for %s Project"
msgstr "Создать определения для проекта %s"
#: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory
msgid "Create FPC Macros and paths for a fpc project directory"
msgstr "Создать макросы FPC и пути к каталогу проекта FPC"
#: lazarusidestrconsts.liscodetoolsdefsdefine
msgid "Define"
msgstr "Определение"
#: lazarusidestrconsts.liscodetoolsdefsdefinerecurse
msgid "Define Recurse"
msgstr "Определить рекурсивно"
#: lazarusidestrconsts.liscodetoolsdefsdeletenode
msgid "Delete node"
msgstr "Удалить элемент"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Главный каталог %s,%sгде Borland установила весь исходный код %s.%sНапример: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s"
msgstr "Главный каталог %s,%sгде Borland установила весь исходный код %s,%sиспользуемый проектом %s.%sНапример: C:/Programme/Borland/Delphi%s"
#: lazarusidestrconsts.liscodetoolsdefsdescription
msgid "Description:"
msgstr "Описание:"
#: lazarusidestrconsts.liscodetoolsdefsdirectory
#, object-pascal-format
msgid "%s directory"
msgstr "Каталог %s"
#: lazarusidestrconsts.liscodetoolsdefselse
msgid "Else"
msgstr "Else"
#: lazarusidestrconsts.liscodetoolsdefselseif
msgid "ElseIf"
msgstr "ElseIf"
#: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory
msgid "FPC Git source directory"
msgstr "Каталог исходного кода FPC из Git"
#: lazarusidestrconsts.liscodetoolsdefsif
msgid "If"
msgstr "If"
#: lazarusidestrconsts.liscodetoolsdefsifdef
msgctxt "lazarusidestrconsts.liscodetoolsdefsifdef"
msgid "IfDef"
msgstr "IfDef"
#: lazarusidestrconsts.liscodetoolsdefsifndef
msgid "IfNDef"
msgstr "IfNDef"
#: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory
msgid "Directory"
msgstr "Каталог"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp
msgid "Insert Delphi 5 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem
msgid "Insert Delphi 5 Directory Template"
msgstr "Вставить шаблон каталога Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl
msgid "Insert Delphi 5 Project Template"
msgstr "Вставить шаблон проекта Delphi 5"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp
msgid "Insert Delphi 6 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem
msgid "Insert Delphi 6 Directory Template"
msgstr "Вставить шаблон каталога Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl
msgid "Insert Delphi 6 Project Template"
msgstr "Вставить шаблон проекта Delphi 6"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp
msgid "Insert Delphi 7 Compiler Template"
msgstr "Вставить шаблон компилятора Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem
msgid "Insert Delphi 7 Directory Template"
msgstr "Вставить шаблон каталога Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl
msgid "Insert Delphi 7 Project Template"
msgstr "Вставить шаблон проекта Delphi 7"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert
msgid "Insert Free Pascal Compiler Template"
msgstr "Вставить шаблон компилятора Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte
msgid "Insert Free Pascal Project Template"
msgstr "Вставить шаблон проекта Free Pascal"
#: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource
msgid "Insert Free Pascal Git Source Template"
msgstr "Вставить шаблон исходного кода Free Pascal из Git"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp
msgid "Insert Kylix 3 Compiler Template"
msgstr "Вставить шаблон компилятора Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem
msgid "Insert Kylix 3 Directory Template"
msgstr "Вставить шаблон каталога Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl
msgid "Insert Kylix 3 Project Template"
msgstr "Вставить шаблон проекта Kylix 3"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild
msgid "Insert node as child"
msgstr "Вставить элемент как дочерний"
#: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow
msgid "Insert node below"
msgstr "Вставить элемент ниже"
#: lazarusidestrconsts.liscodetoolsdefsinserttemplate
msgid "Insert Template"
msgstr "Вставить шаблон"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparent
msgid "Invalid parent"
msgstr "Неверный родитель"
#: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode
msgid "Invalid parent node"
msgstr "Неверный родительский элемент"
#: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode
msgid "Invalid previous node"
msgstr "Неверный предыдущий элемент"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s"
msgstr "Главный каталог %s,%sгде Borland установила весь исходный код %s.%sНапример: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject
#, object-pascal-format
msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s"
msgstr "Главный каталог %s,%sгде Borland установила весь исходный код %s,%sиспользуемый проектом %s.%sНапример: /home/user/kylix%s"
#: lazarusidestrconsts.liscodetoolsdefsmovenodedown
msgid "Move node down"
msgstr "Переместить элемент вниз"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown
msgid "Move node one level down"
msgstr "Переместить элемент на уровень вниз"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup
msgid "Move node one level up"
msgstr "Переместить элемент на уровень вверх"
#: lazarusidestrconsts.liscodetoolsdefsmovenodeup
msgid "Move node up"
msgstr "Переместить элемент вверх"
#: lazarusidestrconsts.liscodetoolsdefsname
msgctxt "lazarusidestrconsts.liscodetoolsdefsname"
msgid "Name:"
msgstr "Имя:"
#: lazarusidestrconsts.liscodetoolsdefsnewnode
msgid "NewNode"
msgstr "Новый элемент"
#: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly
msgid "Node is readonly"
msgstr "Элемент только для чтения"
#: lazarusidestrconsts.liscodetoolsdefsnoneselected
msgid "none selected"
msgstr "Ничего не выбрано"
#: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch
msgid "Parent node cannot contain child nodes."
msgstr "Родительский элемент не может содержать дочерних."
#: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes
msgid "Previous node can not contain child nodes."
msgstr "Предыдущий элемент не может содержать дочерних."
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory
msgctxt "lazarusidestrconsts.liscodetoolsdefsprojectdirectory"
msgid "Project directory"
msgstr "Имя каталога проекта"
#: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2
#, object-pascal-format
msgid "%s project directory"
msgstr "Каталог проекта %s"
#: lazarusidestrconsts.liscodetoolsdefsselectednode
msgid "Selected Node:"
msgstr "Выбранный элемент:"
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory
msgid "The Free Pascal Git source directory. Not required. This will improve find declaration and debugging."
msgstr "Каталог исходного кода Free Pascal из Git. Не обязателен. Улучшит поиск объявлений и отладку."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory
msgid "The Free Pascal project directory."
msgstr "Каталог проекта Free Pascal."
#: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir
msgid "The Free Pascal Git source directory."
msgstr "Каталог исходного кода Free Pascal из Git."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample
#, object-pascal-format
msgid "The path to the Free Pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
msgstr "Путь к компилятору Free Pascal.%s Например, %s/usr/bin%s -n%s или %s/usr/local/bin/fpc @/etc/fpc.cfg%s."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject
msgid "The path to the Free Pascal compiler for this project. Only required if you set the FPC Git source below. Used to autocreate macros."
msgstr "Путь к компилятору Free Pascal для данного проекта. Требуется только при указанном ниже каталоге исходного кода FPC из Git. Используется для автоматического создания макросов."
#: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthissourceusedtoa
#, object-pascal-format
msgid "The path to the Free Pascal compiler for this source.%sUsed to autocreate macros."
msgstr "Путь к компилятору Free Pascal для данного исходного кода.%sИспользуется для автоматического создания макросов."
#: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory
#, object-pascal-format
msgid "The %s project directory,%swhich contains the .dpr, dpk file."
msgstr "Каталог проекта %s,%sсодержащий файлы .dpr, dpk."
#: lazarusidestrconsts.liscodetoolsdefsundefine
msgid "Undefine"
msgstr "Снять определение"
#: lazarusidestrconsts.liscodetoolsdefsundefineall
msgid "Undefine All"
msgstr "Снять определение со всех"
#: lazarusidestrconsts.liscodetoolsdefsundefinerecurse
msgid "Undefine Recurse"
msgstr "Рекурсивно снять определение"
#: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths
msgid "Value as File Paths"
msgstr "Значение как пути к файлам"
#: lazarusidestrconsts.liscodetoolsdefsvalueastext
msgid "Value as Text"
msgstr "Значение как текст"
#: lazarusidestrconsts.liscodetoolsdefsvalueisinvalid
#, object-pascal-format
msgid "%s:%svalue \"%s\" is invalid."
msgstr "%s:%sзначение \"%s\" некорректно."
#: lazarusidestrconsts.liscodetoolsdefsvariable
msgid "Variable:"
msgstr "Переменная:"
#: lazarusidestrconsts.liscodetoolsoptsat
msgid "At"
msgstr "Оператор @"
#: lazarusidestrconsts.liscodetoolsoptsbracket
msgid "Bracket"
msgstr "Скобка"
#: lazarusidestrconsts.liscodetoolsoptscaret
msgid "Caret (^)"
msgstr "Знак ^"
#: lazarusidestrconsts.liscodetoolsoptscolon
msgid "Colon"
msgstr "Двоеточие"
#: lazarusidestrconsts.liscodetoolsoptscomma
msgid "Comma"
msgstr "Запятая"
#: lazarusidestrconsts.liscodetoolsoptsidentifier
msgctxt "lazarusidestrconsts.liscodetoolsoptsidentifier"
msgid "Identifier"
msgstr "Идентификатор"
#: lazarusidestrconsts.liscodetoolsoptskeyword
msgid "Keyword"
msgstr "Ключевое слово"
#: lazarusidestrconsts.liscodetoolsoptsnewline
msgid "Newline"
msgstr "Новая строка"
#: lazarusidestrconsts.liscodetoolsoptsnone
msgctxt "lazarusidestrconsts.liscodetoolsoptsnone"
msgid "None"
msgstr "Нет"
#: lazarusidestrconsts.liscodetoolsoptsnumber
msgid "Number"
msgstr "Число"
#: lazarusidestrconsts.liscodetoolsoptspoint
msgid "Point"
msgstr "Точка"
#: lazarusidestrconsts.liscodetoolsoptssemicolon
msgid "Semicolon"
msgstr "Точка с запятой"
#: lazarusidestrconsts.liscodetoolsoptsspace
msgctxt "lazarusidestrconsts.liscodetoolsoptsspace"
msgid "Space"
msgstr "Пробел"
#: lazarusidestrconsts.liscodetoolsoptsstringconst
msgid "String constant"
msgstr "Строковая константа"
#: lazarusidestrconsts.liscodetoolsoptssymbol
msgid "Symbol"
msgstr "Символ"
#: lazarusidestrconsts.liscoexecuteafter
msgid "Execute after"
msgstr "Выполнить после компиляции"
#: lazarusidestrconsts.liscoexecutebefore
msgid "Execute before"
msgstr "Выполнить перед компиляцией"
#: lazarusidestrconsts.liscollapse
msgid "Collapse"
msgstr "Свернуть"
#: lazarusidestrconsts.liscollapseall
msgid "Collapse All [Ctrl+Minus]"
msgstr "Свернуть всё [Ctrl+Минус]"
#: lazarusidestrconsts.liscollapseall2
msgid "Collapse All"
msgstr "Свернуть все"
#: lazarusidestrconsts.liscollapseallclasses
msgid "Collapse all classes"
msgstr "Свернуть все классы"
#: lazarusidestrconsts.liscollapseallpackages
msgid "Collapse all packages"
msgstr "Свернуть все пакеты"
#: lazarusidestrconsts.liscollapseallunits
msgid "Collapse all units"
msgstr "Свернуть все модули"
#: lazarusidestrconsts.liscomboboxes
msgid "Combo Boxes"
msgstr "Раскрывающиеся списки"
#: lazarusidestrconsts.liscommandlineparameters
msgctxt "lazarusidestrconsts.liscommandlineparameters"
msgid "Command line parameters"
msgstr "Параметры командной строки"
#: lazarusidestrconsts.liscommandlineparamsofprogram
msgid "Command line parameters of program"
msgstr "Параметры командной строки программы"
#: lazarusidestrconsts.liscompile
msgctxt "lazarusidestrconsts.liscompile"
msgid "Compile"
msgstr "Компилировать"
#: lazarusidestrconsts.liscompileanddonotaskagain
msgid "Compile and do not ask again"
msgstr "Компилировать и больше не спрашивать"
#: lazarusidestrconsts.liscompilefollowingmodes
msgid "Compile the following modes"
msgstr "Компилировать в следующих режимах"
#: lazarusidestrconsts.liscompilenormally
msgid "Compile normally"
msgstr "Собрать как обычно"
#: lazarusidestrconsts.liscompileproject
msgid "Compile Project"
msgstr "Компиляция проекта"
#: lazarusidestrconsts.liscompiler
msgid "Compiler"
msgstr "Компилятор"
#: lazarusidestrconsts.liscompilercfgismissing
#, object-pascal-format
msgid "%s is missing."
msgstr "%s отсутствует."
#: lazarusidestrconsts.liscompilerdoesnotsupporttarget
#, object-pascal-format
msgid "Compiler \"%s\" does not support target %s-%s"
msgstr "Компилятор \"%s\" не поддерживает целевую платформу %s-%s"
#: lazarusidestrconsts.liscompilererrorinvalidcompiler
#, object-pascal-format
msgid "Error: invalid compiler: %s"
msgstr "Ошибка: неверный компилятор: %s"
#: lazarusidestrconsts.liscompilerfilename
msgid "Compiler filename"
msgstr "Имя файла компилятора"
#: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath
msgid "Hint: you can set the compiler path in Tools -> Options-> Files -> Compiler Path"
msgstr "Подсказка: Вы можете задать путь компилятора в Сервис -> Параметры -> Файлы -> Путь компилятора"
#: lazarusidestrconsts.liscompilermessagesfilenotfound
#, object-pascal-format
msgid "Compiler messages file not found:%s%s"
msgstr "Файл сообщений компилятора не найден:%s%s"
#: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults
msgid "NOTE: codetools config file not found - using defaults"
msgstr "ЗАМЕТКА: файл настройки CodeTools не найден, поэтому используются значения по умолчанию"
#: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile
msgid "NOTE: loading old codetools options file: "
msgstr "ЗАМЕТКА: загружается старый файл параметров CodeTools: "
#: lazarusidestrconsts.liscompilestage
msgctxt "lazarusidestrconsts.liscompilestage"
msgid "Compile"
msgstr "компиляции"
#: lazarusidestrconsts.liscompilewithprojectsettings
msgid "Compile with project settings"
msgstr "Компилировать с параметрами проекта"
#: lazarusidestrconsts.liscompilewithvdformoredetailscheckforduplicates
msgid "Compile with -vd for more details. Check for duplicates."
msgstr "Соберите с параметром -vd для получения подробностей. Убедитесь в отсутствии дубликатов."
#: lazarusidestrconsts.liscompiling
#, object-pascal-format
msgid "%s (compiling ...)"
msgstr "%s (идёт компиляция ...)"
#: lazarusidestrconsts.liscompletionlonglinehinttype
msgid "Show long line hints"
msgstr "Отображение длинных подсказок"
#: lazarusidestrconsts.liscompletionlonglinehinttypefullleft
msgid "Extend far left"
msgstr "Удлинять далеко влево"
#: lazarusidestrconsts.liscompletionlonglinehinttypelittleleft
msgid "Extend some left"
msgstr "Удлинять немного влево"
#: lazarusidestrconsts.liscompletionlonglinehinttypenone
msgctxt "lazarusidestrconsts.liscompletionlonglinehinttypenone"
msgid "Never"
msgstr "Никогда"
#: lazarusidestrconsts.liscompletionlonglinehinttyperightonly
msgid "Extend right only"
msgstr "Удлинять только вправо"
#: lazarusidestrconsts.liscomponentnameiskeyword
#, object-pascal-format
msgid "Component name \"%s\" is keyword"
msgstr "Имя компонента \"%s\" является ключевым словом"
#: lazarusidestrconsts.liscomppalcomponentlist
msgid "View All"
msgstr "Просмотреть все"
#: lazarusidestrconsts.liscomppalopenpackage
msgid "Open package"
msgstr "Открыть пакет"
#: lazarusidestrconsts.liscomppalopenunit
msgid "Open unit"
msgstr "Открыть модуль"
#: lazarusidestrconsts.liscompress
msgid "Compress"
msgstr "Упаковать"
#: lazarusidestrconsts.liscompresshint
msgid "The resulting directory will be compressed into a ZIP file."
msgstr "Полученный каталог будет упакован в архив ZIP."
#: lazarusidestrconsts.liscomptest
msgctxt "lazarusidestrconsts.liscomptest"
msgid "&Test"
msgstr "&Тест"
#: lazarusidestrconsts.liscondition
msgid "Condition"
msgstr "Условие"
#: lazarusidestrconsts.lisconditionals
msgctxt "lazarusidestrconsts.lisconditionals"
msgid "Conditionals"
msgstr "Условные определения"
#: lazarusidestrconsts.lisconfigdirectory
msgid "Lazarus config directory"
msgstr "Каталог настройки Lazarus"
#: lazarusidestrconsts.lisconfigfileofadditions
msgid "Config file of additions:"
msgstr "Файл настройки дополнений:"
#: lazarusidestrconsts.lisconfigurebuild
#, object-pascal-format
msgid "Configure Build %s"
msgstr "Параметры сборки %s"
#: lazarusidestrconsts.lisconfigurebuildlazarus
msgid "Configure \"Build Lazarus\""
msgstr "Параметры \"Сборки Lazarus\""
#: lazarusidestrconsts.lisconfigureeditortoolbar
msgid "Configure Toolbar"
msgstr "Настроить инструментальную панель"
#: lazarusidestrconsts.lisconfigurelazaruside
msgid "Configure Lazarus IDE"
msgstr "Настройка Lazarus"
#: lazarusidestrconsts.lisconfirm
msgid "Confirm"
msgstr "Подтверждение"
#: lazarusidestrconsts.lisconfirmation
msgid "Confirmation"
msgstr "Подтверждение"
#: lazarusidestrconsts.lisconfirmbuildallprofiles
#, object-pascal-format
msgid "Lazarus will be rebuilt with the following profiles:%sContinue?"
msgstr "Lazarus будет пересобран по следующим профилям:%sПродолжить?"
#: lazarusidestrconsts.lisconfirmchanges
msgid "Confirm changes"
msgstr "Подтвердить изменения"
#: lazarusidestrconsts.lisconfirmdelete
msgid "Confirm delete"
msgstr "Подтвердите удаление"
#: lazarusidestrconsts.lisconfirmlazarusrebuild
#, object-pascal-format
msgid "Do you want to rebuild Lazarus with profile: %s?"
msgstr "Вы хотите пересобрать Lazarus по профилю: %s?"
#: lazarusidestrconsts.lisconfirmnewpackagesetfortheide
msgid "Confirm new package set for the IDE"
msgstr "Подтвердите новый набор пакетов для IDE"
#: lazarusidestrconsts.lisconfirmpackageaction
msgctxt "lazarusidestrconsts.lisconfirmpackageaction"
msgid "Action"
msgstr "Действие"
#: lazarusidestrconsts.lisconfirmpackagenewpackageset
msgid "New package set"
msgstr "Новый набор пакетов"
#: lazarusidestrconsts.lisconfirmpackageoldpackageset
msgid "Old package set"
msgstr "Старый набор пакетов"
#: lazarusidestrconsts.lisconflict
msgid "Conflict"
msgstr "Конфликт"
#: lazarusidestrconsts.lisconflictdetected
msgid "Conflict detected"
msgstr "Обнаружен конфликт"
#: lazarusidestrconsts.lisconsoleapplication
msgid "Console application"
msgstr "Консольное приложение"
#: lazarusidestrconsts.lisconsoleapplicationprogramdescriptor
msgid "A Free Pascal command line program using TCustomApplication to easily check command line options, handling exceptions, etc."
msgstr "Консольная программа на Free Pascal с использованием TCustomApplication для облегчения проверки параметров командной строки, обработки исключений и т. п."
#: lazarusidestrconsts.lisconstructorcode
msgid "Constructor code"
msgstr "Код конструктора"
#: lazarusidestrconsts.liscontains
msgid "contains"
msgstr "содержит"
#: lazarusidestrconsts.liscontents
msgctxt "lazarusidestrconsts.liscontents"
msgid "Contents"
msgstr "Содержимое"
#: lazarusidestrconsts.liscontextsensitive
msgid "Context sensitive"
msgstr "С учётом контекста"
#: lazarusidestrconsts.liscontinueanddonotaskagain
msgid "Continue and do not ask again"
msgstr "Продолжить и больше не спрашивать"
#: lazarusidestrconsts.liscontinuebuilding
msgid "Continue building"
msgstr "Продолжить сборку"
#: lazarusidestrconsts.liscontinuewithoutloadingform
msgid "Continue without loading form"
msgstr "Продолжить, не загружая форму"
#: lazarusidestrconsts.liscontributors
msgid "Contributors"
msgstr "Участники"
#: lazarusidestrconsts.liscontrolneedsparent
msgid "Control needs parent"
msgstr "Элемент управления требует \"родителя\""
#: lazarusidestrconsts.lisconvaddcommentafterreplacement
msgid "Add comment after replacement"
msgstr "Добавлять комментарий при замене"
#: lazarusidestrconsts.lisconvaddedmodedelphimodifier
msgid "Added MODE Delphi syntax modifier after unit name."
msgstr "После имени модуля добавлена директива MODE Delphi."
#: lazarusidestrconsts.lisconvaddingflagforregister
#, object-pascal-format
msgid "Adding flag for \"Register\" procedure in unit %s."
msgstr "Добавление флага наличия процедуры \"Register\" в модуле %s."
#: lazarusidestrconsts.lisconvbracketmissingfromreplfunc
#, object-pascal-format
msgid "\")\" is missing from replacement function: %s"
msgstr "\")\" отсутствует в заменяющей функции: %s"
#: lazarusidestrconsts.lisconvbracketnotfound
msgid "Bracket not found"
msgstr "Скобка не найдена"
#: lazarusidestrconsts.lisconvconvertedfrom
#, object-pascal-format
msgid " { *Converted from %s* }"
msgstr " { *Преобразовано из %s* }"
#: lazarusidestrconsts.lisconvcoordhint
msgid "An offset is added to Top coordinate of controls inside visual containers"
msgstr "Добавление смещения к координатам виджетов внутри визуальных контейнеров"
#: lazarusidestrconsts.lisconvcoordoffs
msgid "Coordinate offsets"
msgstr "Смещения координат"
#: lazarusidestrconsts.lisconvdeletedfile
#, object-pascal-format
msgid "Deleted file %s"
msgstr "Удалён файл %s"
#: lazarusidestrconsts.lisconvdelphiaddedcustomoptiondefines
#, object-pascal-format
msgid "Added defines %s in custom options"
msgstr "К параметрам пользователя добавлены определения %s"
#: lazarusidestrconsts.lisconvdelphiaddedpackagedependency
#, object-pascal-format
msgid "Added Package %s as a dependency."
msgstr "Пакет %s добавлен в качестве зависимости."
#: lazarusidestrconsts.lisconvdelphiaddedunittousessection
#, object-pascal-format
msgid "Added unit \"%s\" to uses section."
msgstr "Модуль \"%s\" добавлен в выражение Uses."
#: lazarusidestrconsts.lisconvdelphiallsubdirsscanned
msgctxt "lazarusidestrconsts.lisconvdelphiallsubdirsscanned"
msgid "All sub-directories will be scanned for unit files"
msgstr "Поиск файлов модулей будет производиться во всех подкаталогах"
#: lazarusidestrconsts.lisconvdelphibegincodetoolsfailed
msgid "BeginCodeTools failed!"
msgstr "Ошибка BeginCodeTools!"
#: lazarusidestrconsts.lisconvdelphicategories
msgid "Categories:"
msgstr "Категории:"
#: lazarusidestrconsts.lisconvdelphichangedencodingtoutf8
#, object-pascal-format
msgid "Changed encoding from %s to UTF-8"
msgstr "Кодировка изменена с %s на UTF-8"
#: lazarusidestrconsts.lisconvdelphiconversionaborted
msgid "Conversion Aborted."
msgstr "Преобразование прервано."
#: lazarusidestrconsts.lisconvdelphiconversionready
msgid "Conversion Ready."
msgstr "Преобразование завершено."
#: lazarusidestrconsts.lisconvdelphiconversiontook
#, object-pascal-format
msgid "Conversion took: %s"
msgstr "Преобразование заняло: %s"
#: lazarusidestrconsts.lisconvdelphiconvertdelphipackage
msgid "Convert Delphi package"
msgstr "Преобразование пакета Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiproject
msgid "Convert Delphi project"
msgstr "Преобразование проекта Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertdelphiunit
msgid "Convert Delphi unit"
msgstr "Преобразование модуля Delphi"
#: lazarusidestrconsts.lisconvdelphiconvertingfoundunits
msgid "*** Converting unit files found during conversion ***"
msgstr "*** Преобразование вновь обнаруженных файлов модулей ***"
#: lazarusidestrconsts.lisconvdelphiconvertingprojpackunits
msgid "*** Converting unit files belonging to project/package ***"
msgstr "*** Преобразование файлов модулей, принадлежащих проекту/пакету ***"
#: lazarusidestrconsts.lisconvdelphierror
#, object-pascal-format
msgid "Error=\"%s\""
msgstr "Ошибка=\"%s\""
#: lazarusidestrconsts.lisconvdelphiexceptionduringconversion
msgid "Exception happened during unit conversion. Continuing with form files of already converted units..."
msgstr "Во время преобразования модулей возникло исключение. Работа продолжается с файлами форм уже преобразованных модулей..."
#: lazarusidestrconsts.lisconvdelphifailedconvertingunit
msgid "Failed converting unit"
msgstr "Не удалось преобразовать модуль"
#: lazarusidestrconsts.lisconvdelphifailedtoconvertunit
#, object-pascal-format
msgid "Failed to convert unit \"%s\""
msgstr "Не удалось преобразовать модуль \"%s\""
#: lazarusidestrconsts.lisconvdelphifixedunitcase
#, object-pascal-format
msgid "Fixed character case of unit \"%s\" to \"%s\"."
msgstr "Регистр имени модуля \"%s\" изменён. Новое имя: \"%s\"."
#: lazarusidestrconsts.lisconvdelphifoundallunitfiles
msgid "Found all unit files"
msgstr "Найдены все файлы модулей"
#: lazarusidestrconsts.lisconvdelphifunc
msgid "Delphi Function"
msgstr "Функция Delphi"
#: lazarusidestrconsts.lisconvdelphimissingincludefile
#, object-pascal-format
msgid "%s(%s,%s) missing include file"
msgstr "%s(%s,%s) отсутствует включаемый файл"
#: lazarusidestrconsts.lisconvdelphiname
msgid "Delphi Name"
msgstr "Имя Delphi"
#: lazarusidestrconsts.lisconvdelphipackagenameexists
msgid "Package name exists"
msgstr "Имя пакета уже существует"
#: lazarusidestrconsts.lisconvdelphipackagerequired
#, object-pascal-format
msgid "Package %s is required but not installed in Lazarus! Install it later."
msgstr "Пакет %s требуется, но не установлен в Lazarus! Установите его при первой возможности."
#: lazarusidestrconsts.lisconvdelphiprojomittedunit
#, object-pascal-format
msgid "Omitted unit %s from project"
msgstr "Модуль %s не включён в проект"
#: lazarusidestrconsts.lisconvdelphiremovedunitfromusessection
#, object-pascal-format
msgid "Removed unit \"%s\" from uses section."
msgstr "Модуль \"%s\" удалён из выражения Uses."
#: lazarusidestrconsts.lisconvdelphirepairingformfiles
msgid "*** Fixing used units and Repairing form files ***"
msgstr "*** Исправление списков используемых модулей и файлов форм ***"
#: lazarusidestrconsts.lisconvdelphireplacedunitinusessection
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisconvdelphireplacedunitinusessection"
msgid "Replaced unit \"%s\" with \"%s\" in uses section."
msgstr "Модуль \"%s\" в выражении Uses заменён на \"%s\"."
#: lazarusidestrconsts.lisconvdelphithereisalreadyapackagewiththenamepleaseclosethispa
#, object-pascal-format
msgid "There is already a package with the name \"%s\"%sPlease close this package first."
msgstr "Пакет с именем \"%s\" уже имеется.%sСначала закройте его."
#: lazarusidestrconsts.lisconvdelphiunitnameexistsinlcl
msgid "Unitname exists in LCL"
msgstr "Модуль с таким именем имеется в LCL"
#: lazarusidestrconsts.lisconvdelphiunitstoreplacein
#, object-pascal-format
msgid "Units to replace in %s"
msgstr "Модули для замены в %s"
#: lazarusidestrconsts.lisconvdelphiunitwithnameexistsinlcl
#, object-pascal-format
msgid "LCL already has a unit with name %s. Delete local file %s?"
msgstr "В LCL уже имеется модуль с именем %s. Удалить локальный файл %s?"
#: lazarusidestrconsts.lisconvdprojfilenotsupportedyet
msgid ".dproj file is not supported yet. The file is used by Delphi 2007 and newer. Please select a .dpr file for projects or .dpk file for packages."
msgstr "Файл .dproj в настоящее время не поддерживается. Он используется в Delphi 2007 и новее. Выберите файл .dpr для проектов либо .dpk для пакетов."
#: lazarusidestrconsts.lisconversionerror
msgid "Conversion error"
msgstr "Ошибка преобразования"
#: lazarusidestrconsts.lisconvert
msgid "Convert"
msgstr "Преобразовать"
#: lazarusidestrconsts.lisconvertencoding
msgid "Convert Encoding"
msgstr "Преобразование кодировки"
#: lazarusidestrconsts.lisconvertencodingofprojectspackages
msgid "Convert encoding of projects/packages"
msgstr "Преобразовать кодировку проектов/пакетов"
#: lazarusidestrconsts.lisconvertotherhint
msgid "Other options affecting the conversion"
msgstr "Прочие параметры, влияющие на преобразование"
#: lazarusidestrconsts.lisconvertprojectorpackage
msgid "Convert project or package"
msgstr "Преобразование проекта либо пакета"
#: lazarusidestrconsts.lisconverttarget
msgid "Target"
msgstr "Цель"
#: lazarusidestrconsts.lisconverttargetcrossplatform
msgid "Cross-platform"
msgstr "Кроссплатформенность"
#: lazarusidestrconsts.lisconverttargetcrossplatformhint
msgid "Cross-platform versus Windows-only"
msgstr "Обеспечить кроссплатформенность или привязать к Windows"
#: lazarusidestrconsts.lisconverttargethint
msgid "Converter adds conditional compilation to support different targets"
msgstr "Добавление директив условной компиляции для поддержки различных целей"
#: lazarusidestrconsts.lisconverttargetsamedfmfile
msgid "Use the same DFM form file"
msgstr "Совместное использование файла формы DFM"
#: lazarusidestrconsts.lisconverttargetsamedfmfilehint
msgid "Same DFM file for Lazarus and Delphi instead of copying it to LFM"
msgstr "Использовать файл DFM совместно для Lazarus и Delphi, не копируя его содержимое в файл LFM"
#: lazarusidestrconsts.lisconverttargetsupportdelphi
msgid "Support Delphi"
msgstr "Поддержка Delphi"
#: lazarusidestrconsts.lisconverttargetsupportdelphihint
msgid "Use conditional compilation to support Delphi"
msgstr "Использовать условную компиляцию для обеспечения поддержки Delphi"
#: lazarusidestrconsts.lisconvfixedunitname
#, object-pascal-format
msgid "Fixed unit name from %s to %s."
msgstr "Имя модуля %s исправлено на %s."
#: lazarusidestrconsts.lisconvfuncreplacements
msgid "Function Replacements"
msgstr "Замена функций"
#: lazarusidestrconsts.lisconvfuncreplhint
msgctxt "lazarusidestrconsts.lisconvfuncreplhint"
msgid "Some Delphi functions can be replaced with LCL function"
msgstr "Некоторые функции Delphi могут быть заменены функциями LCL"
#: lazarusidestrconsts.lisconvfuncstoreplace
msgid "Functions / procedures to replace"
msgstr "Заменяемые функции/процедуры"
#: lazarusidestrconsts.lisconvleftoff
msgid "Left offset"
msgstr "Смещение слева"
#: lazarusidestrconsts.lisconvnewname
msgid "New Name"
msgstr "Новое имя"
#: lazarusidestrconsts.lisconvparentcontainer
msgid "Parent Container"
msgstr "Родительский контейнер"
#: lazarusidestrconsts.lisconvproblemsfindingallunits
#, object-pascal-format
msgid "Problems when trying to find all units from project file %s"
msgstr "Не удалось найти все модули для файла проекта %s"
#: lazarusidestrconsts.lisconvproblemsfixingincludefile
#, object-pascal-format
msgid "Problems when fixing include files in file %s"
msgstr "Не удалось исправить включаемые файлы в %s"
#: lazarusidestrconsts.lisconvproblemsrepairingformfile
#, object-pascal-format
msgid "Problems when repairing form file %s"
msgstr "Не удалось исправить файл формы %s"
#: lazarusidestrconsts.lisconvrepairingincludefiles
msgid "Repairing include files : "
msgstr "Исправление включаемых файлов: "
#: lazarusidestrconsts.lisconvreplacedcall
#, object-pascal-format
msgid "Replaced call %s with %s"
msgstr "Вызов %s заменён на %s"
#: lazarusidestrconsts.lisconvreplfuncparameternum
#, object-pascal-format
msgid "Replacement function parameter number should be >= 1: %s"
msgstr "Количество параметров заменяющей функции не должно быть меньше единицы: %s"
#: lazarusidestrconsts.lisconvshouldbefollowedbynumber
#, object-pascal-format
msgid "\"$\" should be followed by a number: %s"
msgstr "За \"$\" должно следовать число: %s"
#: lazarusidestrconsts.lisconvstoppedbecausethereispackage
msgid "Stopped because there already is a package with the same name"
msgstr "Остановлено, так как пакет с таким же именем уже имеется"
#: lazarusidestrconsts.lisconvthislogwassaved
#, object-pascal-format
msgid "This log was saved to %s"
msgstr "Журнал был сохранён в %s"
#: lazarusidestrconsts.lisconvtopoff
msgid "Top offset"
msgstr "Смещение сверху"
#: lazarusidestrconsts.lisconvtypereplacements
msgid "Type Replacements"
msgstr "Замена типов"
#: lazarusidestrconsts.lisconvtypereplhint
msgid "Unknown types in form file (DFM/LFM)"
msgstr "Неизвестные типы в файле формы (DFM/LFM)"
#: lazarusidestrconsts.lisconvtypestoreplace
msgid "Types to replace"
msgstr "Заменяемые типы"
#: lazarusidestrconsts.lisconvunitreplacements
msgid "Unit Replacements"
msgstr "Замена модулей"
#: lazarusidestrconsts.lisconvunitreplhint
msgid "Unit names in uses section of a source unit"
msgstr "Имена модулей в выражении Uses исходного модуля"
#: lazarusidestrconsts.lisconvunitstoreplace
msgid "Units to replace"
msgstr "Заменяемые модули"
#: lazarusidestrconsts.lisconvunknownprops
msgid "Unknown properties"
msgstr "Неизвестные свойства"
#: lazarusidestrconsts.lisconvuserselectedtoendconversion
#, object-pascal-format
msgid "User selected to end conversion with file %s"
msgstr "Пользователь запросил завершение преобразования на файле %s"
#: lazarusidestrconsts.liscoolbaraddconfigdelete
msgid "Add/Config/Delete Toolbar(s)"
msgstr "Добавление/настройка/удаление инструментальных панелей"
#: lazarusidestrconsts.liscoolbaradddivider
msgid "Add Divider"
msgstr "Добавить разделитель"
#: lazarusidestrconsts.liscoolbaraddselected
msgid "Add selected item to toolbar"
msgstr "Добавить выбранный элемент на панель"
#: lazarusidestrconsts.liscoolbaravailablecommands
msgid "Available commands"
msgstr "Доступные команды"
#: lazarusidestrconsts.liscoolbarborderstyle
msgid "Toolbars border style"
msgstr "Граница инструментальной панели"
#: lazarusidestrconsts.liscoolbarborderstyleitem0
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem0"
msgid "None"
msgstr "Нет"
#: lazarusidestrconsts.liscoolbarborderstyleitem1
msgctxt "lazarusidestrconsts.liscoolbarborderstyleitem1"
msgid "Single"
msgstr "Одинарная"
#: lazarusidestrconsts.liscoolbarcodeexplorer
msgctxt "lazarusidestrconsts.liscoolbarcodeexplorer"
msgid "Code Explorer"
msgstr "Обозреватель кода"
#: lazarusidestrconsts.liscoolbarcodetemplates
msgctxt "lazarusidestrconsts.liscoolbarcodetemplates"
msgid "Code Templates"
msgstr "Шаблоны кода"
#: lazarusidestrconsts.liscoolbarconfigure
msgid "&Configure"
msgstr "&Настроить"
#: lazarusidestrconsts.liscoolbardeletetoolbar
msgid "Are you sure you want to delete the selected toolbar?"
msgstr "Вы действительно хотите удалить эту панель?"
#: lazarusidestrconsts.liscoolbardeletewarning
msgid "There must be at least one toolbar!"
msgstr "Должна иметься хотя бы одна панель!"
#: lazarusidestrconsts.liscoolbardesigner
msgid "Designer"
msgstr "Дизайнер"
#: lazarusidestrconsts.liscoolbargeneralsettings
msgid "General Coolbar Settings"
msgstr "Общие параметры инструментальных панелей"
#: lazarusidestrconsts.liscoolbargrabstyle
msgid "Toolbars grab style"
msgstr "Стиль узла захвата"
#: lazarusidestrconsts.liscoolbargrabstyleitem0
msgid "Simple"
msgstr "Простой"
#: lazarusidestrconsts.liscoolbargrabstyleitem1
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem1"
msgid "Double"
msgstr "Двойной"
#: lazarusidestrconsts.liscoolbargrabstyleitem2
msgid "HorLines"
msgstr "Горизонтальные линии"
#: lazarusidestrconsts.liscoolbargrabstyleitem3
msgid "VerLines"
msgstr "Вертикальные линии"
#: lazarusidestrconsts.liscoolbargrabstyleitem4
msgid "Gripper"
msgstr "Рельефный"
#: lazarusidestrconsts.liscoolbargrabstyleitem5
msgctxt "lazarusidestrconsts.liscoolbargrabstyleitem5"
msgid "Button"
msgstr "Кнопка"
#: lazarusidestrconsts.liscoolbargrabwidth
msgid "Grab width"
msgstr "Ширина"
#: lazarusidestrconsts.liscoolbaridemainmenu
msgid "IDE Main Menu"
msgstr "Главное меню IDE"
#: lazarusidestrconsts.liscoolbarmessages
msgctxt "lazarusidestrconsts.liscoolbarmessages"
msgid "Messages"
msgstr "Сообщения"
#: lazarusidestrconsts.liscoolbarmoveselecteddown
msgid "Move selected toolbar item down"
msgstr "Переместить выбранный элемент вниз"
#: lazarusidestrconsts.liscoolbarmoveselectedup
msgid "Move selected toolbar item up"
msgstr "Переместить выбранный элемент вверх"
#: lazarusidestrconsts.liscoolbaroptions
msgid "IDE CoolBar"
msgstr "Инструментальные панели IDE"
#: lazarusidestrconsts.liscoolbarpackageeditor
msgid "Package Editor"
msgstr "Редактор пакетов"
#: lazarusidestrconsts.liscoolbarpackageeditorfiles
msgid "Package Editor Files"
msgstr "Файлы в редакторе пакетов"
#: lazarusidestrconsts.liscoolbarremoveselected
msgid "Remove selected item from toolbar"
msgstr "Удалить выбранный элемент с панели"
#: lazarusidestrconsts.liscoolbarrestoredefaults
msgid "Restore defaults"
msgstr "Сбросить"
#: lazarusidestrconsts.liscoolbarselecttoolbar
msgid "Please select a toolbar first!"
msgstr "Сначала выберите панель!"
#: lazarusidestrconsts.liscoolbarsourceeditor
msgctxt "lazarusidestrconsts.liscoolbarsourceeditor"
msgid "Source Editor"
msgstr "Редактор исходного кода"
#: lazarusidestrconsts.liscoolbarsourcetab
msgid "Source Tab"
msgstr "Вкладка редактора исходного кода"
#: lazarusidestrconsts.liscoolbartoolbarcommands
msgid "Toolbar commands"
msgstr "Элементы панели"
#: lazarusidestrconsts.liscoolbarvisible
msgid "Coolbar is &visible"
msgstr "&Показывать инструментальные панели"
#: lazarusidestrconsts.liscoolbarwidth
msgid "Coolbar width"
msgstr "Ширина панели"
#: lazarusidestrconsts.liscopyallitemstoclipboard
msgid "Copy All Items to Clipboard"
msgstr "Копировать все строки в буфер обмена"
#: lazarusidestrconsts.liscopyalloriginalmessagestoclipboard
msgid "Copy All/Original Messages to Clipboard"
msgstr "Копировать все/исходные сообщения в буфер обмена"
#: lazarusidestrconsts.liscopyallshownmessagestoclipboard
msgid "Copy All Shown Messages to Clipboard"
msgstr "Копировать все показанные сообщения в буфер обмена"
#: lazarusidestrconsts.liscopydescription
msgid "Copy description to clipboard"
msgstr "Копировать описание в буфер обмена"
#: lazarusidestrconsts.liscopyerror2
msgid "Copy error"
msgstr "Ошибка копирования"
#: lazarusidestrconsts.liscopyfilename
#, object-pascal-format
msgid "Copy Filename %s"
msgstr "Копировать имя файла %s"
#: lazarusidestrconsts.liscopyfilenametoclipboard
msgid "Copy File Name to Clipboard"
msgstr "Копировать имя файла в буфер обмена"
#: lazarusidestrconsts.liscopyfilesfailed
msgid "Copying files failed."
msgstr "Не удалось скопировать файлы."
#: lazarusidestrconsts.liscopyidentifier
#, object-pascal-format
msgid "Copy \"%s\" to clipboard"
msgstr "Копировать \"%s\" в буфер обмена"
#: lazarusidestrconsts.liscopyingawholeformisnotimplemented
msgid "Copying a whole form is not implemented."
msgstr "Копирование всей формы не реализовано."
#: lazarusidestrconsts.liscopyitemtoclipboard
msgid "Copy Item to Clipboard"
msgstr "Копировать строку в буфер обмена"
#: lazarusidestrconsts.liscopymovefiletodirectory
msgid "Copy/Move File to Directory"
msgstr "Копировать/переместить файл в каталог"
#: lazarusidestrconsts.liscopyselecteditemtoclipboard
msgid "Copy Selected Items to Clipboard"
msgstr "Копировать выделенные строки в буфер обмена"
#: lazarusidestrconsts.liscopyselectedmessagestoclipboard
msgid "Copy Selected Messages to Clipboard"
msgstr "Копировать выделенные сообщения в буфер обмена"
#: lazarusidestrconsts.liscoscanforfpcmessages
msgid "Scan for FPC messages"
msgstr "Искать сообщения FPC"
#: lazarusidestrconsts.liscoscanformakemessages
msgid "Scan for Make messages"
msgstr "Искать сообщения Make"
#: lazarusidestrconsts.liscoskipcallingcompiler
msgid "Skip calling compiler"
msgstr "Пропустить вызов компилятора"
#: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena
msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the Free Pascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config."
msgstr "Внимание: дополнительный файл настройки компилятора имеет то же имя, что и один из стандартных файлов настройки компилятора Free Pascal. Это приведёт к использованию дополнительного файла и пропуску стандартного."
#: lazarusidestrconsts.liscpopenpackage
#, object-pascal-format
msgid "Open Package %s"
msgstr "Открыть пакет %s"
#: lazarusidestrconsts.liscpopenunit
#, object-pascal-format
msgid "Open Unit %s"
msgstr "Открыть модуль %s"
#: lazarusidestrconsts.liscpu
#, object-pascal-format
msgid ", CPU: %s"
msgstr ", процессор: %s"
#: lazarusidestrconsts.liscreateandedit
msgid "Create and edit"
msgstr "Создать и редактировать"
#: lazarusidestrconsts.liscreateaprojectfirst
msgid "Create a project first!"
msgstr "Сначала необходимо создать проект!"
#: lazarusidestrconsts.liscreatedebugandreleasemodes
msgid "Create Debug and Release modes"
msgstr "Создать режимы отладочной и конечной сборки"
#: lazarusidestrconsts.liscreatedirectory
msgid "Create directory?"
msgstr "Создать каталог?"
#: lazarusidestrconsts.liscreatefilter
msgid "Create Filter"
msgstr "Создание фильтра"
#: lazarusidestrconsts.liscreatefppkgconfig
msgid "Restore Fppkg configuration"
msgstr "Восстановить файлы настройки Fppkg"
#: lazarusidestrconsts.liscreatefunction
msgid "Create function"
msgstr "Создать функцию"
#: lazarusidestrconsts.liscreatehelpnode
msgid "Create Help node"
msgstr "Создать элемент справки"
#: lazarusidestrconsts.liscreateit
msgid "Create it"
msgstr "Создать его"
#: lazarusidestrconsts.liscreatelocalvariable
#, object-pascal-format
msgid "Create local variable \"%s\""
msgstr "Создать локальную переменную \"%s\""
#: lazarusidestrconsts.liscreatenewaddition
msgid "Create new addition"
msgstr "Создать новое дополнение"
#: lazarusidestrconsts.liscreatenewpackage
msgid "(Create new package)"
msgstr "(Создать новый пакет)"
#: lazarusidestrconsts.liscreatenewpackagecomponent
msgid "Create new package component"
msgstr "Создать новый компонент пакета"
#: lazarusidestrconsts.liscreateproject
msgid "Create project"
msgstr "Создать проект"
#: lazarusidestrconsts.liscreateupdatepofilewhensavingalfmfile
msgid "Create/update .po file when saving a lfm file"
msgstr "Создавать/обновлять файлы PO при сохранении файла LFM"
#: lazarusidestrconsts.liscreatingfileindexoffpcsources
#, object-pascal-format
msgid "Creating file index of FPC sources %s ..."
msgstr "Создание индекса файлов исходного кода FPC %s ..."
#: lazarusidestrconsts.lisctdefchoosedirectory
msgid "Choose Directory"
msgstr "Выберите каталог"
#: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues
msgid "CodeTools Directory Values"
msgstr "Параметры каталогов CodeTools"
#: lazarusidestrconsts.lisctdefdefinetemplates
msgid "Define templates"
msgstr "Задать шаблоны"
#: lazarusidestrconsts.lisctdefnovariableselected
msgid "<no variable selected>"
msgstr "<Не выбрано переменных>"
#: lazarusidestrconsts.lisctdefsopenpreview
msgid "Open Preview"
msgstr "Открыть предпросмотр"
#: lazarusidestrconsts.lisctdefstools
msgid "Tools"
msgstr "Средства"
#: lazarusidestrconsts.lisctdefvariable
#, object-pascal-format
msgid "Variable: %s"
msgstr "Переменная: %s"
#: lazarusidestrconsts.lisctdefvariablename
msgid "Variable Name"
msgstr "Имя переменной"
#: lazarusidestrconsts.lisctdtemplates
msgid "Templates"
msgstr "Шаблоны"
#: lazarusidestrconsts.lisctoupdateallmethodsignatures
msgid "Update all method signatures"
msgstr "Обновлять все сигнатуры методов"
#: lazarusidestrconsts.lisctoupdatemultipleproceduresignatures
msgid "Update multiple procedure signatures"
msgstr "Обновлять все подходящие сигнатуры процедур"
#: lazarusidestrconsts.lisctpleaseselectamacro
msgid "please select a macro"
msgstr "Выберите макрос"
#: lazarusidestrconsts.lisctselectcodemacro
msgid "Select Code Macro"
msgstr "Выбрать макрос кода"
#: lazarusidestrconsts.liscurrentlclwidgetset
#, object-pascal-format
msgid "Current LCL widgetset: \"%s\""
msgstr "Текущая библиотека виджетов LCL: \"%s\""
#: lazarusidestrconsts.liscurrentstate
msgid "Current state: "
msgstr "Текущее состояние: "
#: lazarusidestrconsts.liscursorcolumnincurrenteditor
msgid "Cursor column in current editor"
msgstr "Номер столбца под курсором в текущем редакторе"
#: lazarusidestrconsts.liscursorrowincurrenteditor
msgid "Cursor row in current editor"
msgstr "Номер строки под курсором в текущем редакторе"
#: lazarusidestrconsts.liscustomopthint
msgid "These options are passed to the compiler after macros are replaced."
msgstr "Эти параметры передаются компилятору после замены макросов."
#: lazarusidestrconsts.liscustomoptions
msgid "custom options"
msgstr "параметры пользователя"
#: lazarusidestrconsts.liscustomoptions2
msgid "Custom options"
msgstr "Параметры пользователя"
#: lazarusidestrconsts.liscustomoptions3
msgid "Custom Options"
msgstr "Параметры пользователя"
#: lazarusidestrconsts.liscustomprogram
msgid "Custom Program"
msgstr "Программа пользователя"
#: lazarusidestrconsts.liscustomprogramprogramdescriptor
msgid "A Custom Free Pascal program."
msgstr "Пользовательская программа на Free Pascal."
#: lazarusidestrconsts.lisdatamodule
msgid "Data Module"
msgstr "Модуль данных"
#: lazarusidestrconsts.lisdbgenbreakpointevaluation
msgid "Breakpoint Evaluation"
msgstr "Вычисление выражения точки останова"
#: lazarusidestrconsts.lisdbgenbreakpointhit
msgid "Breakpoint Hit"
msgstr "Достижение точки останова"
#: lazarusidestrconsts.lisdbgenbreakpointmessage
msgid "Breakpoint Message"
msgstr "Сообщение точки останова"
#: lazarusidestrconsts.lisdbgenbreakpointstackdump
msgid "Breakpoint Stack Dump"
msgstr "Вывод стека для точки останова"
#: lazarusidestrconsts.lisdbgendefaultcolor
msgid "Default Color"
msgstr "Цвет по умолчанию"
#: lazarusidestrconsts.lisdbgenexceptionraised
msgid "Exception Raised"
msgstr "Вызов исключения"
#: lazarusidestrconsts.lisdbgenmoduleload
msgid "Module Load"
msgstr "Загрузка модуля"
#: lazarusidestrconsts.lisdbgenmoduleunload
msgid "Module Unload"
msgstr "Выгрузка модуля"
#: lazarusidestrconsts.lisdbgenoutputdebugstring
msgid "Output Debug String"
msgstr "Вывод строки отладки"
#: lazarusidestrconsts.lisdbgenprocessexit
msgid "Process Exit"
msgstr "Выход из процесса"
#: lazarusidestrconsts.lisdbgenprocessstart
msgid "Process Start"
msgstr "Запуск процесса"
#: lazarusidestrconsts.lisdbgenthreadexit
msgid "Thread Exit"
msgstr "Выход из потока исполнения"
#: lazarusidestrconsts.lisdbgenthreadstart
msgid "Thread Start"
msgstr "Запуск потока исполнения"
#: lazarusidestrconsts.lisdbgenwindowsmessageposted
msgid "Windows Message Posted"
msgstr "Размещение сообщения Windows"
#: lazarusidestrconsts.lisdbgenwindowsmessagesent
msgid "Windows Message Sent"
msgstr "Отправка сообщения Windows"
#: lazarusidestrconsts.lisdbgmangnodebuggerspecified
msgid "No debugger specified"
msgstr "Отладчик не указан"
#: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway
msgid "Set the breakpoint anyway"
msgstr "Установить точку останова всё равно"
#: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno
#, object-pascal-format
msgid "There is no debugger specified.%sSetting breakpoints have no effect until you set up a Debugger in the debugger options dialog in the menu."
msgstr "Не указан отладчик.%sТочки останова не будут иметь эффекта, пока вы не настроите отладчик в диалоге его параметров."
#: lazarusidestrconsts.lisdebug
msgctxt "lazarusidestrconsts.lisdebug"
msgid "Debug"
msgstr "Отладочное"
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaks
msgid "Confirm to delete all Breakpoints"
msgstr "Подтверждать удаление всех точек останова"
#: lazarusidestrconsts.lisdebugdialogconfirmdelbreaksfile
msgid "Confirm to delete Breakpoints in same file"
msgstr "Подтверждать удаление точек останова в том же файле"
#: lazarusidestrconsts.lisdebugdialogconfirmdelhistory
msgid "Confirm to clear History"
msgstr "Подтверждать очистку истории"
#: lazarusidestrconsts.lisdebugdialogconfirmdelwatches
msgid "Confirm to delete all Watches"
msgstr "Подтверждать удаление всех наблюдений"
#: lazarusidestrconsts.lisdebugger
msgctxt "lazarusidestrconsts.lisdebugger"
msgid "Debugger"
msgstr "Отладчик"
#: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate
#, object-pascal-format
msgid "The debugger encountered an internal error.%0:s%0:sSave your work.%0:sYou may then hit \"Stop\", or \"Reset debugger\" to terminate the debug session."
msgstr "Произошла внутренняя ошибка отладчика.%0:s%0:sСохраните свои данные.%0:sЗатем можно нажать \"Стоп\" либо \"Сбросить отладчик\" для прекращения сеанса отладки."
#: lazarusidestrconsts.lisdebuggerinvalid
msgid "Debugger invalid"
msgstr "Неверный отладчик"
#: lazarusidestrconsts.lisdebugging
#, object-pascal-format
msgid "%s (debugging ...)"
msgstr "%s (идёт отладка ...)"
#: lazarusidestrconsts.lisdebughintautotypecastclass
msgid "Automatic typecast for objects"
msgstr "Автоматически выполнять приведение типов объектов"
#: lazarusidestrconsts.lisdebugoptionsfrmaddexception
msgid "Add Exception"
msgstr "Добавить исключение"
#: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath
msgid "Additional search path"
msgstr "Дополнительный путь поиска"
#: lazarusidestrconsts.lisdebugoptionsfrmallowfunctioncalls
msgid "BETA: Allow function calls in watches (if supported by backend)"
msgstr "БЕТА: разрешить вызовы функций в наблюдениях (если поддерживает механизм отладки)"
#: lazarusidestrconsts.lisdebugoptionsfrmautocloseasm
msgid "Automatically close the assembler window, after source not found"
msgstr "Автоматически закрывать окно ассемблера при необнаружении исходного кода"
#: lazarusidestrconsts.lisdebugoptionsfrmautoinstanceclass
msgid "Automatically set \"use instance class type\" for new watches"
msgstr "Автоматически устанавливать параметр \"использовать тип экземпляра класса\" для новых наблюдений"
#: lazarusidestrconsts.lisdebugoptionsfrmbackend
msgid "Debugger backend"
msgstr "Механизм отладки"
#: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint
msgid "Breakpoint"
msgstr "Точка останова"
#: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun
msgid "Clear log on run"
msgstr "Очищать журнал при запуске"
#: lazarusidestrconsts.lisdebugoptionsfrmdebugger
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmdebugger"
msgid "Debugger"
msgstr "Отладчик"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerbackend
msgid "Debugger Backend:"
msgstr "Механизм отладки:"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerdialogsettings
msgid "Debugger dialogs"
msgstr "Диалоговые окна отладчика"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions
msgid "Debugger general options"
msgstr "Общие параметры отладчика"
#: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific
msgid "Debugger specific options (depends on type of debugger)"
msgstr "Частные параметры отладчика (зависят от типа отладчика)"
#: lazarusidestrconsts.lisdebugoptionsfrmdialogstofront
msgid "Always bring debug-windows (watches, locals) to front when adding items"
msgstr "Всегда помещать окна отладки (списки наблюдений и локальных переменных) спереди при добавлении элементов"
#: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname
msgid "Duplicate Exception name"
msgstr "Имя исключения уже существует"
#: lazarusidestrconsts.lisdebugoptionsfrmeditclass
msgid "Change type"
msgstr "Изменить тип"
#: lazarusidestrconsts.lisdebugoptionsfrmeditclasswarn
msgid "Changing the type for the current debugger backend. Use \"Add\" or \"Copy\" to create a new backend with a new type."
msgstr "Изменение типа для текущего механизма отладки. Нажмите \"Добавить\" либо \"Копировать\" для создания другого механизма отладки с новым типом."
#: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname
msgid "Enter the name of the exception"
msgstr "Введите имя исключения"
#: lazarusidestrconsts.lisdebugoptionsfrmeventlog
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmeventlog"
msgid "Event Log"
msgstr "Журнал событий"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledby
msgid "Handled by"
msgstr "Обрабатывается"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger
msgid "Handled by Debugger"
msgstr "Обрабатывается отладчиком"
#: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram
msgid "Handled by Program"
msgstr "Обрабатывается программой"
#: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions
msgid "Ignore these exceptions"
msgstr "Игнорировать эти исключения"
#: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions
msgid "Language Exceptions"
msgstr "Исключения языка"
#: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto
msgid "Limit line count to"
msgstr "Ограничить число строк"
#: lazarusidestrconsts.lisdebugoptionsfrmmodule
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmmodule"
msgid "Module"
msgstr "Модуль"
#: lazarusidestrconsts.lisdebugoptionsfrmname
msgctxt "lazarusidestrconsts.lisdebugoptionsfrmname"
msgid "Name:"
msgstr "Имя:"
#: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions
msgid "Notify on Exceptions"
msgstr "Уведомлять об исключениях"
#: lazarusidestrconsts.lisdebugoptionsfrmosexceptions
msgid "OS Exceptions"
msgstr "Исключения ОС"
#: lazarusidestrconsts.lisdebugoptionsfrmoutput
msgid "Output"
msgstr "Вывод"
#: lazarusidestrconsts.lisdebugoptionsfrmprocess
msgid "Process"
msgstr "Процесс"
#: lazarusidestrconsts.lisdebugoptionsfrmresetdebuggeroneachrun
msgid "Reset Debugger after each run"
msgstr "Сбрасывать отладчик после каждого запуска"
#: lazarusidestrconsts.lisdebugoptionsfrmshowexitcodeonstop
msgid "Show message on stop with Error (Exit-code <> 0)"
msgstr "Показывать сообщение при остановке с ошибкой (код выхода не равен нулю)"
#: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop
msgid "Show message on stop"
msgstr "Показывать сообщение при остановке"
#: lazarusidestrconsts.lisdebugoptionsfrmsignals
msgid "Signals"
msgstr "Сигналы"
#: lazarusidestrconsts.lisdebugoptionsfrmthread
msgid "Thread"
msgstr "Поток исполнения"
#: lazarusidestrconsts.lisdebugoptionsfrmunknowndebuggerbacke
#, object-pascal-format
msgid "Unknown Debugger backend \"%s\""
msgstr "Механизм отладки \"%s\" неизвестен"
#: lazarusidestrconsts.lisdebugoptionsfrmuseeventlogcolors
msgid "Use event log colors"
msgstr "Включить цвета журнала событий"
#: lazarusidestrconsts.lisdebugoptionsfrmuseidedebugger
msgid "-- Use IDE default Debugger --"
msgstr "-- Использовать отладчик IDE по умолчанию --"
#: lazarusidestrconsts.lisdebugoptionsfrmuseprojectdebugger
msgid "-- Use project Debugger --"
msgstr "-- Использовать отладчик проекта --"
#: lazarusidestrconsts.lisdebugoptionsfrmwindows
msgid "Windows"
msgstr "Окна"
#: lazarusidestrconsts.lisdebugunabletoloadfile
msgid "Unable to load file"
msgstr "Невозможно загрузить файл"
#: lazarusidestrconsts.lisdebugunabletoloadfile2
#, object-pascal-format
msgid "Unable to load file \"%s\"."
msgstr "Невозможно загрузить файл \"%s\"."
#: lazarusidestrconsts.lisdefault
msgctxt "lazarusidestrconsts.lisdefault"
msgid "Default"
msgstr "По умолчанию"
#: lazarusidestrconsts.lisdefaultclassvisibilitysectionofnewmethodsforexampl
msgid "Default class visibility section of new methods. For example code completion on OnShow:="
msgstr "Секция видимости класса, выбираемая по умолчанию для новых методов. Например, используется при завершении кода вида OnShow:="
#: lazarusidestrconsts.lisdefaultiscomboboxwithtrueandfalse
msgid "The default is ComboBox with \"True\" and \"False\" selections"
msgstr "По умолчанию отображается раскрывающийся список с элементами \"True\" и \"False\""
#: lazarusidestrconsts.lisdefaultplaceholder
msgid "(default)"
msgstr "(по умолчанию)"
#: lazarusidestrconsts.lisdefaultsectionofmethods
msgid "Default section of methods"
msgstr "Секция по умолчанию для методов"
#: lazarusidestrconsts.lisdelayforcompletionbox
msgid "Delay for completion box"
msgstr "Задержка вывода окна автозавершения"
#: lazarusidestrconsts.lisdelayforcompletionlonglinehint
msgid "Delay for long line hints in completion box"
msgstr "Задержка вывода длинных подсказок в окне автозавершения"
#: lazarusidestrconsts.lisdelayforhints
msgid "Delay for hints"
msgstr "Задержка вывода подсказок"
#: lazarusidestrconsts.lisdelete2
msgid "Delete?"
msgstr "Удалить?"
#: lazarusidestrconsts.lisdeleteaddition
#, object-pascal-format
msgid "Delete addition \"%s\"?"
msgstr "Удалить справочное дополнение \"%s\"?"
#: lazarusidestrconsts.lisdeleteall
msgid "&Delete All"
msgstr "&Удалить все"
#: lazarusidestrconsts.lisdeleteallthesefiles
msgid "Delete all these files?"
msgstr "Удалить все эти файлы?"
#: lazarusidestrconsts.lisdeleteambiguousfile
msgid "Delete ambiguous file?"
msgstr "Удалить файл с дублирующимся именем?"
#: lazarusidestrconsts.lisdeletemacro
#, object-pascal-format
msgid "Delete macro \"%s\"?"
msgstr "Удалить макрос \"%s\"?"
#: lazarusidestrconsts.lisdeletemode
#, object-pascal-format
msgid "Delete mode \"%s\""
msgstr "Удалить режим \"%s\""
#: lazarusidestrconsts.lisdeleteoldfile
#, object-pascal-format
msgid "Delete old file \"%s\"?"
msgstr "Удалить старый файл \"%s\"?"
#: lazarusidestrconsts.lisdeleteselectedmacro
msgid "Delete selected macro?"
msgstr "Удалить выделенный макрос?"
#: lazarusidestrconsts.lisdeletethisaddition
msgid "Delete this addition"
msgstr "Удалить дополнение"
#: lazarusidestrconsts.lisdeletevalue
#, object-pascal-format
msgid "Delete value \"%s\"?"
msgstr "Удалить значение \"%s\"?"
#: lazarusidestrconsts.lisdeletevalue2
#, object-pascal-format
msgid "Delete value %s"
msgstr "Удалить значение %s"
#: lazarusidestrconsts.lisdelimiterissemicolon
msgid "Delimiter is semicolon."
msgstr "Разделителем является точка с запятой"
#: lazarusidestrconsts.lisdelphicompatibleresources
msgid "Delphi compatible resources. Recommended."
msgstr "Ресурсы, совместимые с Delphi. Рекомендуется использовать именно их."
#: lazarusidestrconsts.lisdesigntimepackagesaddcomponentsandmenuitemstotheid
msgid "\"Design time\" packages add components and menu items to the IDE. They can be used by projects but are not compiled into the project. The compiler will not find units of this package when compiling the project."
msgstr "Пакеты времени разработки добавляют компоненты и элементы меню в IDE. Они могут использоваться проектами, но не собираться с ними. Компилятор не найдёт модулей такого пакета при сборке проекта."
#: lazarusidestrconsts.lisdesktops
msgid "Desktops ..."
msgstr "Рабочие столы ..."
#: lazarusidestrconsts.lisdestinationdirectory
msgid "Destination directory"
msgstr "Каталог назначения"
#: lazarusidestrconsts.lisdestructorcode
msgid "Destructor code"
msgstr "Код деструктора"
#: lazarusidestrconsts.lisdfileswererenamedtol
#, object-pascal-format
msgid "%d files were renamed to lowercase."
msgstr "Файлы (%d шт.) переименованы в нижний регистр."
#: lazarusidestrconsts.lisdiffdlgcaseinsensitive
msgid "Case Insensitive"
msgstr "Игнорировать регистр"
#: lazarusidestrconsts.lisdiffdlgfile1
msgid "File1"
msgstr "Файл1"
#: lazarusidestrconsts.lisdiffdlgfile2
msgid "File2"
msgstr "Файл2"
#: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd
msgid "Ignore if empty lines were added or removed"
msgstr "Игнорировать добавление/удаление пустых строк"
#: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe
msgid "Ignore difference in line ends (e.g. #10 = #13#10)"
msgstr "Игнорировать разные концы строк (например, #10 = #13#10)"
#: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd
msgid "Ignore amount of space chars"
msgstr "Игнорировать количество пробелов"
#: lazarusidestrconsts.lisdiffdlgignorespaces
msgid "Ignore spaces (newline chars not included)"
msgstr "Игнорировать пробелы (без учёта символов перевода строки)"
#: lazarusidestrconsts.lisdiffdlgignorespacesatendofline
msgid "Ignore spaces at end of line"
msgstr "Игнорировать пробелы в конце строки"
#: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline
msgid "Ignore spaces at start of line"
msgstr "Игнорировать пробелы в начале строки"
#: lazarusidestrconsts.lisdiffdlgonlyselection
msgid "Only selection"
msgstr "Только выбранное"
#: lazarusidestrconsts.lisdiffdlgopendiffineditor
msgid "Open difference in editor"
msgstr "Открыть разницу в редакторе"
#: lazarusidestrconsts.lisdifferentunitfoundatnewposition
#, object-pascal-format
msgid "different unit %s found at new position \"%s\""
msgstr "найден отличающийся модуль %s по новому местонахождению \"%s\""
#: lazarusidestrconsts.lisdirectives
msgid "Directives"
msgstr "Директивы"
#: lazarusidestrconsts.lisdirectivesfornewunit
msgid "Directives for new unit"
msgstr "Директивы в новом модуле"
#: lazarusidestrconsts.lisdirectories
msgid "Directories"
msgstr "Каталоги"
#: lazarusidestrconsts.lisdirectory
msgid "Directory: "
msgstr "Каталог: "
#: lazarusidestrconsts.lisdirectorynotfound
#, object-pascal-format
msgid "Directory \"%s\" not found."
msgstr "Каталог \"%s\" не найден."
#: lazarusidestrconsts.lisdirectorynotfound2
#, object-pascal-format
msgid "directory %s not found"
msgstr "каталог %s не найден"
#: lazarusidestrconsts.lisdirectorywheretheideputsthepofiles
msgid "Directory where the IDE puts the .po files"
msgstr "Каталог, в котором IDE размещает файлы PO"
#: lazarusidestrconsts.lisdisablei18nforlfm
msgid "Disable I18N for LFM"
msgstr "Отключить i18n для LFM"
#: lazarusidestrconsts.lisdisableoptionxg
msgid "Disable Option -Xg?"
msgstr "Отключить параметр -Xg?"
#: lazarusidestrconsts.lisdisableoptionxg2
msgid "Disable option -Xg"
msgstr "Отключить параметр -Xg"
#: lazarusidestrconsts.lisdiscardchanges
msgid "Discard changes"
msgstr "Отбросить изменения"
#: lazarusidestrconsts.lisdiscardchangesall
msgid "Discard all changes"
msgstr "Отбросить все изменения"
#: lazarusidestrconsts.lisdiscardchangesandopenproject
msgid "Discard changes and open project"
msgstr "Отбросить изменения и открыть проект"
#: lazarusidestrconsts.lisdiscardchangesandquit
msgid "Discard changes and quit"
msgstr "Отбросить изменения и выйти"
#: lazarusidestrconsts.lisdiscardchangescreatenewproject
msgid "Discard changes, create new project"
msgstr "Отбросить изменения и создать новый проект"
#: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff
msgid "Click on one of the above items to see the diff"
msgstr "Выберите один из элементов выше, чтобы увидеть разницу"
#: lazarusidestrconsts.lisdiskdifferrorreadingfile
#, object-pascal-format
msgid "Error reading file: %s"
msgstr "Ошибка чтения файла: %s"
#: lazarusidestrconsts.lisdiskdiffignorealldiskchanges
msgid "Ignore all disk changes"
msgstr "Игнорировать все изменения на диске"
#: lazarusidestrconsts.lisdiskdiffreloadcheckedfilesfromdisk
msgid "Reload checked files from disk"
msgstr "Перечитать выбранные файлы с диска"
#: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk
msgid "Some files have changed on disk:"
msgstr "Некоторые файлы изменены на диске:"
#: lazarusidestrconsts.lisdiskdiffsomefileshavelocalchanges
msgid "Some files have local changes. Either local or external changes will be overwritten."
msgstr "Некоторые файлы были изменены локально. Будут отброшены локальные либо внешние изменения."
#: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda
msgid "Distinguish big and small letters e.g. A and a"
msgstr "Различать регистр букв, например, А и а"
#: lazarusidestrconsts.lisdlgalloptions
msgid "All options ..."
msgstr "Все параметры ..."
#: lazarusidestrconsts.lisdlgchangeclass
msgid "Change Class ..."
msgstr "Сменить класс ..."
#: lazarusidestrconsts.lisdlgdefines
msgid "Defines ..."
msgstr "Определения ..."
#: lazarusidestrconsts.lisdlgedit
msgctxt "lazarusidestrconsts.lisdlgedit"
msgid "Edit ..."
msgstr "Редактировать ..."
#: lazarusidestrconsts.lisdlgexport
msgctxt "lazarusidestrconsts.lisdlgexport"
msgid "Export ..."
msgstr "Экспортировать ..."
#: lazarusidestrconsts.lisdlgimport
msgctxt "lazarusidestrconsts.lisdlgimport"
msgid "Import ..."
msgstr "Импортировать ..."
#: lazarusidestrconsts.lisdlgmore
msgctxt "lazarusidestrconsts.lisdlgmore"
msgid "More ..."
msgstr "Прочие ..."
#: lazarusidestrconsts.lisdlgopen
msgctxt "lazarusidestrconsts.lisdlgopen"
msgid "Open ..."
msgstr "Открыть ..."
#: lazarusidestrconsts.lisdoesnotexists
#, object-pascal-format
msgid "%s does not exist: %s"
msgstr "%s не существует: %s"
#: lazarusidestrconsts.lisdonotchange
msgid "Do not change"
msgstr "В неизменном виде"
#: lazarusidestrconsts.lisdonotcheckifanotherideinstanceisalreadyrunning
msgid "Do not check if another IDE instance is already running."
msgstr "Не проверять, что другой экземпляр IDE уже запущен."
#: lazarusidestrconsts.lisdonotclosetheproject
msgid "Do not close the project"
msgstr "Не закрывать проект"
#: lazarusidestrconsts.lisdonotcompiledependencies
msgid "Do not compile dependencies."
msgstr "Не собирать зависимости."
#: lazarusidestrconsts.lisdonotshowsplashscreen
msgid "Do not show splash screen."
msgstr "Не показывать начальную заставку."
#: lazarusidestrconsts.lisdonotshowthisdialogforthisproject
msgid "Do not show this dialog for this project"
msgstr "Не показывать этот диалог для данного проекта"
#: lazarusidestrconsts.lisdonotshowthismessageagain
msgid "Do not show this message again"
msgstr "Больше не показывать это сообщение"
#: lazarusidestrconsts.lisdonotwriteupdatedprojectinfoafterbuild
msgid "Do not write updated project info file after build. If not specified, build number will be incremented if configured."
msgstr "Не записывать обновлённый файл сведений о проекте после сборки. Если параметр не указан, номер сборки будет наращиваться (если данная функция была включена)."
#: lazarusidestrconsts.lisdonwloadonlinepackages
#, object-pascal-format
msgid ""
"The following package(s) are not available locally: %s.\n"
"In order to install it, you must download them first. Download now?"
msgstr ""
"Следующие пакеты недоступны локально: %s.\n"
"Для установки их требуется загрузить. Сделать это сейчас?"
#: lazarusidestrconsts.lisdown
msgctxt "lazarusidestrconsts.lisdown"
msgid "Down"
msgstr "Вниз"
#: lazarusidestrconsts.lisdowngrade
msgid "Downgrade"
msgstr "Понизить версию"
#: lazarusidestrconsts.lisdowngradeconfiguration
msgid "Downgrade configuration"
msgstr "Понижение версии каталога настройки"
#: lazarusidestrconsts.lisdownload
msgid "Download"
msgstr "Загрузка"
#: lazarusidestrconsts.lisdoyoustillwanttocreatethenewproject
msgid "Do you still want to create the new project?"
msgstr "Вы действительно хотите создать новый проект?"
#: lazarusidestrconsts.lisdoyoustillwanttoopenanotherproject
msgid "Do you still want to open another project?"
msgstr "Вы действительно хотите открыть другой проект?"
#: lazarusidestrconsts.lisdoyoustillwanttoquit
msgid "Do you still want to quit?"
msgstr "Вы действительно хотите выйти?"
#: lazarusidestrconsts.lisdrawgridlinesobjectinspector
msgid "Draw grid lines"
msgstr "Отображать линии сетки"
#: lazarusidestrconsts.lisdrawtheselectionfocusedevenifthemessageswindowhasn
msgid "Draw the selection focused even if the Messages window has no focus. Use this if your theme has a hardly visible unfocused drawing."
msgstr "Отрисовывать выделенное как находящееся в фокусе даже если окно сообщений фокуса не имеет. Воспользуйтесь этой возможностью, если используемая тема оформления имеет плохо заметную отрисовку элементов не в фокусе."
#: lazarusidestrconsts.lisdropdowncount
msgid "Drop Down Count"
msgstr "Количество отображаемых элементов списка"
#: lazarusidestrconsts.lisdropdowncounthint
msgid "Used for all ComboBoxes in IDE dialogs"
msgstr "Используется для всех раскрывающихся списков в диалогах IDE"
#: lazarusidestrconsts.lisdsgcopycomponents
msgid "Copy selected components to clipboard"
msgstr "Копировать выбранные компоненты в буфер"
#: lazarusidestrconsts.lisdsgcutcomponents
msgid "Cut selected components to clipboard"
msgstr "Вырезать выбранные компоненты в буфер"
#: lazarusidestrconsts.lisdsgorderbackone
msgid "Move component one back"
msgstr "Переместить компонент на один назад"
#: lazarusidestrconsts.lisdsgorderforwardone
msgid "Move component one forward"
msgstr "Переместить компонент на один вперёд"
#: lazarusidestrconsts.lisdsgordermovetoback
msgid "Move component to back"
msgstr "Переместить компонент назад"
#: lazarusidestrconsts.lisdsgordermovetofront
msgid "Move component to front"
msgstr "Переместить компонент вперёд"
#: lazarusidestrconsts.lisdsgpastecomponents
msgid "Paste selected components from clipboard"
msgstr "Вставить выбранные компоненты из буфера"
#: lazarusidestrconsts.lisdsgselectparentcomponent
msgid "Select parent component"
msgstr "Выбрать родительский компонент"
#: lazarusidestrconsts.lisdsgshownonvisualcomponents
msgid "Show nonvisual components"
msgstr "Показывать невизуальные компоненты"
#: lazarusidestrconsts.lisdsgtoggleshowingnonvisualcomponents
msgid "Toggle showing nonvisual components"
msgstr "Показать или скрыть невизуальные компоненты"
#: lazarusidestrconsts.lisduplicate
msgid "Duplicate"
msgstr "Дубликат"
#: lazarusidestrconsts.lisduplicateentry
msgid "Duplicate entry"
msgstr "Дублирующийся элемент"
#: lazarusidestrconsts.lisduplicatefilename
msgid "Duplicate File Name"
msgstr "Дублирующееся имя файла"
#: lazarusidestrconsts.lisduplicatefoundofvalue
#, object-pascal-format
msgid "Duplicate found of value \"%s\"."
msgstr "Значение \"%s\" уже существует."
#: lazarusidestrconsts.lisduplicatemodename
#, object-pascal-format
msgid "Mode \"%s\" is already present in the list."
msgstr "Режим \"%s\" уже имеется в списке."
#: lazarusidestrconsts.lisduplicatename
msgid "Duplicate Name"
msgstr "Имя уже существует"
#: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe
#, object-pascal-format
msgid "Duplicate name: A component named \"%s\" already exists in the inherited component %s"
msgstr "Дублирующееся имя: Компонент с именем \"%s\" уже существует в унаследованном компоненте %s"
#: lazarusidestrconsts.lisduplicateppufilesdeleteoneormakesureallsearchpaths
msgid "Duplicate ppu files. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Файлы PPU дублируются. Удалите один из них, либо убедитесь, что пути поиска имеют нужный порядок (подсказка: FPC сначала ищет в последнем пути)."
#: lazarusidestrconsts.lisduplicatesearchpath
msgid "Duplicate search path"
msgstr "Путь поиска уже существует"
#: lazarusidestrconsts.lisduplicatesourcesdeleteoneormakesureallsearchpathsh
msgid "Duplicate sources. Delete one or make sure all search paths have correct order (Hint: FPC uses last path first)."
msgstr "Файлы исходного кода дублируются. Удалите один из них, либо убедитесь, что пути поиска имеют нужный порядок (подсказка: FPC сначала ищет в последнем пути)."
#: lazarusidestrconsts.lisduplicateunit
msgid "Duplicate Unit"
msgstr "Дублирующийся модуль"
#: lazarusidestrconsts.lisduplicateunitin
#, object-pascal-format
msgid "Duplicate unit \"%s\" in \"%s\""
msgstr "Дублирующийся модуль \"%s\" в \"%s\""
#: lazarusidestrconsts.lisdynpkgamounttoscrollin
msgid "Amount to scroll in"
msgstr "Шаг прокрутки"
#: lazarusidestrconsts.lisdynpkgamounttoscrollin2
msgid "Amount to scroll in (%)"
msgstr "Шаг прокрутки (%)"
#: lazarusidestrconsts.lisdynpkgamounttoscrollinmax
msgid "Amount to scroll in (Max)"
msgstr "Шаг прокрутки (максимум)"
#: lazarusidestrconsts.lisdynpkgautoscrollondeletepa
msgid "Auto Scroll on delete past left border"
msgstr "Автоматическая прокрутка при удалении за левую границу"
#: lazarusidestrconsts.lisdynpkgautoscrollontypepast
msgid "Auto Scroll on type past right border"
msgstr "Автоматическая прокрутка при вводе за правую границу"
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsofw
msgid "Trigger on min chars (% of width)"
msgstr "Минимум для срабатывания (% ширины)"
#: lazarusidestrconsts.lisdynpkgtriggeronmincharsvis
msgid "Trigger on min chars visible"
msgstr "Минимум для срабатывания"
#: lazarusidestrconsts.lisedit
msgctxt "lazarusidestrconsts.lisedit"
msgid "Edit"
msgstr "Правка"
#: lazarusidestrconsts.liseditadditionalhelpformessages
msgid "Edit additional help for messages"
msgstr "Редактировать дополнительную справку для сообщений"
#: lazarusidestrconsts.liseditbuildmodes
msgid "Edit build modes"
msgstr "Изменить режимы сборки"
#: lazarusidestrconsts.liseditcontexthelp
msgid "Edit context help"
msgstr "Редактировать контекстно-зависимую справку"
#: lazarusidestrconsts.lisedithelp
msgid "Edit help"
msgstr "Редактировать справку"
#: lazarusidestrconsts.liseditkey
msgid "Edit Key"
msgstr "Изменить клавиши"
#: lazarusidestrconsts.liseditorcolors
msgid "Editor Colors"
msgstr "Цвета редактора"
#: lazarusidestrconsts.liseditormacros
msgctxt "lazarusidestrconsts.liseditormacros"
msgid "Editor Macros"
msgstr "Макросы редактора"
#: lazarusidestrconsts.liseditortoolbar
msgid "Editor ToolBar"
msgstr "Инструментальная панель редактора"
#: lazarusidestrconsts.liseditortoolbarsettings
msgid "Editor Toolbar Settings"
msgstr "Параметры инструментальной панели редактора"
#: lazarusidestrconsts.liseditortoolbarvisible
msgid "Editor Toolbar is &visible"
msgstr "&Показывать инструментальную панель редактора"
#: lazarusidestrconsts.lisedoptsloadascheme
msgid "Load a scheme"
msgstr "Загрузить схему"
#: lazarusidestrconsts.lisedtdefcurrentproject
msgid "Current Project"
msgstr "Текущий проект"
#: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename
msgid "A valid tool needs at least a title and a filename."
msgstr "Корректное средство обязательно должно иметь заголовок и имя файла."
#: lazarusidestrconsts.lisedtexttooledittool
msgid "Edit Tool"
msgstr "Параметры пользовательского средства"
#: lazarusidestrconsts.lisedtexttoolkey
msgctxt "lazarusidestrconsts.lisedtexttoolkey"
msgid "Key"
msgstr "Клавиша"
#: lazarusidestrconsts.lisedtexttoolmacros
msgctxt "lazarusidestrconsts.lisedtexttoolmacros"
msgid "Macros"
msgstr "Макросы"
#: lazarusidestrconsts.lisedtexttoolparameters
msgid "Parameters:"
msgstr "Параметры:"
#: lazarusidestrconsts.lisedtexttoolprogramfilename
msgid "Program Filename:"
msgstr "Имя файла программы:"
#: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages
msgid "Scan output for FPC messages"
msgstr "Искать сообщения FPC в выводе"
#: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages
msgid "Scan output for \"make\" messages"
msgstr "Искать сообщения \"make\" в выводе"
#: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired
msgid "Title and Filename required"
msgstr "Требуются заголовок и имя файла"
#: lazarusidestrconsts.lisedtexttoolworkingdirectory
msgid "Working Directory:"
msgstr "Рабочий каталог:"
#: lazarusidestrconsts.liselevatethemessageprioritytoalwaysshowitbydefaultit
msgid "Elevate the message priority to always show it (by default it has low priority \"verbose\")"
msgstr "Всегда отображать сообщение как важное (по умолчанию оно относится к менее важным \"подробным\")"
#: lazarusidestrconsts.lisemdall
msgctxt "lazarusidestrconsts.lisemdall"
msgid "All"
msgstr "Все"
#: lazarusidestrconsts.lisemdemptymethods
msgctxt "lazarusidestrconsts.lisemdemptymethods"
msgid "Empty Methods"
msgstr "Пустые методы"
#: lazarusidestrconsts.lisemdfoundemptymethods
msgid "Found empty methods:"
msgstr "Найденные пустые методы:"
#: lazarusidestrconsts.lisemdnoclass
msgid "No class"
msgstr "Отсутствует класс"
#: lazarusidestrconsts.lisemdnoclassat
#, object-pascal-format
msgid "No class at %s(%s,%s)"
msgstr "Отсутствует класс в %s(%s,%s)"
#: lazarusidestrconsts.lisemdonlypublished
msgid "Only published"
msgstr "Только published"
#: lazarusidestrconsts.lisemdpublic
msgid "Public"
msgstr "Public"
#: lazarusidestrconsts.lisemdpublished
msgid "Published"
msgstr "Published"
#: lazarusidestrconsts.lisemdremovemethods
msgid "Remove methods"
msgstr "Удалить методы"
#: lazarusidestrconsts.lisemdsearchintheseclasssections
msgid "Search in these class sections:"
msgstr "Искать в следующих секциях класса"
#: lazarusidestrconsts.lisemdunabletoshowemptymethodsofthecurrentclassbecause
#, object-pascal-format
msgid "Unable to show empty methods of the current class, because%s%s"
msgstr "Невозможно показать пустые методы текущего класса по причине:%s%s"
#: lazarusidestrconsts.lisempty
msgid "Empty"
msgstr "Пусто"
#: lazarusidestrconsts.lisemptydestinationforpublishing
msgid "Destination directory for publishing is either a relative path or empty."
msgstr "Путь к каталогу назначения для опубликования относителен либо пуст."
#: lazarusidestrconsts.lisenabledonlyforpackages
msgid "Enabled only for packages."
msgstr "Параметр активен только для пакетов"
#: lazarusidestrconsts.lisenableflaguseunitofunitinpackage
#, object-pascal-format
msgid ". Enable flag \"Use Unit\" of unit %s in package %s"
msgstr ". Включите флаг \"Использовать модуль\" для модуля %s в пакете %s"
#: lazarusidestrconsts.lisenablei18nforlfm
msgid "Enable I18N for LFM"
msgstr "Включить i18n для LFM"
#: lazarusidestrconsts.lisenableinternationalizationandtranslationsupport
msgid "Enable internationalization and translation support"
msgstr "Включить поддержку интернационализации и локализации"
#: lazarusidestrconsts.lisenablemacros
msgid "Enable Macros"
msgstr "Включить макросы"
#: lazarusidestrconsts.lisenableoptiondwarf2
msgid "Enable Dwarf 2 (-gw)"
msgstr "Включить Dwarf 2 (-gw)"
#: lazarusidestrconsts.lisenableoptiondwarf2sets
msgid "Enable Dwarf 2 with sets"
msgstr "Включить Dwarf 2 с поддержкой множеств"
#: lazarusidestrconsts.lisenableoptiondwarf3
msgid "Enable Dwarf 3 (-gw3)"
msgstr "Включить Dwarf 3 (-gw3)"
#: lazarusidestrconsts.lisenableoptionxg
msgid "Enable Option -Xg?"
msgstr "Включить параметр -Xg?"
#: lazarusidestrconsts.lisenablereplacewholeidentifierdisablereplaceprefix
msgid "Enable = pressing Return replaces whole identifier and Shift+Return replaces prefix, Disable = pressing Return replaces prefix and Shift+Return replaces whole identifier"
msgstr "Включено = при нажатии клавиши Ввод заменять идентификатор целиком, а при нажатии Shift+Ввод заменять префикс; выключено = при нажатии клавиши Ввод заменять префикс, а при нажатии Shift+Ввод заменять идентификатор целиком"
#: lazarusidestrconsts.lisencloseinifdef
msgid "Enclose in $IFDEF"
msgstr "Заключить в $IFDEF"
#: lazarusidestrconsts.lisencodingnumberoffilesfailed
#, object-pascal-format
msgid "Number of files failed to convert: %d"
msgstr "Не удалось преобразовать файлов: %d"
#: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisencodingoffileondiskisnewencodingis"
msgid "Encoding of file \"%s\"%son disk is %s. New encoding is %s."
msgstr "Файл \"%s\"%sна диске имеет кодировку %s. Новой кодировкой будет %s."
#: lazarusidestrconsts.lisenternewnameformacros
#, object-pascal-format
msgid "Enter new name for Macro \"%s\""
msgstr "Введите новое имя макроса \"%s\""
#: lazarusidestrconsts.lisenvironmentvariablenameasparameter
msgid "Environment variable, name as parameter"
msgstr "Переменная окружения; параметром является имя"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename
msgid "Invalid debugger filename"
msgstr "Некорректное имя отладчика"
#: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg
#, object-pascal-format
msgid "The debugger file \"%s\" is not an executable."
msgstr "Файл отладчика \"%s\" не является исполнимым."
#: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg
#, object-pascal-format
msgid "Test directory \"%s\" not found."
msgstr "Каталог для сборки пробных проектов \"%s\" не найден."
#: lazarusidestrconsts.liserrinvalidoption
#, object-pascal-format
msgid "Invalid option at position %d: \"%s\""
msgstr "Неверный параметр в позиции %d: \"%s\""
#: lazarusidestrconsts.liserrnooptionallowed
#, object-pascal-format
msgid "Option at position %d does not allow an argument: %s"
msgstr "Параметр в позиции %d не разрешает аргумент: %s"
#: lazarusidestrconsts.liserroptionneeded
#, object-pascal-format
msgid "Option at position %d needs an argument : %s"
msgstr "Параметр в позиции %d требует аргумент: %s"
#: lazarusidestrconsts.liserror
msgid "Error: "
msgstr "Ошибка: "
#: lazarusidestrconsts.liserrorcreatingfile
msgid "Error creating file"
msgstr "Ошибка создания файла"
#: lazarusidestrconsts.liserrordeletingfile
msgid "Error deleting file"
msgstr "Ошибка удаления файла"
#: lazarusidestrconsts.liserrorin
#, object-pascal-format
msgid "Error in %s"
msgstr "Ошибка в %s"
#: lazarusidestrconsts.liserrorinthecompilerfilename
msgid "Error in the compiler file name:"
msgstr "Ошибка в имени файла компилятора:"
#: lazarusidestrconsts.liserrorinthecustomcompileroptionsother
msgid "Error in the custom compiler options (Other):"
msgstr "Ошибка в пользовательских параметрах компилятора (вкладка \"Другие\"):"
#: lazarusidestrconsts.liserrorinthecustomlinkeroptionslinkingpassoptionstol
msgid "Error in the custom linker options (Compilation and Linking / Pass options to linker):"
msgstr "Ошибка в пользовательских параметрах компоновщика (поле ввода параметров компоновщика на вкладке \"Компиляция и компоновка\"):"
#: lazarusidestrconsts.liserrorinthedebuggerpathaddition
msgid "Error in the \"Debugger path addition\":"
msgstr "Ошибка в поле \"Дополнения к путям отладчика\":"
#: lazarusidestrconsts.liserrorinthesearchpathforincludefiles
msgid "Error in the search path for \"Include files\":"
msgstr "Ошибка в путях поиска в поле \"Включаемые файлы\":"
#: lazarusidestrconsts.liserrorinthesearchpathforlibraries
msgid "Error in the search path for \"Libraries\":"
msgstr "Ошибка в путях поиска в поле \"Библиотеки\":"
#: lazarusidestrconsts.liserrorinthesearchpathforobjectfiles
msgid "Error in the search path for \"Object files\":"
msgstr "Ошибка в путях поиска в поле \"Объектные файлы\":"
#: lazarusidestrconsts.liserrorinthesearchpathforothersources
msgid "Error in the search path for \"Other sources\":"
msgstr "Ошибка в путях поиска в поле \"Прочие файлы исходного кода\":"
#: lazarusidestrconsts.liserrorinthesearchpathforotherunitfiles
msgid "Error in the search path for \"Other unit files\":"
msgstr "Ошибка в путях поиска в поле \"Другие модули\":"
#: lazarusidestrconsts.liserrorintheunitoutputdirectory
msgid "Error in the \"unit output directory\":"
msgstr "Ошибка в поле \"Каталог вывода модулей\":"
#: lazarusidestrconsts.liserrorinvalidbuildmode
#, object-pascal-format
msgid "Error: invalid build mode \"%s\""
msgstr "Ошибка: некорректный режим сборки \"%s\""
#: lazarusidestrconsts.liserrorloadingfile
msgid "Error loading file"
msgstr "Ошибка загрузки файла"
#: lazarusidestrconsts.liserrorloadingfile2
#, object-pascal-format
msgid "Error loading file \"%s\":"
msgstr "Ошибка загрузки файла \"%s\":"
#: lazarusidestrconsts.liserrormovingcomponent
msgid "Error moving component"
msgstr "Ошибка перемещения компонента"
#: lazarusidestrconsts.liserrormovingcomponent2
#, object-pascal-format
msgid "Error moving component %s:%s"
msgstr "Ошибка перемещения компонента %s:%s"
#: lazarusidestrconsts.liserrornamingcomponent
msgid "Error naming component"
msgstr "Ошибка при именовании компонента"
#: lazarusidestrconsts.liserroropeningcomponent
msgid "Error opening component"
msgstr "Ошибка при открытии компонента"
#: lazarusidestrconsts.liserroropeningform
msgid "Error opening form"
msgstr "Ошибка открытия формы"
#: lazarusidestrconsts.liserrorparsinglfmcomponentstream
msgid "Error parsing lfm component stream."
msgstr "Ошибка анализа потока компонента LFM."
#: lazarusidestrconsts.liserrorreadingpackagelistfromfile
#, object-pascal-format
msgid "Error reading package list from file%s%s%s%s"
msgstr "Ошибка чтения списка пакетов из файла%s%s%s%s"
#: lazarusidestrconsts.liserrorreadingxml
msgid "Error reading XML"
msgstr "Ошибка чтения XML"
#: lazarusidestrconsts.liserrorreadingxmlfile
#, object-pascal-format
msgid "Error reading xml file \"%s\"%s%s"
msgstr "Ошибка чтения файла XML \"%s\"%s%s"
#: lazarusidestrconsts.liserrorrenamingfile
msgid "Error renaming file"
msgstr "Ошибка переименования файла"
#: lazarusidestrconsts.liserrors
msgctxt "lazarusidestrconsts.liserrors"
msgid "Errors"
msgstr "Ошибки"
#: lazarusidestrconsts.liserrors2
#, object-pascal-format
msgid ", Errors: %s"
msgstr ", ошибок: %s"
#: lazarusidestrconsts.liserrorsavingform
msgid "Error saving form"
msgstr "Ошибка сохранения формы"
#: lazarusidestrconsts.liserrorsettingthenameofacomponentto
#, object-pascal-format
msgid "Error setting the name of a component %s to %s"
msgstr "Ошибка установки имени компонента %s в %s"
#: lazarusidestrconsts.liserrorwritingfile
#, object-pascal-format
msgid "Error writing file \"%s\""
msgstr "Ошибка записи файла \"%s\""
#: lazarusidestrconsts.liserrorwritingpackagelisttofile
#, object-pascal-format
msgid "Error writing package list to file%s%s%s%s"
msgstr "Ошибка записи списка пакетов в файл%s%s%s%s"
#: lazarusidestrconsts.liseverynthlinenumber
msgid "Show every n-th line number"
msgstr "Показывать каждый n-ный номер строки"
#: lazarusidestrconsts.lisexamplefile
msgid "Example file:"
msgstr "Файл с образцами:"
#: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac
#, object-pascal-format
msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier"
msgstr "Примеры:%s<Идентификатор>%sTMyEnum.<Перечисление>%s<Имя модуля>.<Идентификатор>%s#<Имя пакета>.<Имя модуля>.<Идентификатор>"
#: lazarusidestrconsts.lisexclude
msgid "Exclude"
msgstr "Исключить"
#: lazarusidestrconsts.lisexcludedatruntime
#, object-pascal-format
msgid "%s excluded at run time"
msgstr "%s исключён во время исполнения"
#: lazarusidestrconsts.lisexcludesforstars
msgid "Excludes for * and ** in unit and include search paths"
msgstr "Исключения для * и ** в путях поиска модулей и включаемых файлов"
#: lazarusidestrconsts.lisexecutableisadirectory
#, object-pascal-format
msgid "executable \"%s\" is a directory"
msgstr "исполнимый файл \"%s\" является каталогом"
#: lazarusidestrconsts.lisexecutablelacksthepermissiontorun
#, object-pascal-format
msgid "executable \"%s\" lacks the permission to run"
msgstr "исполнимый файл \"%s\" не имеет прав на запуск"
#: lazarusidestrconsts.lisexecuteafter
msgid "Execute After"
msgstr "Выполнить после компиляции"
#: lazarusidestrconsts.lisexecutebefore
msgid "Execute Before"
msgstr "Выполнить перед компиляцией"
#: lazarusidestrconsts.lisexecutionstopped
msgid "Execution stopped"
msgstr "Исполнение остановлено"
#: lazarusidestrconsts.lisexecutionstoppedexitcode
#, object-pascal-format
msgid "Execution stopped with exit-code %1:d ($%2:s)"
msgstr "Исполнение остановлено с кодом выхода %1:d ($%2:s)"
#: lazarusidestrconsts.lisexit
msgctxt "lazarusidestrconsts.lisexit"
msgid "Exit"
msgstr "Выход"
#: lazarusidestrconsts.lisexitcode
#, object-pascal-format
msgid "Exit code %s"
msgstr "Код завершения %s"
#: lazarusidestrconsts.lisexpand
msgid "Expand"
msgstr "Развернуть"
#: lazarusidestrconsts.lisexpandall
msgid "Expand All [Ctrl+Plus]"
msgstr "Развернуть всё [Ctrl+Плюс]"
#: lazarusidestrconsts.lisexpandall2
msgid "Expand All"
msgstr "Развернуть все"
#: lazarusidestrconsts.lisexpandallclasses
msgid "Expand all classes"
msgstr "Развернуть все классы"
#: lazarusidestrconsts.lisexpandallpackages
msgid "Expand all packages"
msgstr "Развернуть все пакеты"
#: lazarusidestrconsts.lisexpandallunits
msgid "Expand all units"
msgstr "Развернуть все модули"
#: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor
msgid "Expanded filename of current editor file"
msgstr "Полное имя файла в текущем редакторе"
#: lazarusidestrconsts.lisexport
msgctxt "lazarusidestrconsts.lisexport"
msgid "Export"
msgstr "Экспортировать"
#: lazarusidestrconsts.lisexportall
msgid "Export all"
msgstr "Экспортировать все"
#: lazarusidestrconsts.lisexportallitemstofile
msgid "Export All Items to File"
msgstr "Экспортировать всё в файл"
#: lazarusidestrconsts.lisexportenvironmentoptions
msgctxt "lazarusidestrconsts.lisexportenvironmentoptions"
msgid "Export environment options"
msgstr "Экспортировать параметры окружения"
#: lazarusidestrconsts.lisexporthtml
msgid "Export as HTML"
msgstr "Экспортировать в HTML"
#: lazarusidestrconsts.lisexportimport
msgid "Export / Import"
msgstr "Экспорт / импорт"
#: lazarusidestrconsts.lisexportpackagelistxml
msgid "Export package list"
msgstr "Экспорт списка пакетов"
#: lazarusidestrconsts.lisexportselected
msgid "Export selected"
msgstr "Экспортировать выбранный"
#: lazarusidestrconsts.lisexportsub
msgid "Export >>"
msgstr "Экспортировать >>"
#: lazarusidestrconsts.lisextract
msgid "Extract"
msgstr "Извлечь"
#: lazarusidestrconsts.lisextractprocedure
msgctxt "lazarusidestrconsts.lisextractprocedure"
msgid "Extract Procedure"
msgstr "Извлечь в процедуру"
#: lazarusidestrconsts.lisextraopts
msgid "Pass additional options to the compiler. Can be given multiple times. If compilation options are also specified in --build-ide, then the options from --opt will be added after them."
msgstr "Передать дополнительные параметры компилятору. Может задаваться несколько раз. Если параметры компиляции также указаны в --build-ide, параметры из --opt будут переданы после них."
#: lazarusidestrconsts.lisextremelyverbose
msgid "Extremely Verbose"
msgstr "Крайне подробное"
#: lazarusidestrconsts.lisexttoolexternaltools
msgid "External Tools"
msgstr "Внешние средства"
#: lazarusidestrconsts.lisexttoolmaximumtoolsreached
msgid "Maximum Tools reached"
msgstr "Достигнут максимум количества средств"
#: lazarusidestrconsts.lisexttoolthereisamaximumoftools
#, object-pascal-format
msgid "There is a maximum of %s tools."
msgstr "Допускается максимум %s средств."
#: lazarusidestrconsts.lisfailedtoaddnnotuniqueresources
#, object-pascal-format
msgid "Failed to add %d not unique resource(s)"
msgstr "Невозможно добавить неуникальные ресурсы (%d шт.)"
#: lazarusidestrconsts.lisfailedtocreateapplicationbundlefor
#, object-pascal-format
msgid "Failed to create Application Bundle for \"%s\""
msgstr "Не удалось создать Application Bundle для \"%s\""
#: lazarusidestrconsts.lisfailedtoloadfoldstat
msgid "Failed to load fold state"
msgstr "Не удалось загрузить состояние сворачиваний кода."
#: lazarusidestrconsts.lisfailedtoresolvemacros
msgid "failed to resolve macros"
msgstr "не удалось раскрыть макрос"
#: lazarusidestrconsts.lisfailedtosavefile
msgid "Failed to save file."
msgstr "Не удалось сохранить файл."
#: lazarusidestrconsts.lisfatal
msgctxt "lazarusidestrconsts.lisfatal"
msgid "Fatal"
msgstr "Фатальная ошибка"
#: lazarusidestrconsts.lisfile
msgctxt "lazarusidestrconsts.lisfile"
msgid "File"
msgstr "Файл"
#: lazarusidestrconsts.lisfile2
msgid "File: "
msgstr "Файл: "
#: lazarusidestrconsts.lisfileextensionofprograms
msgid "File extension of programs"
msgstr "Расширение файлов программ"
#: lazarusidestrconsts.lisfilefilter
msgid "File filter"
msgstr "Файловый фильтр"
#: lazarusidestrconsts.lisfilefilters
msgid "File Filters"
msgstr "Файловые фильтры"
#: lazarusidestrconsts.lisfilefiltersaddrow
msgid "Add Row"
msgstr "Добавить строку"
#: lazarusidestrconsts.lisfilefiltersdeleterow
msgid "Delete Row"
msgstr "Удалить строку"
#: lazarusidestrconsts.lisfilefiltersinsertrow
msgid "Insert Row"
msgstr "Вставить строку"
#: lazarusidestrconsts.lisfilefiltersmask
msgid "File mask"
msgstr "Файловая маска"
#: lazarusidestrconsts.lisfilefilterssetdefaults
msgid "Set defaults"
msgstr "Установить значения по умолчанию"
#: lazarusidestrconsts.lisfilefilterstitle
msgid "These are file filters that will appear in all File Open dialogs"
msgstr "Эти файловые фильтры появятся во всех диалогах открытия файлов"
#: lazarusidestrconsts.lisfilefound
msgid "File found"
msgstr "Найден файл"
#: lazarusidestrconsts.lisfilehaschangedsave
#, object-pascal-format
msgid "File \"%s\" has changed. Save?"
msgstr "Файл \"%s\" был изменён. Сохранить?"
#: lazarusidestrconsts.lisfilehasnoproject
msgid "File has no project"
msgstr "Файл не имеет проекта"
#: lazarusidestrconsts.lisfileisdirectory
msgid "File is directory"
msgstr "Файл является каталогом"
#: lazarusidestrconsts.lisfileisnotanexecutable
msgid "File is not an executable"
msgstr "Файл не является исполнимым"
#: lazarusidestrconsts.lisfileisvirtual
#, object-pascal-format
msgid "File \"%s\" is virtual."
msgstr "Файл \"%s\" является виртуальным."
#: lazarusidestrconsts.lisfilenamestyle
msgid "Filename Style"
msgstr "Стиль имени файла"
#: lazarusidestrconsts.lisfilenotfound
msgid "File not found"
msgstr "Файл не найден"
#: lazarusidestrconsts.lisfilenotfound3
#, object-pascal-format
msgid "file %s not found"
msgstr "файл %s не найден"
#: lazarusidestrconsts.lisfilenotfound4
msgid "file not found"
msgstr "файл не найден"
#: lazarusidestrconsts.lisfilenotfound5
#, object-pascal-format
msgid "File not found:%s%s"
msgstr "Файл не найден:%s%s"
#: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit
#, object-pascal-format
msgid "File \"%s\" not found.%sDo you want to create it?"
msgstr "Файл \"%s\" не найден.%sСоздать его?"
#: lazarusidestrconsts.lisfilenotlowercase
msgid "File not lowercase"
msgstr "Файл не в нижнем регистре"
#: lazarusidestrconsts.lisfilescountconvertedtotextformat
#, object-pascal-format
msgid "%d files were converted to text format."
msgstr "Файлы (%d шт.) преобразованы в текстовые."
#: lazarusidestrconsts.lisfilesettings
msgid "File Settings"
msgstr "Параметры файла"
#: lazarusidestrconsts.lisfileshasincorrectsyntax
#, object-pascal-format
msgid "File %s has incorrect syntax."
msgstr "Файл %s имеет некорректный синтаксис."
#: lazarusidestrconsts.lisfileshasregisterprocedureinpackageusessection
#, object-pascal-format
msgid "Files: %s, has Register procedure: %s, in package uses section: %s"
msgstr "Файлов: %s, с процедурой Register: %s, в выражении Uses пакета: %s"
#: lazarusidestrconsts.lisfileshaverightencoding
msgid "*** All found files already have the right encoding ***"
msgstr "*** Все найденные файлы уже имеют верную кодировку ***"
#: lazarusidestrconsts.lisfilesinasciiorutf8encoding
msgid "Files in ASCII or UTF-8 encoding"
msgstr "Файлы в кодировке ASCII либо UTF-8"
#: lazarusidestrconsts.lisfilesisconvertedtotextformat
#, object-pascal-format
msgid "File %s was converted to text format."
msgstr "Файл %s преобразован в текстовый."
#: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding
msgid "Files not in ASCII nor UTF-8 encoding"
msgstr "Файлы не в кодировке ASCII и не в UTF-8"
#: lazarusidestrconsts.lisfilewheredebugoutputiswritten
msgid "File where debug output is written to. Default is write to the console."
msgstr "Файл, куда записывается вывод отладки. По умолчанию вывод отладки записывается в консоль."
#: lazarusidestrconsts.lisfilter
msgid "Filter"
msgstr "Фильтр"
#: lazarusidestrconsts.lisfilter3
#, object-pascal-format
msgid "Filter: %s"
msgstr "Фильтр: %s"
#: lazarusidestrconsts.lisfilterallmessagesofcertaintype
msgid "Filter all messages of certain type"
msgstr "Скрывать сообщения определённого типа"
#: lazarusidestrconsts.lisfilterallmessagesoftype
#, object-pascal-format
msgid "Filter all messages of type %s"
msgstr "Скрывать сообщения типа \"%s\""
#: lazarusidestrconsts.lisfilteralreadyexists
msgid "Filter already exists"
msgstr "Фильтр уже имеется"
#: lazarusidestrconsts.lisfilterdebugmessagesandbelow
msgid "Filter Debug Messages and below"
msgstr "Не выводить отладочные сообщения и ниже"
#: lazarusidestrconsts.lisfilterhintsandbelow
msgid "Filter Hints and below"
msgstr "Не выводить подсказки и ниже"
#: lazarusidestrconsts.lisfilterhintswithoutsourceposition
msgid "Filter Hints without Source Position"
msgstr "Не выводить подсказки без позиции в коде"
#: lazarusidestrconsts.lisfilternonedonotfilterbyurgency
msgid "Filter None, do not filter by urgency"
msgstr "Выводить все, не фильтровать по важности"
#: lazarusidestrconsts.lisfilternonurgentmessages
msgid "Filter non urgent Messages"
msgstr "Фильтровать сообщения по важности"
#: lazarusidestrconsts.lisfilternotesandbelow
msgid "Filter Notes and below"
msgstr "Не выводить замечания и ниже"
#: lazarusidestrconsts.lisfiltersets
msgid "Filter Sets"
msgstr "Наборы фильтров"
#: lazarusidestrconsts.lisfiltertheavailableoptionslist
msgid "Filter the available options list"
msgstr "Фильтр списка доступных параметров"
#: lazarusidestrconsts.lisfilterverbosemessagesandbelow
msgid "Filter Verbose Messages and below"
msgstr "Не выводить подробные сообщения и ниже"
#: lazarusidestrconsts.lisfilterwarningsandbelow
msgid "Filter Warnings and below"
msgstr "Не выводить предупреждения и ниже"
#: lazarusidestrconsts.lisfind
msgid "Find ..."
msgstr "Найти ..."
#: lazarusidestrconsts.lisfinddeclarationof
#, object-pascal-format
msgid "Find Declaration of %s"
msgstr "Найти объявление %s"
#: lazarusidestrconsts.lisfindfiledirectories
msgid "D&irectories"
msgstr "Ката&логи"
#: lazarusidestrconsts.lisfindfilefilemask
msgid "Fi&le mask"
msgstr "Фа&йловая маска"
#: lazarusidestrconsts.lisfindfileincludesubdirectories
msgid "Include &sub directories"
msgstr "&Искать в подкаталогах"
#: lazarusidestrconsts.lisfindfilemultilinepattern
msgid "&Multiline pattern"
msgstr "Многострочный &шаблон"
#: lazarusidestrconsts.lisfindfilereplacementisnotpossible
msgid "This file contains characters that have different lengths in upper and lower case. The current implementation does not allow for correct replacement in this case (but you can use case-sensitive replacement). This file will have to be skipped:"
msgstr "Этот файл содержит символы, для которых длина в верхнем и нижнем регистрах не совпадает. Текущая реализация не позволяет осуществить корректную замену в таком случае (но можно использовать замену с учётом регистра). Этот файл будет пропущен:"
#: lazarusidestrconsts.lisfindfilesearchallfilesinproject
msgid "all files in &project"
msgstr "все &файлы проекта"
#: lazarusidestrconsts.lisfindfilesearchallopenfiles
msgid "all &open files"
msgstr "все &открытые файлы"
#: lazarusidestrconsts.lisfindfilesearchinactivefile
msgid "&active file"
msgstr "теку&щий файл"
#: lazarusidestrconsts.lisfindfilesearchindirectories
msgid "&directories"
msgstr "&каталоги"
#: lazarusidestrconsts.lisfindfilessearchinprojectgroup
msgid "project &group"
msgstr "&группа проектов"
#: lazarusidestrconsts.lisfindfilewhere
msgid "Search location"
msgstr "Область поиска"
#: lazarusidestrconsts.lisfindkeycombination
msgid "Find key combination"
msgstr "Найти комбинацию клавиш"
#: lazarusidestrconsts.lisfindmissingunit
msgid "Find missing unit"
msgstr "Поиск отсутствующего модуля"
#: lazarusidestrconsts.lisfindoption
msgid "Find option"
msgstr "Найти параметр"
#: lazarusidestrconsts.lisfirst
msgid "First"
msgstr "В начале"
#: lazarusidestrconsts.lisfirsttest
msgid "&First test"
msgstr "&Первая проверка"
#: lazarusidestrconsts.lisfixlfmfile
msgid "Fix LFM file"
msgstr "Исправить файл LFM"
#: lazarusidestrconsts.lisfocushint
msgid "Focus hint"
msgstr "Прикрепить подсказку"
#: lazarusidestrconsts.lisforcerenaming
msgid "Force renaming"
msgstr "Переименовать принудительно"
#: lazarusidestrconsts.lisforexampleshowattopthelocalvariablesthenthemembers
msgid "\"Scoped\" sorting will show local variables on top, then the members of current class, then of the ancestors, then the current unit, then of used units"
msgstr "Сортировка \"в области действия\" выведет сверху локальные переменные, затем элементы текущего класса, его предков, текущего и используемых модулей"
#: lazarusidestrconsts.lisform
msgid "Form"
msgstr "Форма"
#: lazarusidestrconsts.lisformacosdarwin
msgid "For macOS (Darwin)"
msgstr "Для macOS (Darwin)"
#: lazarusidestrconsts.lisformaterror
msgid "Format error"
msgstr "Ошибка форматирования"
#: lazarusidestrconsts.lisforwindows
msgid "For Windows"
msgstr "Для Windows"
#: lazarusidestrconsts.lisfoundversionexpected
#, object-pascal-format
msgid "Found version %s, expected %s"
msgstr "Найдена версия %s, хотя ожидалась %s"
#: lazarusidestrconsts.lisfpcfullversioneg20701
msgid "FPC version as one number (e.g. 20701)"
msgstr "Версия FPC в виде одного числа (например, 20701)"
#: lazarusidestrconsts.lisfpcmessagefile2
msgid "FPC message file:"
msgstr "Файл сообщений FPC:"
#: lazarusidestrconsts.lisfpcmessagesappendix
msgid "FPC messages: Appendix"
msgstr "Сообщения FPC: приложение"
#: lazarusidestrconsts.lisfpcresources
msgid "FPC resources (.res)"
msgstr "Ресурсы FPC (.res)"
#: lazarusidestrconsts.lisfpcsources
msgid "FPC sources"
msgstr "Исходный код FPC"
#: lazarusidestrconsts.lisfpctooold
msgid "FPC too old"
msgstr "Слишком старая версия FPC"
#: lazarusidestrconsts.lisfpcversion
msgid "FPC Version: "
msgstr "Версия FPC: "
#: lazarusidestrconsts.lisfpcversioneg222
msgid "FPC Version (e.g. 2.2.2)"
msgstr "Версия FPC (например, 2.2.2)"
#: lazarusidestrconsts.lisfpdoceditor
msgctxt "lazarusidestrconsts.lisfpdoceditor"
msgid "FPDoc Editor"
msgstr "Редактор FPDoc"
#: lazarusidestrconsts.lisfpdocerrorwriting
#, object-pascal-format
msgid "Error writing \"%s\"%s%s"
msgstr "При записи \"%s\" произошла ошибка%s%s"
#: lazarusidestrconsts.lisfpdocfpdocsyntaxerror
msgid "FPDoc syntax error"
msgstr "Синтаксическая ошибка FPDoc"
#: lazarusidestrconsts.lisfpdocpackagename
msgid "FPDoc package name:"
msgstr "Имя пакета FPDoc:"
#: lazarusidestrconsts.lisfpdocpackagenamedefaultisprojectfilename
msgid "FPDoc package name. Default is project file name."
msgstr "Имя пакета FPDoc. По умолчанию используется имя файла проекта."
#: lazarusidestrconsts.lisfpdocthereisasyntaxerrorinthefpdocelement
#, object-pascal-format
msgid "There is a syntax error in the fpdoc element \"%s\":%s%s"
msgstr "В элементе FPDoc \"%s\" имеется синтаксическая ошибка:%s%s"
#: lazarusidestrconsts.lisfppkgcompilerproblem
msgid "there is a problem with the Free Pascal compiler executable, "
msgstr "проблема с исполнимым файлом компилятора Free Pascal, "
#: lazarusidestrconsts.lisfppkgconfgenproblems
msgid "Warnings have to be resolved first"
msgstr "Сначала требуется устранить предупреждения"
#: lazarusidestrconsts.lisfppkgconfiguration
msgid "The configuration file typically has the name \"fppkg.cfg\". When incorrect it may be impossible to resolve dependencies on Free Pascal packages. Leave empty to use the default."
msgstr "Файл настройки обычно называется \"fppkg.cfg\". Если он некорректен, может оказаться невозможным разрешение зависимостей от пакетов Free Pascal. Оставьте пустым для использования параметров по умолчанию."
#: lazarusidestrconsts.lisfppkgconfigurationfilenotfound
#, object-pascal-format
msgid "Fppkg configuration file not found:%s%s"
msgstr "Файл настройки Fppkg не найден:%s%s"
#: lazarusidestrconsts.lisfppkgcreatefilefailed
#, object-pascal-format
msgid "Failed to generate the configuration file \"%s\": %s"
msgstr "Невозможно создать файл настройки \"%s\": %s"
#: lazarusidestrconsts.lisfppkgfilestobewritten
msgid "Files to be written:"
msgstr "Будут записаны следующие файлы:"
#: lazarusidestrconsts.lisfppkgfixconfiguration
msgid "You could try to restore the configuration files automatically, or adapt the configuration file manually."
msgstr "Вы можете восстановить файлы настройки автоматически либо исправить вручную."
#: lazarusidestrconsts.lisfppkgfpcmkcfgcheckfailed
msgid "Failed to retrieve the version of the fpcmkcfg configuration tool."
msgstr "Невозможно получить версию средства fpcmkcfg."
#: lazarusidestrconsts.lisfppkgfpcmkcfgmissing
msgid "Could not find the fpcmkcfg configuration tool, which is needed to create the configuration files."
msgstr "Невозможно найти средство fpcmkcfg, требующееся для создания файлов настройки."
#: lazarusidestrconsts.lisfppkgfpcmkcfgneeded
msgid "An up-to-date version is needed to create the configuration files."
msgstr "Для создания файлов настройки требуется последняя версия."
#: lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold
msgctxt "lazarusidestrconsts.lisfppkgfpcmkcfgprobtooold"
msgid "It is probably too old to create the configuration files."
msgstr "Вероятно, оно слишком старое для создания файлов настройки."
#: lazarusidestrconsts.lisfppkgfpcmkcfgtooold
#, object-pascal-format
msgid "The fpcmkcfg configuration tool it too old [%s]."
msgstr "Средство fpcmkcfg слишком старое [%s]."
#: lazarusidestrconsts.lisfppkginstallationpath
#, object-pascal-format
msgid "The prefix of the Free Pascal Compiler installation is required. For example it has the units \"%s\" and/or \"%s\""
msgstr "Требуется префикс установки компилятора Free Pascal. Например, он содержит \"%s\" и/или \"%s\""
#: lazarusidestrconsts.lisfppkglibprefix
#, object-pascal-format
msgid "Fpc library prefix: %s"
msgstr "Префикс библиотек FPC: %s"
#: lazarusidestrconsts.lisfppkgprefix
#, object-pascal-format
msgid "Fpc prefix: %s"
msgstr "Префикс FPC: %s"
#: lazarusidestrconsts.lisfppkgproblem
msgid "Problem with Fppkg configuration"
msgstr "Проблема с настройкой Fppkg"
#: lazarusidestrconsts.lisfppkgrecentfpcmkcfgneeded
msgid "Make sure a recent version is installed and available in the path or alongside the compiler-executable."
msgstr "Убедитесь, что свежая версия установлена и доступна в путях поиска либо совместно с исполнимым файлом компилятора."
#: lazarusidestrconsts.lisfppkgwriteconfexception
#, object-pascal-format
msgid "A problem occurred while trying to create a new Fppkg configuration: %s"
msgstr "При создании новых файлов настройки Fppkg произошла проблема: %s"
#: lazarusidestrconsts.lisfppkgwriteconffailed
#, object-pascal-format
msgid "Failed to create a new Fppkg configuration (%s) You will have to fix the configuration manually or reinstall Free Pascal."
msgstr "Не удалось создать новые файлы настройки Fppkg (%s) Следует исправить эту проблему вручную либо переустановить Free Pascal."
#: lazarusidestrconsts.lisfppkgwriteconfigfile
msgid "Write new configuration files"
msgstr "Записать новые файлы настройки"
#: lazarusidestrconsts.lisframe
msgid "Frame"
msgstr "Фрейм"
#: lazarusidestrconsts.lisfrbackwardsearch
msgid "&Backward search"
msgstr "&Назад"
#: lazarusidestrconsts.lisfreeingbufferlines
#, object-pascal-format
msgid "freeing buffer lines: %s"
msgstr "освобождение строк буфера: %s"
#: lazarusidestrconsts.lisfreepascalcompilermessages
msgid "Free Pascal Compiler messages"
msgstr "Сообщения компилятора Free Pascal"
#: lazarusidestrconsts.lisfreepascalprefix
msgid "Free Pascal compiler prefix"
msgstr "Префикс установки компилятора Free Pascal"
#: lazarusidestrconsts.lisfreepascalsourcedirectory
msgid "Free Pascal source directory"
msgstr "Каталог исходного кода Free Pascal"
#: lazarusidestrconsts.lisfrforwardsearch
msgid "Forwar&d search"
msgstr "&Вперёд"
#: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp
msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)"
msgstr "Дополнительные файлы для поиска (пример: /path/*.pas;/path2/*.pp)"
#: lazarusidestrconsts.lisfrifindorrenameidentifier
msgid "Find or Rename Identifier"
msgstr "Найти или переименовать идентификатор"
#: lazarusidestrconsts.lisfrifindreferences
msgid "Find References"
msgstr "Найти ссылки"
#: lazarusidestrconsts.lisfriidentifier
#, object-pascal-format
msgid "Identifier: %s"
msgstr "Идентификатор: %s"
#: lazarusidestrconsts.lisfriinallopenpackagesandprojects
msgid "in all open packages and projects"
msgstr "во всех открытых пакетах и проектах"
#: lazarusidestrconsts.lisfriincurrentunit
msgid "in current unit"
msgstr "в текущем модуле"
#: lazarusidestrconsts.lisfriinmainproject
msgid "in main project"
msgstr "в главном проекте"
#: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit
msgid "in project/package owning current unit"
msgstr "в проекте/пакете, содержащем этот модуль"
#: lazarusidestrconsts.lisfriinvalididentifier
msgid "Invalid Identifier"
msgstr "Некорректный идентификатор"
#: lazarusidestrconsts.lisfrirenameallreferences
msgid "Rename all References"
msgstr "Переименовать все ссылки"
#: lazarusidestrconsts.lisfrirenaming
msgid "Renaming"
msgstr "Переименование"
#: lazarusidestrconsts.lisfrisearch
msgid "Search"
msgstr "Поиск"
#: lazarusidestrconsts.lisfrisearchincommentstoo
msgid "Search in comments too"
msgstr "Искать и в комментариях"
#: lazarusidestrconsts.lisfull
msgid "Full"
msgstr "Полное"
#: lazarusidestrconsts.lisfunction
msgctxt "lazarusidestrconsts.lisfunction"
msgid "Function"
msgstr "Функция"
#: lazarusidestrconsts.lisgeneral
msgctxt "lazarusidestrconsts.lisgeneral"
msgid "General"
msgstr "Общие"
#: lazarusidestrconsts.lisgeneratefppkgcfg
#, object-pascal-format
msgid "Fppkg configuration: %s"
msgstr "Параметры Fppkg: %s"
#: lazarusidestrconsts.lisgeneratefppkgcompcfg
#, object-pascal-format
msgid "Fppkg compiler configuration: %s"
msgstr "Параметры Fppkg компилятора: %s"
#: lazarusidestrconsts.lisgeneratefppkgconfiguration
msgid "Use this screen to generate new Fppkg configuration files with the fpcmkcfg tool."
msgstr "Воспользуйтесь этим диалогом для создания новых файлов настройки Fppkg с помощью средства fpcmkcfg."
#: lazarusidestrconsts.lisgeneratefppkgconfigurationcaption
msgid "Generate new Fppkg configuration files"
msgstr "Создание новых файлов настройки Fppkg"
#: lazarusidestrconsts.lisgetbuildmodes
msgid "Print a list of build modes in the project. Active mode is listed first."
msgstr "Вывести список режимов сборки проекта. Активный режим выводится первым в списке."
#: lazarusidestrconsts.lisgetexpandtext
msgid "Print the result of substituting macros in the text. The absence of macros means the name of the macro. In case of an error, returns only the text with partially expanded macros and sets the error code (also for an empty string). Takes into account the active (or specified via --bm option) build mode."
msgstr "Вывести результат раскрытия макросов в тексте. При отсутствии макросов текст интерпретируется как имя макроса. При возникновении ошибки возвращается только текст с частично раскрытыми макросами и устанавливается код ошибки (в том числе для пустой строки). При обработке используется активный (или указанный через параметр --bm) режим сборки."
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition
msgid "get word at current cursor position"
msgstr "Возвратить слово в текущей позиции курсора"
#: lazarusidestrconsts.lisgetwordatcurrentcursorposition2
msgid "Get word at current cursor position."
msgstr "Возвратить слово в текущей позиции курсора."
#: lazarusidestrconsts.lisglobalsettings
msgid "Global settings"
msgstr "Глобальные параметры"
#: lazarusidestrconsts.lisgotoline
msgid "Goto Line"
msgstr "Переход к строке"
#: lazarusidestrconsts.lisgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. \n"
"\n"
"A copy of the GNU General Public License is available on the World Wide Web at <http://www.gnu.org/copyleft/gpl.html>. You can also obtain it by writing to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<одна строка с наименованием Программы и кратким описанием ее назначения>\n"
"\n"
"© <год первого опубликования программы> <имя (наименование) автора или иного правообладателя> <способ связи>\n"
"\n"
"Данная программа является свободным программным обеспечением. Вы вправе распространять её и/или модифицировать в соответствии с условиями версии 2 либо по вашему выбору с условиями более поздней версии Стандартной Общественной Лицензии GNU, опубликованной Free Software Foundation. \n"
"\n"
"Мы распространяем эту программу в надежде на то, что она будет вам полезной, однако НЕ ПРЕДОСТАВЛЯЕМ НА НЕЁ НИКАКИХ ГАРАНТИЙ, в том числе ГАРАНТИИ ТОВАРНОГО СОСТОЯНИЯ ПРИ ПРОДАЖЕ и ПРИГОДНОСТИ ДЛЯ ИСПОЛЬЗОВАНИЯ В КОНКРЕТНЫХ ЦЕЛЯХ. Для получения более подробной информации ознакомьтесь со Стандартной Общественной Лицензией GNU. \n"
"\n"
"Копия Стандартной Общественной Лицензии GNU доступна в Интернете по адресу <http://www.gnu.org/copyleft/gpl.html>. Вы также можете получить экземпляр в Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
#: lazarusidestrconsts.lisgroup
msgid "Group"
msgstr "Группа"
#: lazarusidestrconsts.lisgrouplocalvariables
msgid "Group automatically defined local variables"
msgstr "Группировать автоматически создаваемые объявления локальных переменных"
#: lazarusidestrconsts.lisgroupsfordebugoutput
msgid "Enable or disable groups of debug output. Valid options are:"
msgstr "Включить или отключить группы отладочного вывода. Возможные параметры:"
#: lazarusidestrconsts.lisgrowtolarges
msgid "Grow to Largest"
msgstr "Увеличить до наибольшего"
#: lazarusidestrconsts.lisgutterpartmargin
msgid "Margin"
msgstr "Отступ"
#: lazarusidestrconsts.lisgutterpartvisible
msgid "Visible"
msgstr "Отображать"
#: lazarusidestrconsts.lisgutterpartwidth
msgid "Width"
msgstr "Ширина"
#: lazarusidestrconsts.lishashelp
msgid "Has Help"
msgstr "Имеет справку"
#: lazarusidestrconsts.lisheadercolors
msgid "Header colors"
msgstr "Цвета заголовков"
#: lazarusidestrconsts.lisheadercommentforclass
msgid "Header comment for class"
msgstr "Комментарий перед заголовком класса"
#: lazarusidestrconsts.lishelpentries
msgid "Help entries"
msgstr "Элементы справки"
#: lazarusidestrconsts.lishelpselectordialog
msgid "Help selector"
msgstr "Выбор справки"
#: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage
msgid "Help for Free Pascal Compiler message"
msgstr "Справка по сообщению компилятора Free Pascal"
#: lazarusidestrconsts.lishideallhintsandwarningsbyinsertingidedirectivesh
msgid "Hide all hints and warnings by inserting IDE directives {%H-}"
msgstr "Скрыть все подсказки и предупреждения вставкой директив IDE {%H-}"
#: lazarusidestrconsts.lishidemessageatbyinsertingidedirectiveh
msgid "Hide message at %s by inserting IDE directive {%H-}"
msgstr "Скрыть сообщение в позиции %s вставкой директивы IDE {%H-}"
#: lazarusidestrconsts.lishidemessagebyinsertingidedirectiveh
msgid "Hide message by inserting IDE directive {%H-}"
msgstr "Скрыть сообщение вставкой директивы IDE {%H-}"
#: lazarusidestrconsts.lishidemessagebyinsertingwarnofftounit
#, object-pascal-format
msgid "Hide message by inserting {$warn %s off} to unit \"%s\""
msgstr "Скрыть сообщение вставкой {$warn %s off} в модуле \"%s\""
#: lazarusidestrconsts.lishidesearch
msgid "Hide Search"
msgstr "Скрыть средство поиска"
#: lazarusidestrconsts.lishidewindow
msgctxt "lazarusidestrconsts.lishidewindow"
msgid "Hide window"
msgstr "Скрывать окно"
#: lazarusidestrconsts.lishidewithpackageoptionvm
#, object-pascal-format
msgid "Hide with package option (-vm%s)"
msgstr "Скрыть с помощью параметра пакета (-vm%s)"
#: lazarusidestrconsts.lishidewithprojectoptionvm
#, object-pascal-format
msgid "Hide with project option (-vm%s)"
msgstr "Скрыть с помощью параметра проекта (-vm%s)"
#: lazarusidestrconsts.lishint
msgctxt "lazarusidestrconsts.lishint"
msgid "Hint"
msgstr "Подсказка"
#: lazarusidestrconsts.lishintadefaultvaluecanbedefinedintheconditionals
msgid "Hint: A default value can be defined in the conditionals."
msgstr "Подсказка: значение по умолчанию может быть задано условными определениями."
#: lazarusidestrconsts.lishintatpropertysnameshowsdescription
msgid "A hint at property's name shows its description."
msgstr "В подсказке, всплывающей над именем свойства, выводится его описание"
#: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename
msgid "Hint: Check if two packages contain a unit with the same name."
msgstr "Подсказка: проверьте, содержат ли два пакета модули с одинаковым именем."
#: lazarusidestrconsts.lishintclickonshowoptionstofindoutwhereinheritedpaths
msgid "Hint: Click on \"Show Options\" to find out where inherited paths are coming from."
msgstr "Подсказка: нажмите \"Показать параметры\", чтобы выяснить, откуда были взяты унаследованные пути."
#: lazarusidestrconsts.lishints
#, object-pascal-format
msgid ", Hints: %s"
msgstr ", подсказок: %s"
#: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon
#, object-pascal-format
msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again."
msgstr "Подсказка: функция \"Создать строку ресурсов\" требует строковой константы.%sВыберите выражение и попробуйте снова."
#: lazarusidestrconsts.lishintviewforms
msgid "View Forms"
msgstr "Показать формы"
#: lazarusidestrconsts.lishintviewunits
msgid "View Units"
msgstr "Показать модули"
#: lazarusidestrconsts.lishlpoptsdatabases
msgid "Databases"
msgstr "Базы данных"
#: lazarusidestrconsts.lishlpoptshelpoptions
msgid "Help Options"
msgstr "Параметры справки"
#: lazarusidestrconsts.lishlpoptsproperties
msgid "Properties:"
msgstr "Свойства:"
#: lazarusidestrconsts.lishlpoptsviewers
msgid "Viewers"
msgstr "Программы просмотра"
#: lazarusidestrconsts.lishofpcdochtmlpath
msgid "FPC Doc HTML Path"
msgstr "Путь к HTML-документации FPC"
#: lazarusidestrconsts.lishorizontal
msgid "Horizontal"
msgstr "По горизонтали"
#: lazarusidestrconsts.lishorizontallinesbetweenproperties
msgid "Horizontal lines between properties."
msgstr "Горизонтальные линии между свойствами"
#: lazarusidestrconsts.lisid
msgctxt "lazarusidestrconsts.lisid"
msgid "ID"
msgstr "Идентификатор"
#: lazarusidestrconsts.lisidcaddition
msgid "Addition"
msgstr "Добавление"
#: lazarusidestrconsts.lisidcopening
msgid "Opening"
msgstr "Открытие"
#: lazarusidestrconsts.liside
msgid "IDE"
msgstr "IDE"
#: lazarusidestrconsts.lisidebuildoptions
msgid "IDE build options"
msgstr "Параметры сборки IDE"
#: lazarusidestrconsts.lisidecaptioncustomhint
msgid "Additional info to display in the IDE title"
msgstr "Дополнительные сведения для отображения в заголовке IDE"
#: lazarusidestrconsts.lisidecompileandrestart
msgid "The IDE will be recompiled and restarted during installation/uninstallation of packages."
msgstr "При установке/удалении пакетов IDE будет пересобрана и перезапущена."
#: lazarusidestrconsts.lisideconficurationfoundmaybelongtootherlazarus
#, object-pascal-format
msgid "Welcome to Lazarus.%0:sThe IDE configuration found was previously used by another installation of Lazarus.%0:sIf you have two or more separate installations of Lazarus, they should not share the same configuration. This may lead to conflicts and your Lazarus installations may become unusable.%0:s%0:sIf you have only one installation and copied or moved the Lazarus executable, then you may upgrade this configuration.%0:s%1:s%0:s%0:sChoose:%0:s%0:s* Update info: Use this configuration and update it for being used with this Lazarus in future. The old installation will no longer use this.%0:s* Ignore: Use this configuration but keep the warning. This may lead to conflicts with the other installation.%0:s* Abort: Exit now. You can then fix the problem by starting this Lazarus with the correct configuration.%0:s%0:sAdditional information:%0:sThis configuration is at: %2:s%0:sIt belongs to the Lazarus installation at: %3:s%0:sThe current IDE was started from: %4:s%0:s"
msgstr "Добро пожаловать в Lazarus.%0:sНайденный каталог настройки использовался другим экземпляром Lazarus.%0:sДва или более экземпляра Lazarus не должны иметь общий каталог настройки. Это может привести к конфликтам и невозможности использования IDE.%0:s%0:sЕсли вы имеете только один экземпляр и скопировали либо переместили исполнимый файл Lazarus, каталог настройки можно обновить.%0:s%1:s%0:s%0:sВыберите:%0:s%0:s* Обновить данные: Использовать этот каталог настройки и обновить его. Старый экземпляр Lazarus больше не будет его использовать.%0:s* Пропустить: Использовать этот каталог настройки, но предупредить в дальнейшем. Это может привести к конфликтам с другими экземплярами Lazarus.%0:s* Прервать: Завершить работу. Проблему можно будет исправить, запустив Lazarus с указанием корректного каталога настройки.%0:s%0:sДополнительные сведения:%0:sПуть к каталогу настройки: %2:s%0:sЭкземпляр Lazarus, владеющий им: %3:s%0:sПуть запуска текущего экземпляра IDE: %4:s%0:s"
#: lazarusidestrconsts.lisideinfoinformationabouttheide
msgid "Information about the IDE"
msgstr "Сведения об IDE"
#: lazarusidestrconsts.lisidemacros
msgid "IDE Macros"
msgstr "Макросы IDE"
#: lazarusidestrconsts.lisidemaintainsscaledinmainunit
msgid "The IDE maintains Application.Scaled (Hi-DPI) in main unit."
msgstr "IDE сохраняет Application.Scaled (Hi-DPI) в главном модуле"
#: lazarusidestrconsts.lisidemaintainsthetitleinmainunit
msgid "The IDE maintains the title in main unit."
msgstr "IDE сохраняет заголовок в главном модуле"
#: lazarusidestrconsts.lisidentifier
msgid "identifier"
msgstr "идентификатор"
#: lazarusidestrconsts.lisidentifierbeginswith
msgid "Identifier begins with ..."
msgstr "Идентификатор начинается с ..."
#: lazarusidestrconsts.lisidentifiercontains
msgid "Identifier contains ..."
msgstr "Идентификатор содержит ..."
#: lazarusidestrconsts.lisideoptions
msgid "IDE Options:"
msgstr "Параметры IDE:"
#: lazarusidestrconsts.lisidetitlecustom
msgid "Custom IDE title"
msgstr "Пользовательский заголовок IDE"
#: lazarusidestrconsts.lisidetitleoptions
msgid "IDE main window and taskbar title"
msgstr "Заголовок IDE в главном окне и в панели задач"
#: lazarusidestrconsts.lisidetitlestartswithprojectname
msgid "Show custom IDE title before built-in IDE title or info"
msgstr "Показывать пользовательский заголовок перед встроенным в IDE и иными сведениями"
#: lazarusidestrconsts.lisiecoallbuildmodes
msgid "All build modes"
msgstr "всех режимов сборки"
#: lazarusidestrconsts.lisiecocompileroptionsof
msgid "Compiler options of"
msgstr "Параметры компилятора"
#: lazarusidestrconsts.lisiecocurrentbuildmode
msgid "Current build mode"
msgstr "текущего режима сборки"
#: lazarusidestrconsts.lisiecoerroropeningxml
msgid "Error opening XML"
msgstr "Ошибка при открытии XML"
#: lazarusidestrconsts.lisiecoerroropeningxmlfile
#, object-pascal-format
msgid "Error opening XML file \"%s\":%s%s"
msgstr "Ошибка при открытии файла XML \"%s\":%s%s"
#: lazarusidestrconsts.lisiecoexportcompileroptions
msgid "Export Compiler Options"
msgstr "Экспорт параметров компилятора"
#: lazarusidestrconsts.lisiecoexportfileexists
msgid "Export file exists"
msgstr "Файл экспорта уже существует"
#: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti
#, object-pascal-format
msgid "Export file \"%s\" exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)"
msgstr "Файл экспорта \"%s\" уже существует.%sОткрыть его и заменить только параметры компилятора?%s(Остальные параметры не будут затронуты.)"
#: lazarusidestrconsts.lisiecoimportcompileroptions
msgid "Import Compiler Options"
msgstr "Импорт параметров компилятора"
#: lazarusidestrconsts.lisiecoloadfromfile
msgid "Load from file"
msgstr "Загрузить из файла"
#: lazarusidestrconsts.lisieconocompileroptionsinfile
#, object-pascal-format
msgid "File \"%s\" does not contain compiler options."
msgstr "Файл \"%s\" не содержит параметров компилятора."
#: lazarusidestrconsts.lisiecosavetofile
msgid "Save to file"
msgstr "Сохранить в файл"
#: lazarusidestrconsts.lisifnotchecked
msgid "If not checked:"
msgstr "если не отмечен:"
#: lazarusidestrconsts.lisifonlysessioninfochangedthenask
msgid "If only the session info changed, ask about saving it."
msgstr "Если изменились только сведения о сеансе работы, спрашивать перед их сохранением"
#: lazarusidestrconsts.lisifyouwanttousetwodifferentlazarusversionsyoumustst
#, object-pascal-format
msgid "If you want to use two different Lazarus versions you must start the second Lazarus with the command line parameter primary-config-path or pcp.%sFor example:"
msgstr "Если вы хотите использовать два экземпляра Lazarus разных версий, второй экземпляр Lazarus следует запускать с параметром командной строки primary-config-path или pcp.%sНапример:"
#: lazarusidestrconsts.lisignoreall
msgid "Ignore all"
msgstr "Игнорировать все"
#: lazarusidestrconsts.lisignoreuseasancestor
#, object-pascal-format
msgid "Ignore, use %s as ancestor"
msgstr "Игнорировать, использовать %s как предка"
#: lazarusidestrconsts.lisimitateindentationofcurrentunitprojectorpackage
msgid "Imitate indentation of current unit, project or package"
msgstr "Следовать отступам в текущем модуле, проекте или пакете"
#: lazarusidestrconsts.lisimplementationcommentforclass
msgid "Implementation comment for class"
msgstr "Комментарий перед реализацией класса"
#: lazarusidestrconsts.lisimport
msgctxt "lazarusidestrconsts.lisimport"
msgid "Import"
msgstr "Импортировать"
#: lazarusidestrconsts.lisimportant
msgctxt "lazarusidestrconsts.lisimportant"
msgid "Important"
msgstr "Важное"
#: lazarusidestrconsts.lisimportenvironmentoptions
msgctxt "lazarusidestrconsts.lisimportenvironmentoptions"
msgid "Import environment options"
msgstr "Импортировать параметры окружения"
#: lazarusidestrconsts.lisimportfromfile
msgid "Import from File"
msgstr "Импортировать из файла"
#: lazarusidestrconsts.lisimportingbuildmodesnotsupported
msgid "Importing BuildModes is not supported for packages."
msgstr "Импорт режимов сборки не поддерживается для пакетов."
#: lazarusidestrconsts.lisimportpackagelistxml
msgid "Import package list"
msgstr "Импорт списка пакетов"
#: lazarusidestrconsts.lisimpossible
msgid "Impossible"
msgstr "Невозможно"
#: lazarusidestrconsts.lisinasourcedirectoryofthepackage
#, object-pascal-format
msgid "In a source directory of the package \"%s\"."
msgstr "В каталоге исходного кода пакета \"%s\"."
#: lazarusidestrconsts.lisinasourcedirectoryoftheprojectcheckforduplicates
msgid "In a source directory of the project. Check for duplicates."
msgstr "В каталоге исходного кода проекта. Проверьте наличие дублирующихся файлов."
#: lazarusidestrconsts.lisincludepath
msgid "include path"
msgstr "пути к включаемым файлам"
#: lazarusidestrconsts.lisincludepaths
msgid "Include paths"
msgstr "Пути к включаемым файлам"
#: lazarusidestrconsts.lisincluderecursive
msgid "Include, recursive"
msgstr "Добавить, рекурсивно"
#: lazarusidestrconsts.lisincompatibleppu
#, object-pascal-format
msgid ", incompatible ppu=%s"
msgstr ", несовместимый PPU=%s"
#: lazarusidestrconsts.lisincorrectconfigurationdirectoryfound
msgid "Incorrect configuration directory found"
msgstr "Найден неверный каталог настройки"
#: lazarusidestrconsts.lisincorrectfppkgconfiguration
#, object-pascal-format
msgid "there is a problem with the Fppkg configuration. (%s)"
msgstr "в файлах настройки Fppkg имеются проблемы. (%s)"
#: lazarusidestrconsts.lisindentationforpascalsources
msgid "Indentation for Pascal sources"
msgstr "Отступы исходного кода на Паскале"
#: lazarusidestrconsts.lisinformation
msgid "Information"
msgstr "Сведения"
#: lazarusidestrconsts.lisinformationaboutunit
#, object-pascal-format
msgid "Information about %s"
msgstr "Сведения о %s"
#: lazarusidestrconsts.lisinformationaboutusedfpc
msgid "Information about used FPC"
msgstr "Сведения об используемом компиляторе FPC"
#: lazarusidestrconsts.lisinfpcunitsearchpathprobablyinstalledbythefpcpackag
msgid "In FPC unit search path. Probably installed by the FPC package. Check if the compiler and the ppu file are from the same installation."
msgstr "В списке путей поиска модулей FPC. Возможно, установлен пакетом FPC. Проверьте, что компилятор и файл PPU принадлежат одной установке."
#: lazarusidestrconsts.lisinfrontofrelated
msgid "In front of related"
msgstr "Перед связанными"
#: lazarusidestrconsts.lisinheriteditem
msgid "Inherited Item"
msgstr "Унаследованный объект"
#: lazarusidestrconsts.lisinheritedparameters
msgid "Inherited parameters"
msgstr "Унаследованные параметры"
#: lazarusidestrconsts.lisinheritedprojectcomponent
msgid "Inherited project component"
msgstr "Унаследованный от компонента проекта"
#: lazarusidestrconsts.lisinitialchecks
msgid "Initial Checks"
msgstr "Начальные проверки"
#: lazarusidestrconsts.lisinitializelocalvariable
msgid "Initialize Local Variable"
msgstr "Инициализация локальной переменной"
#: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil
#, object-pascal-format
msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%sDelete all files in \"%s\"?"
msgstr "При создании очищенной копии проекта/пакета все файлы в следующем каталоге будут удалены, и всё их содержимое будет утеряно.%sУдалить все файлы в \"%s\"?"
#: lazarusidestrconsts.lisinsert
msgctxt "lazarusidestrconsts.lisinsert"
msgid "Insert"
msgstr "Вставить"
#: lazarusidestrconsts.lisinsertassignment
#, object-pascal-format
msgid "Insert Assignment %s := ..."
msgstr "Вставить присваивание %s := ..."
#: lazarusidestrconsts.lisinsertdate
msgid "insert date"
msgstr "Вставить дату"
#: lazarusidestrconsts.lisinsertdateandtime
msgid "insert date and time"
msgstr "Вставить дату и время"
#: lazarusidestrconsts.lisinsertdateandtimeoptionalformatstring
msgid "Insert date and time. Optional: format string."
msgstr "Вставить дату и время. Возможно форматирование строки."
#: lazarusidestrconsts.lisinsertdateoptionalformatstring
msgid "Insert date. Optional: format string."
msgstr "Вставить дату. Возможно форматирование строки."
#: lazarusidestrconsts.lisinsertendifneeded
msgid "insert end if needed"
msgstr "Вставить при необходимости слово 'end'"
#: lazarusidestrconsts.lisinsertheaderofcurrentprocedure
msgid ""
"Insert header of current procedure.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithStart, // proc keyword e.g. 'function', 'class procedure'\n"
"WithoutClassKeyword,// without 'class' proc keyword\n"
"AddClassName, // extract/add ClassName.\n"
"WithoutClassName, // skip classname\n"
"WithoutName, // skip function name\n"
"WithoutParamList, // skip param list\n"
"WithVarModifiers, // extract 'var', 'out', 'const'\n"
"WithParameterNames, // extract parameter names\n"
"WithoutParamTypes, // skip colon, param types and default values\n"
"WithDefaultValues, // extract default values\n"
"WithResultType, // extract colon + result type\n"
"WithOfObject, // extract 'of object'\n"
"WithCallingSpecs, // extract cdecl; inline;\n"
"WithProcModifiers, // extract forward; alias; external;\n"
"WithComments, // extract comments and spaces\n"
"InUpperCase, // turn to uppercase\n"
"CommentsToSpace, // replace comments with a single space\n"
" // (default is to skip unnecessary space,\n"
" // e.g 'Do ;' normally becomes 'Do;'\n"
" // with this option you get 'Do ;')\n"
"WithoutBrackets, // skip start- and end-bracket of parameter list\n"
"WithoutSemicolon, // skip semicolon at end\n"
msgstr ""
"Вставить заголовок текущей процедуры.\n"
"\n"
"Необязательные параметры (разделяются запятыми):\n"
"WithStart, // ключевое слово, например, 'function', 'class procedure'\n"
"WithoutClassKeyword,// опустить ключевое слово 'class'\n"
"AddClassName, // извлечь/добавить имя класса\n"
"WithoutClassName, // опустить имя класса\n"
"WithoutName, // опустить имя функции\n"
"WithoutParamList, // опустить список параметров\n"
"WithVarModifiers, // извлечь 'var', 'out', 'const'\n"
"WithParameterNames, // извлечь имена параметров\n"
"WithoutParamTypes, // опустить двоеточие, типы параметров и значения по умолчанию\n"
"WithDefaultValues, // извлечь значения по умолчанию\n"
"WithResultType, // извлечь двоеточие + тип результата\n"
"WithOfObject, // извлечь 'of object'\n"
"WithCallingSpecs, // извлечь cdecl; inline;\n"
"WithProcModifiers, // извлечь forward; alias; external;\n"
"WithComments, // извлечь комментарии и пробелы\n"
"InUpperCase, // преобразовать в верхний регистр\n"
"CommentsToSpace, // заменить комментарии единственным пробелом\n"
" // (по умолчанию лишние пробелы опускаются,\n"
" // например, 'Do ;' обычно преобразуется в 'Do;',\n"
" // а с этим параметром вы получите 'Do ;')\n"
"WithoutBrackets, // опустить открывающую и закрывающую скобки списка параметров\n"
"WithoutSemicolon, // опустить точку с запятой в конце\n"
#: lazarusidestrconsts.lisinsertmacro
msgctxt "lazarusidestrconsts.lisinsertmacro"
msgid "Insert Macro"
msgstr "Вставить макрос"
#: lazarusidestrconsts.lisinsertnameofcurrentprocedure
msgid "Insert name of current procedure."
msgstr "Вставить имя текущей процедуры."
#: lazarusidestrconsts.lisinsertprintshorttag2
msgid "Insert printshort tag"
msgstr "Вставить тег вывода краткого описания"
#: lazarusidestrconsts.lisinsertprocedurehead
msgid "insert procedure head"
msgstr "Вставить заголовок процедуры"
#: lazarusidestrconsts.lisinsertprocedurename
msgid "insert procedure name"
msgstr "Вставить имя процедуры"
#: lazarusidestrconsts.lisinsertsemicolonifneeded
msgid "Insert semicolon if needed"
msgstr "Вставить при необходимости точку с запятой"
#: lazarusidestrconsts.lisinserttime
msgid "insert time"
msgstr "Вставить время"
#: lazarusidestrconsts.lisinserttimeoptionalformatstring
msgid "Insert time. Optional: format string."
msgstr "Вставить время. Возможно форматирование строки."
#: lazarusidestrconsts.lisinserturltag
msgid "Insert url tag"
msgstr "Вставить тег URL"
#: lazarusidestrconsts.lisinsession
msgid "In session"
msgstr "В сеансе"
#: lazarusidestrconsts.lisinstalled
msgid "installed"
msgstr "установлен"
#: lazarusidestrconsts.lisinstallitilikethefat
msgid "Install it, I like the fat"
msgstr "Установить, я люблю полных"
#: lazarusidestrconsts.lisinstallpackagesmsg
#, object-pascal-format
msgid ""
"The following packages are not installed, but available in the main repository: %s.\n"
"Do you wish to install missing packages?"
msgstr ""
"Следующие пакеты не установлены, но доступны в главном репозитории: %s.\n"
"Хотите установить их?"
#: lazarusidestrconsts.lisinstallselection
msgid "Install selection"
msgstr "Установить выбранное"
#: lazarusidestrconsts.lisinstalluninstallpackages
msgctxt "lazarusidestrconsts.lisinstalluninstallpackages"
msgid "Install/Uninstall Packages"
msgstr "Установка/удаление пакетов"
#: lazarusidestrconsts.lisinsteadofcompilepackagecreateasimplemakefile
msgid "Instead of compiling a package create a simple Makefile."
msgstr "Вместо компиляции пакета создать простой Makefile."
#: lazarusidestrconsts.lisinsufficientencoding
msgid "Insufficient encoding"
msgstr "Неподходящая кодировка"
#: lazarusidestrconsts.lisinteractive
msgid "Interactive"
msgstr "Интерактивный режим"
#: lazarusidestrconsts.lisinternalerror
#, object-pascal-format
msgid "internal error: %s"
msgstr "внутренняя ошибка: %s"
#: lazarusidestrconsts.lisinvaliddelete
msgid "Invalid delete"
msgstr "Недопустимое удаление"
#: lazarusidestrconsts.lisinvalidexecutable
msgid "Invalid Executable"
msgstr "Некорректный исполнимый файл"
#: lazarusidestrconsts.lisinvalidexecutablemessagetext
#, object-pascal-format
msgid "The file \"%s\" is not executable."
msgstr "Файл \"%s\" не является исполнимым."
#: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction
#, object-pascal-format
msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again."
msgstr "Неверное выражение.%sПодсказка: функция \"Создать строку ресурсов\" требует строковую константу в одном файле. Выделите выражение и попробуйте ещё."
#: lazarusidestrconsts.lisinvalidfilename
msgid "Invalid file name"
msgstr "Некорректное имя файла"
#: lazarusidestrconsts.lisinvalidfilter
msgid "Invalid filter"
msgstr "Неверный фильтр"
#: lazarusidestrconsts.lisinvalidlinecolumninmessage
#, object-pascal-format
msgid "Invalid line, column in message%s%s"
msgstr "Неверные строка, столбец в сообщении%s%s"
#: lazarusidestrconsts.lisinvalidmacrosin
#, object-pascal-format
msgid "Invalid macros in \"%s\""
msgstr "Некорректный макрос в \"%s\""
#: lazarusidestrconsts.lisinvalidmacrosinexternaltool
#, object-pascal-format
msgid "Invalid macros \"%s\" in external tool \"%s\""
msgstr "Некорректный макрос \"%s\" внешнего средства \"%s\""
#: lazarusidestrconsts.lisinvalidmacrothemacromustbeapascalidentifie
#, object-pascal-format
msgid "Invalid macro \"%s\". The macro name must be a Pascal identifier."
msgstr "Макрос \"%s\" некорректен. Его имя должно являться идентификатором Паскаля."
#: lazarusidestrconsts.lisinvalidmacrothenameisakeyword
#, object-pascal-format
msgid "Invalid macro name \"%s\". The name is a keyword."
msgstr "Имя макроса \"%s\" некорректно. Оно является ключевым словом."
#: lazarusidestrconsts.lisinvalidmask
msgid "Invalid Mask"
msgstr "Некорректная маска"
#: lazarusidestrconsts.lisinvalidmode
#, object-pascal-format
msgid "Invalid mode %s"
msgstr "Режим %s некорректен"
#: lazarusidestrconsts.lisinvalidmultiselection
msgid "Invalid multiselection"
msgstr "Неверное множественное выделение"
#: lazarusidestrconsts.lisinvalidpascalidentifiercap
msgid "Invalid Pascal Identifier"
msgstr "Некорректный идентификатор Паскаля"
#: lazarusidestrconsts.lisinvalidpascalidentifiername
#, object-pascal-format
msgid "The name \"%s\" is not a valid Pascal identifier.%sUse it anyway?"
msgstr "Имя \"%s\" не является корректным идентификатором Паскаля.%sИспользовать его несмотря на это?"
#: lazarusidestrconsts.lisinvalidprocname
msgid "Invalid proc name"
msgstr "Неверное имя процедуры"
#: lazarusidestrconsts.lisinvalidprojectfilename
msgid "Invalid project filename"
msgstr "Неверное имя файла проекта"
#: lazarusidestrconsts.lisinvalidpublishingdirectory
msgid "Invalid publishing Directory"
msgstr "Неверный каталог публикации"
#: lazarusidestrconsts.lisinvalidselection
msgid "Invalid selection"
msgstr "Неверное выделение"
#: lazarusidestrconsts.lisinvalidversionin
#, object-pascal-format
msgid "invalid version in %s"
msgstr "в файле %s указана некорректная версия"
#: lazarusidestrconsts.lisisalreadypartoftheproject
#, object-pascal-format
msgid "%s is already part of the Project."
msgstr "%s уже принадлежит проекту."
#: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject
#, object-pascal-format
msgid "\"%s\" is an invalid project name.%sPlease choose another (e.g. project1.lpi)"
msgstr "\"%s\" не является корректным именем проекта.%sВыберите другое (например, project1.lpi)."
#: lazarusidestrconsts.lisisathiscirculardependencyisnotallowed
#, object-pascal-format
msgid "%s is a %s.%sThis circular dependency is not allowed."
msgstr "%s является %s.%sТакой порочный круг зависимостей недопустим."
#: lazarusidestrconsts.lisisddirectorynotfound
msgid "directory not found"
msgstr "каталог не найден"
#: lazarusidestrconsts.lisissues
msgid "Issues"
msgstr "Ограничения"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthe
#, object-pascal-format
msgid "I wonder how you did that. Error in the %s:"
msgstr "Интересно, как вам удалось добиться такого. Ошибка в %s:"
#: lazarusidestrconsts.lisiwonderhowyoudidthaterrorinthebasedirectory
msgid "I wonder how you did that: Error in the base directory:"
msgstr "Интересно, как вам удалось добиться такого. Ошибка в пути к базовому каталогу:"
#: lazarusidestrconsts.lisjhjumphistory
msgctxt "lazarusidestrconsts.lisjhjumphistory"
msgid "Jump History"
msgstr "История переходов"
#: lazarusidestrconsts.lisjumptoerror
msgid "Jump to error"
msgstr "Переходить к ошибке"
#: lazarusidestrconsts.lisjumptoerroratidentifiercompletion
msgid "When an error in the sources is found at identifier completion, jump to it."
msgstr "Переходить к ошибке, обнаруженной в исходном коде при завершении идентификатора."
#: lazarusidestrconsts.lisjumptoprocedure
#, object-pascal-format
msgid "Jump to procedure %s"
msgstr "Перейти к процедуре %s"
#: lazarusidestrconsts.liskb
#, object-pascal-format
msgid "%s KB"
msgstr "%s кБ"
#: lazarusidestrconsts.liskeep2
msgid "Keep"
msgstr "Оставить"
#: lazarusidestrconsts.liskeepfileopen
msgid "Keep converted files open in editor"
msgstr "Оставлять преобразованные файлы открытыми в редакторе"
#: lazarusidestrconsts.liskeepfileopenhint
msgid "All project files will be open in editor after conversion"
msgstr "Все файлы проекта будут открыты в редакторе после преобразования"
#: lazarusidestrconsts.liskeepname
msgid "Keep name"
msgstr "Сохранить имя"
#: lazarusidestrconsts.liskeepopen
msgid "Keep open"
msgstr "Оставить открытым"
#: lazarusidestrconsts.liskeeprelativeindentationofmultilinetemplate
msgid "Keep absolute indentation, regardless of the current cursor indentation in the text."
msgstr "Сохранять абсолютные значения отступов независимо от положения курсора в тексте."
#: lazarusidestrconsts.liskeepsubindentation
msgid "Absolute indentation"
msgstr "Абсолютные отступы"
#: lazarusidestrconsts.liskeepthemandcontinue
msgid "Keep them and continue"
msgstr "Оставить их и продолжить"
#: lazarusidestrconsts.liskey
msgctxt "lazarusidestrconsts.liskey"
msgid "Key"
msgstr "Ключ"
#: lazarusidestrconsts.liskeycatcustom
msgid "Custom commands"
msgstr "Команды пользователя"
#: lazarusidestrconsts.liskeycatdesigner
msgid "Designer commands"
msgstr "Команды редактора форм"
#: lazarusidestrconsts.liskeycatobjinspector
msgid "Object Inspector commands"
msgstr "Команды инспектора объектов"
#: lazarusidestrconsts.liskeyor2keysequence
msgid "Key (or 2 key sequence)"
msgstr "Клавиша (или двухклавишная комбинация)"
#: lazarusidestrconsts.liskmabortbuilding
msgid "Abort building"
msgstr "Прервать сборку"
#: lazarusidestrconsts.liskmaddbpaddress
msgid "Add Address Breakpoint"
msgstr "Добавить точку останова по адресу"
#: lazarusidestrconsts.liskmaddbpsource
msgid "Add Source Breakpoint"
msgstr "Добавить точку останова в исходном коде"
#: lazarusidestrconsts.liskmaddbpwatchpoint
msgid "Add Data/WatchPoint"
msgstr "Добавить точку останова с наблюдением"
#: lazarusidestrconsts.liskmaddwatch
msgctxt "lazarusidestrconsts.liskmaddwatch"
msgid "Add watch"
msgstr "Добавить наблюдение"
#: lazarusidestrconsts.liskmbuildmanymodes
msgid "Build many modes"
msgstr "Собрать в нескольких режимах"
#: lazarusidestrconsts.liskmbuildprojectprogram
msgid "Build project/program"
msgstr "Собрать проект/программу"
#: lazarusidestrconsts.liskmchoosekeymappingscheme
msgid "Choose Keymapping scheme"
msgstr "Выберите схему комбинаций клавиш"
#: lazarusidestrconsts.liskmclassic
msgid "Classic"
msgstr "Классическая"
#: lazarusidestrconsts.liskmcleanupandbuild
msgctxt "lazarusidestrconsts.liskmcleanupandbuild"
msgid "Clean up and build"
msgstr "Очистить и собрать"
#: lazarusidestrconsts.liskmcloseproject
msgid "Close project"
msgstr "Закрыть проект"
#: lazarusidestrconsts.liskmcodetoolsdefineseditor
msgid "CodeTools defines editor"
msgstr "Редактор определений CodeTools"
#: lazarusidestrconsts.liskmcompileprojectprogram
msgid "Compile project/program"
msgstr "Компилировать проект/программу"
#: lazarusidestrconsts.liskmconfigbuildfile
msgid "Config \"Build File\""
msgstr "Параметры \"сборки файла\""
#: lazarusidestrconsts.liskmconfigurecustomcomponents
msgid "Configure Custom Components"
msgstr "Настройка пользовательских компонентов"
#: lazarusidestrconsts.liskmcontextsensitivehelp
msgid "Context sensitive help"
msgstr "Контекстно-зависимая справка"
#: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage
msgid "Convert Delphi package to Lazarus package"
msgstr "Преобразовать пакет Delphi в пакет Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject
msgid "Convert Delphi Project to Lazarus Project"
msgstr "Преобразовать проект Delphi в проект Lazarus"
#: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit
msgid "Convert Delphi Unit to Lazarus Unit"
msgstr "Преобразовать модуль Delphi в модуль Lazarus"
#: lazarusidestrconsts.liskmconvertdfmfiletolfm
msgid "Convert DFM File to LFM"
msgstr "Преобразовать файл DFM в LFM"
#: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard
msgid "Copy selected components"
msgstr "Копировать выбранные компоненты"
#: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard
msgid "Cut selected components"
msgstr "Вырезать выбранные компоненты"
#: lazarusidestrconsts.liskmdefaulttoosx
msgid "Default adapted to macOS"
msgstr "Схема по умолчанию в адаптации для macOS"
#: lazarusidestrconsts.liskmdeletelastchar
msgid "Delete last char"
msgstr "Удалить последний символ"
#: lazarusidestrconsts.liskmdiffeditorfiles
msgid "Diff Editor Files"
msgstr "Сравнить открытые в редакторе файлы"
#: lazarusidestrconsts.liskmeditcodetemplates
msgid "Edit Code Templates"
msgstr "Редактировать шаблоны кода"
#: lazarusidestrconsts.liskmeditcontextsensitivehelp
msgid "Edit context sensitive help"
msgstr "Редактировать контекстно-зависимую справку"
#: lazarusidestrconsts.liskmencloseselection
msgid "Enclose Selection"
msgstr "Заключить выделенное"
#: lazarusidestrconsts.liskmevaluatemodify
msgid "Evaluate/Modify"
msgstr "Вычислить/Изменить"
#: lazarusidestrconsts.liskmexternaltoolssettings
msgid "External Tools settings"
msgstr "Настройка внешних средств"
#: lazarusidestrconsts.liskmfindincremental
msgid "Find Incremental"
msgstr "Найти инкрементно"
#: lazarusidestrconsts.liskmgotomarker0
msgid "Go to bookmark 0"
msgstr "Перейти к закладке 0"
#: lazarusidestrconsts.liskmgotomarker1
msgid "Go to bookmark 1"
msgstr "Перейти к закладке 1"
#: lazarusidestrconsts.liskmgotomarker2
msgid "Go to bookmark 2"
msgstr "Перейти к закладке 2"
#: lazarusidestrconsts.liskmgotomarker3
msgid "Go to bookmark 3"
msgstr "Перейти к закладке 3"
#: lazarusidestrconsts.liskmgotomarker4
msgid "Go to bookmark 4"
msgstr "Перейти к закладке 4"
#: lazarusidestrconsts.liskmgotomarker5
msgid "Go to bookmark 5"
msgstr "Перейти к закладке 5"
#: lazarusidestrconsts.liskmgotomarker6
msgid "Go to bookmark 6"
msgstr "Перейти к закладке 6"
#: lazarusidestrconsts.liskmgotomarker7
msgid "Go to bookmark 7"
msgstr "Перейти к закладке 7"
#: lazarusidestrconsts.liskmgotomarker8
msgid "Go to bookmark 8"
msgstr "Перейти к закладке 8"
#: lazarusidestrconsts.liskmgotomarker9
msgid "Go to bookmark 9"
msgstr "Перейти к закладке 9"
#: lazarusidestrconsts.liskmgotosourceeditor1
msgid "Go to source editor 1"
msgstr "Перейти к редактору исходного кода 1"
#: lazarusidestrconsts.liskmgotosourceeditor10
msgid "Go to source editor 10"
msgstr "Перейти к редактору исходного кода 10"
#: lazarusidestrconsts.liskmgotosourceeditor2
msgid "Go to source editor 2"
msgstr "Перейти к редактору исходного кода 2"
#: lazarusidestrconsts.liskmgotosourceeditor3
msgid "Go to source editor 3"
msgstr "Перейти к редактору исходного кода 3"
#: lazarusidestrconsts.liskmgotosourceeditor4
msgid "Go to source editor 4"
msgstr "Перейти к редактору исходного кода 4"
#: lazarusidestrconsts.liskmgotosourceeditor5
msgid "Go to source editor 5"
msgstr "Перейти к редактору исходного кода 5"
#: lazarusidestrconsts.liskmgotosourceeditor6
msgid "Go to source editor 6"
msgstr "Перейти к редактору исходного кода 6"
#: lazarusidestrconsts.liskmgotosourceeditor7
msgid "Go to source editor 7"
msgstr "Перейти к редактору исходного кода 7"
#: lazarusidestrconsts.liskmgotosourceeditor8
msgid "Go to source editor 8"
msgstr "Перейти к редактору исходного кода 8"
#: lazarusidestrconsts.liskmgotosourceeditor9
msgid "Go to source editor 9"
msgstr "Перейти к редактору исходного кода 9"
#: lazarusidestrconsts.liskminsertdateandtime
msgid "Insert date and time"
msgstr "Вставить дату и время"
#: lazarusidestrconsts.liskminsertusername
msgid "Insert username"
msgstr "Вставить имя пользователя"
#: lazarusidestrconsts.liskminspect
msgid "Inspect"
msgstr "Просмотреть"
#: lazarusidestrconsts.liskmkeymappingscheme
msgid "Keymapping Scheme"
msgstr "Схема комбинаций клавиш"
#: lazarusidestrconsts.liskmlazarusdefault
msgid "Lazarus default"
msgstr "Схема Lazarus по умолчанию"
#: lazarusidestrconsts.liskmmacosxapple
msgid "macOS, Apple style"
msgstr "macOS, стиль Apple"
#: lazarusidestrconsts.liskmmacosxlaz
msgid "macOS, Lazarus style"
msgstr "macOS, стиль Lazarus"
#: lazarusidestrconsts.liskmnewpackage
msgctxt "lazarusidestrconsts.liskmnewpackage"
msgid "New package"
msgstr "Новый пакет"
#: lazarusidestrconsts.liskmnewproject
msgid "New project"
msgstr "Нрвый проект "
#: lazarusidestrconsts.liskmnewprojectfromfile
msgid "New project from file"
msgstr "Новый проект из файла"
#: lazarusidestrconsts.liskmnewunit
msgctxt "lazarusidestrconsts.liskmnewunit"
msgid "New Unit"
msgstr "Создать модуль"
#: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme
msgid "Note: All keys will be set to the values of the chosen scheme."
msgstr "Внимание: все клавиши получат значения выбранной схемы."
#: lazarusidestrconsts.liskmopenpackagefile
msgid "Open package file"
msgstr "Открыть файл пакета"
#: lazarusidestrconsts.liskmopenrecent
msgctxt "lazarusidestrconsts.liskmopenrecent"
msgid "Open Recent"
msgstr "Открыть недавний"
#: lazarusidestrconsts.liskmopenrecentpackage
msgid "Open recent package"
msgstr "Открыть недавний пакет"
#: lazarusidestrconsts.liskmopenrecentproject
msgid "Open recent project"
msgstr "Открыть недавний проект"
#: lazarusidestrconsts.liskmpastecomponentsfromclipboard
msgid "Paste Components"
msgstr "Вставить компоненты"
#: lazarusidestrconsts.liskmpauseprogram
msgid "Pause program"
msgstr "Приостановить программу"
#: lazarusidestrconsts.liskmpublishproject
msgid "Publish project"
msgstr "Опубликовать проект"
#: lazarusidestrconsts.liskmquickcompilenolinking
msgid "Quick compile, no linking"
msgstr "Быстрая компиляция, без компоновки"
#: lazarusidestrconsts.liskmremoveactivefilefromproject
msgid "Remove Active File from Project"
msgstr "Удалить текущий файл из проекта"
#: lazarusidestrconsts.liskmrunprogram
msgid "Run program"
msgstr "Запустить программу"
#: lazarusidestrconsts.liskmsaveall
msgctxt "lazarusidestrconsts.liskmsaveall"
msgid "Save All"
msgstr "Сохранить всё"
#: lazarusidestrconsts.liskmsaveas
msgid "Save As"
msgstr "Сохранить как"
#: lazarusidestrconsts.liskmsaveproject
msgid "Save project"
msgstr "Сохранить проект"
#: lazarusidestrconsts.liskmsaveprojectas
msgid "Save project as"
msgstr "Сохранить проект как"
#: lazarusidestrconsts.liskmselectlineend
msgctxt "lazarusidestrconsts.liskmselectlineend"
msgid "Select Line End"
msgstr "Выделить до конца строки"
#: lazarusidestrconsts.liskmselectlinestart
msgctxt "lazarusidestrconsts.liskmselectlinestart"
msgid "Select Line Start"
msgstr "Выделить до начала строки"
#: lazarusidestrconsts.liskmselectpagebottom
msgctxt "lazarusidestrconsts.liskmselectpagebottom"
msgid "Select Page Bottom"
msgstr "Выделить страницу снизу"
#: lazarusidestrconsts.liskmselectpagetop
msgctxt "lazarusidestrconsts.liskmselectpagetop"
msgid "Select Page Top"
msgstr "Выделить страницу сверху"
#: lazarusidestrconsts.liskmselectwordleft
msgctxt "lazarusidestrconsts.liskmselectwordleft"
msgid "Select Word Left"
msgstr "Выделить слово слева"
#: lazarusidestrconsts.liskmselectwordright
msgctxt "lazarusidestrconsts.liskmselectwordright"
msgid "Select Word Right"
msgstr "Выделить слово справа"
#: lazarusidestrconsts.liskmsetfreebookmark
msgid "Set free Bookmark"
msgstr "Установить свободную закладку"
#: lazarusidestrconsts.liskmsetmarker0
msgid "Set bookmark 0"
msgstr "Добавить закладку 0"
#: lazarusidestrconsts.liskmsetmarker1
msgid "Set bookmark 1"
msgstr "Добавить закладку 1"
#: lazarusidestrconsts.liskmsetmarker2
msgid "Set bookmark 2"
msgstr "Добавить закладку 2"
#: lazarusidestrconsts.liskmsetmarker3
msgid "Set bookmark 3"
msgstr "Добавить закладку 3"
#: lazarusidestrconsts.liskmsetmarker4
msgid "Set bookmark 4"
msgstr "Добавить закладку 4"
#: lazarusidestrconsts.liskmsetmarker5
msgid "Set bookmark 5"
msgstr "Добавить закладку 5"
#: lazarusidestrconsts.liskmsetmarker6
msgid "Set bookmark 6"
msgstr "Добавить закладку 6"
#: lazarusidestrconsts.liskmsetmarker7
msgid "Set bookmark 7"
msgstr "Добавить закладку 7"
#: lazarusidestrconsts.liskmsetmarker8
msgid "Set bookmark 8"
msgstr "Добавить закладку 8"
#: lazarusidestrconsts.liskmsetmarker9
msgid "Set bookmark 9"
msgstr "Добавить закладку 9"
#: lazarusidestrconsts.liskmstopprogram
msgid "Stop Program"
msgstr "Остановить программу"
#: lazarusidestrconsts.liskmtogglebetweenunitandform
msgid "Toggle between Unit and Form"
msgstr "Переключиться между модулем и формой"
#: lazarusidestrconsts.liskmtogglemarker0
msgid "Toggle bookmark 0"
msgstr "Переключить закладку 0"
#: lazarusidestrconsts.liskmtogglemarker1
msgid "Toggle bookmark 1"
msgstr "Переключить закладку 1"
#: lazarusidestrconsts.liskmtogglemarker2
msgid "Toggle bookmark 2"
msgstr "Переключить закладку 2"
#: lazarusidestrconsts.liskmtogglemarker3
msgid "Toggle bookmark 3"
msgstr "Переключить закладку 3"
#: lazarusidestrconsts.liskmtogglemarker4
msgid "Toggle bookmark 4"
msgstr "Переключить закладку 4"
#: lazarusidestrconsts.liskmtogglemarker5
msgid "Toggle bookmark 5"
msgstr "Переключить закладку 5"
#: lazarusidestrconsts.liskmtogglemarker6
msgid "Toggle bookmark 6"
msgstr "Переключить закладку 6"
#: lazarusidestrconsts.liskmtogglemarker7
msgid "Toggle bookmark 7"
msgstr "Переключить закладку 7"
#: lazarusidestrconsts.liskmtogglemarker8
msgid "Toggle bookmark 8"
msgstr "Переключить закладку 8"
#: lazarusidestrconsts.liskmtogglemarker9
msgid "Toggle bookmark 9"
msgstr "Переключить закладку 9"
#: lazarusidestrconsts.liskmtoggleviewassembler
msgctxt "lazarusidestrconsts.liskmtoggleviewassembler"
msgid "View Assembler"
msgstr "Показать ассемблер"
#: lazarusidestrconsts.liskmtoggleviewbreakpoints
msgid "View Breakpoints"
msgstr "Показать точки останова"
#: lazarusidestrconsts.liskmtoggleviewcallstack
msgctxt "lazarusidestrconsts.liskmtoggleviewcallstack"
msgid "View Call Stack"
msgstr "Показать стек вызовов"
#: lazarusidestrconsts.liskmtoggleviewcodebrowser
msgid "Toggle view Code Browser"
msgstr "Показать браузер кода"
#: lazarusidestrconsts.liskmtoggleviewcodeexplorer
msgid "Toggle view Code Explorer"
msgstr "Показать обозреватель кода"
#: lazarusidestrconsts.liskmtoggleviewcomponentpalette
msgid "Toggle View Component Palette"
msgstr "Показывать палитру компонентов"
#: lazarusidestrconsts.liskmtoggleviewdebugevents
msgid "View Debuger Event Log"
msgstr "Показать журнал событий отладчика"
#: lazarusidestrconsts.liskmtoggleviewdebuggeroutput
msgid "View Debugger Output"
msgstr "Показать вывод отладчика"
#: lazarusidestrconsts.liskmtoggleviewdocumentationeditor
msgid "Toggle view Documentation Editor"
msgstr "Показать редактор документации"
#: lazarusidestrconsts.liskmtoggleviewhistory
msgctxt "lazarusidestrconsts.liskmtoggleviewhistory"
msgid "View History"
msgstr "Показать историю"
#: lazarusidestrconsts.liskmtoggleviewidespeedbuttons
msgid "Toggle view IDE speed buttons"
msgstr "Показывать кнопки быстрого запуска IDE"
#: lazarusidestrconsts.liskmtoggleviewlocalvariables
msgid "View Local Variables"
msgstr "Показать локальные переменные"
#: lazarusidestrconsts.liskmtoggleviewmemviewer
msgctxt "lazarusidestrconsts.liskmtoggleviewmemviewer"
msgid "View Mem viewer"
msgstr "Показать средство просмотра памяти"
#: lazarusidestrconsts.liskmtoggleviewmessages
msgid "Toggle view Messages"
msgstr "Показать окно сообщений"
#: lazarusidestrconsts.liskmtoggleviewobjectinspector
msgid "Toggle view Object Inspector"
msgstr "Показать инспектор объектов"
#: lazarusidestrconsts.liskmtoggleviewpseudoterminal
msgctxt "lazarusidestrconsts.liskmtoggleviewpseudoterminal"
msgid "View Console In/Output"
msgstr "Показать ввод/вывод в консоли"
#: lazarusidestrconsts.liskmtoggleviewregisters
msgid "View Registers"
msgstr "Показать регистры"
#: lazarusidestrconsts.liskmtoggleviewsearchresults
msgid "Toggle view Search Results"
msgstr "Показать результаты поиска"
#: lazarusidestrconsts.liskmtoggleviewsourceeditor
msgid "Toggle view Source Editor"
msgstr "Показать редактор исходного кода"
#: lazarusidestrconsts.liskmtoggleviewthreads
msgctxt "lazarusidestrconsts.liskmtoggleviewthreads"
msgid "View Threads"
msgstr "Показать потоки исполнения"
#: lazarusidestrconsts.liskmtoggleviewwatches
msgid "View Watches"
msgstr "Показать окно наблюдений"
#: lazarusidestrconsts.liskmviewjumphistory
msgid "View jump history"
msgstr "Показать историю переходов"
#: lazarusidestrconsts.liskmviewprojectoptions
msgid "View project options"
msgstr "Показать параметры проекта"
#: lazarusidestrconsts.liskmviewprojectsource
msgid "View Project Source"
msgstr "Показать исходный код проекта"
#: lazarusidestrconsts.liskmviewunitinfo
msgid "View Unit Info"
msgstr "Показать сведения о модуле"
#: lazarusidestrconsts.lislastopened
msgid "Last opened"
msgstr "Последнее открытие"
#: lazarusidestrconsts.lislaunchingapplicationinvalid
msgid "Launching application invalid"
msgstr "Запускающее приложение недопустимо"
#: lazarusidestrconsts.lislaunchingcmdline
msgid "Launching target command line"
msgstr "Командная строка для запуска"
#: lazarusidestrconsts.lislazarusdefault
msgid "Lazarus Default"
msgstr "Lazarus по умолчанию"
#: lazarusidestrconsts.lislazarusdirectory
msgid "Lazarus directory"
msgstr "Каталог Lazarus"
#: lazarusidestrconsts.lislazarusdirhint
#, object-pascal-format
msgid "Lazarus sources. This path is relative to primary config directory (%s)."
msgstr "Исходный код Lazarus. Путь указывается относительно первичного каталога настройки (%s)."
#: lazarusidestrconsts.lislazarusdiroverride
msgid "Directory to be used as a basedirectory."
msgstr "Каталог для использования в качестве базового."
#: lazarusidestrconsts.lislazaruseditorv
#, object-pascal-format
msgid "Lazarus IDE v%s"
msgstr "Lazarus IDE v%s"
#: lazarusidestrconsts.lislazaruside
msgid "Lazarus IDE"
msgstr "IDE Lazarus"
#: lazarusidestrconsts.lislazaruslanguageid
msgid "Lazarus language ID (e.g. en, de, br, fi)"
msgstr "Идентификатор языка Lazarus (пример: en, de, br, fi)"
#: lazarusidestrconsts.lislazaruslanguagename
msgid "Lazarus language name (e.g. english, deutsch)"
msgstr "Название языка Lazarus (пример: английский, немецкий)"
#: lazarusidestrconsts.lislazarusoptionsprojectfilename
msgid "lazarus [options] <project-filename>"
msgstr "lazarus [параметры] <имя файла проекта>"
#: lazarusidestrconsts.lislazbuild
msgid "lazbuild"
msgstr "Собрать с lazbuild"
#: lazarusidestrconsts.lislazbuildabochooseoutputdir
msgid "Choose output directory of the IDE executable "
msgstr "Выберите каталог для вывода исполнимого файла IDE "
#: lazarusidestrconsts.lislazbuildareyousureyouwanttodeletethisbuildprofile
msgid "Are you sure you want to delete this build profile?"
msgstr "Вы действительно хотите удалить этот профиль сборки?"
#: lazarusidestrconsts.lislazbuildbuildmany
msgid "Build Many"
msgstr "Собрать несколько"
#: lazarusidestrconsts.lislazbuildcommonsettings
msgid "Common Settings"
msgstr "Общие параметры"
#: lazarusidestrconsts.lislazbuildconfirmbuild
msgid "Confirm before build"
msgstr "Спрашивать перед пересборкой"
#: lazarusidestrconsts.lislazbuildconfirmdeletion
msgid "Confirm deletion"
msgstr "Подтвердите удаление"
#: lazarusidestrconsts.lislazbuilddebugide
msgid "Debug IDE"
msgstr "IDE в режиме отладки"
#: lazarusidestrconsts.lislazbuilddefines
msgid "Defines"
msgstr "Определения"
#: lazarusidestrconsts.lislazbuilddefineswithoutd
msgid "Defines without -d"
msgstr "Определения без -d"
#: lazarusidestrconsts.lislazbuildeditdefines
msgctxt "lazarusidestrconsts.lislazbuildeditdefines"
msgid "Edit Defines"
msgstr "Редактировать определения"
#: lazarusidestrconsts.lislazbuildeditlistofdefineswhichcanbeusedbyanyprofile
msgid "Edit list of defines which can be used by any profile"
msgstr "Редактировать список определений для использования любым профилем"
#: lazarusidestrconsts.lislazbuilderrorwritingfile
msgctxt "lazarusidestrconsts.lislazbuilderrorwritingfile"
msgid "Error writing file"
msgstr "Ошибка записи файла"
#: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow
#, object-pascal-format
msgid "%s%s%s%slazbuild is non interactive, aborting now."
msgstr "%s%s%s%slazbuild неинтерактивен, остановка."
#: lazarusidestrconsts.lislazbuildmanageprofiles
msgid "Manage Build Profiles"
msgstr "Управление профилями сборки"
#: lazarusidestrconsts.lislazbuildmanageprofiles2
msgid "Manage profiles"
msgstr "Управление профилями"
#: lazarusidestrconsts.lislazbuildnameoftheactiveprofile
msgid "Name of the active profile"
msgstr "Имя текущего профиля"
#: lazarusidestrconsts.lislazbuildnewprof
msgid "Add New Profile"
msgstr "Добавление нового профиля"
#: lazarusidestrconsts.lislazbuildnewprofinfo
msgid "Current build options will be associated with:"
msgstr "Текущие параметры сборки будут сохранены в профиле:"
#: lazarusidestrconsts.lislazbuildnormalide
msgid "Normal IDE"
msgstr "Обычная IDE"
#: lazarusidestrconsts.lislazbuildoptimizedide
msgid "Optimized IDE"
msgstr "IDE с оптимизацией"
#: lazarusidestrconsts.lislazbuildoptions
msgid "Options:"
msgstr "Параметры:"
#: lazarusidestrconsts.lislazbuildoptionspassedtocompiler
msgid "Options passed to compiler"
msgstr "Параметры, передаваемые компилятору"
#: lazarusidestrconsts.lislazbuildoptionssyntax
msgid "lazbuild [options] <project/package filename or package name>"
msgstr "lazbuild [параметры] <имя файла проекта/пакета либо имя пакета>"
#: lazarusidestrconsts.lislazbuildprofile
msgid "Profile to build"
msgstr "Профиль сборки"
#: lazarusidestrconsts.lislazbuildrenameprof
msgid "Rename Profile"
msgstr "Переименование профиля"
#: lazarusidestrconsts.lislazbuildrenameprofinfo
msgid "New name for profile:"
msgstr "Новое имя профиля:"
#: lazarusidestrconsts.lislazbuildrestartafterbuild
msgid "Restart after building IDE"
msgstr "Перезапускать после сборки IDE"
#: lazarusidestrconsts.lislazbuildrestartlazarusautomatically
msgctxt "lazarusidestrconsts.lislazbuildrestartlazarusautomatically"
msgid "Restart Lazarus automatically after building the IDE (has no effect when building other parts)"
msgstr "Перезапускать Lazarus автоматически после сборки IDE (не действует при сборке прочих частей среды разработки)"
#: lazarusidestrconsts.lislazbuildselectprofilestobuild
msgid "Select profiles to build"
msgstr "Выбор профилей для сборки"
#: lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding
msgctxt "lazarusidestrconsts.lislazbuildshowconfirmationdialogwhenbuilding"
msgid "Show confirmation dialog when building directly from Tools menu"
msgstr "Выводить диалог подтверждения при пересборке напрямую из меню Сервис"
#: lazarusidestrconsts.lislazbuildshowoptionsanddefinesforcommandline
msgid "Show options and defines for command line"
msgstr "Показать параметры и определения в формате командной строки"
#: lazarusidestrconsts.lislazbuildtargetcpu
msgid "Target CPU:"
msgstr "Целевой CPU:"
#: lazarusidestrconsts.lislazbuildtargetdirectory
msgid "Target directory:"
msgstr "Каталог назначения:"
#: lazarusidestrconsts.lislazbuildtargetos
msgid "Target OS:"
msgstr "Целевая ОС:"
#: lazarusidestrconsts.lislazbuildunabletowritefile
#, object-pascal-format
msgid "Unable to write file \"%s\":%s"
msgstr "Невозможно записать файл \"%s\":%s"
#: lazarusidestrconsts.lislazbuildupdaterevinc
msgctxt "lazarusidestrconsts.lislazbuildupdaterevinc"
msgid "Update revision.inc"
msgstr "Обновить revision.inc"
#: lazarusidestrconsts.lislazbuildupdaterevisioninfoinaboutlazarusdialog
msgid "Update revision info in \"About Lazarus\" dialog"
msgstr "Обновить сведения о ревизии в диалоге \"О проекте Lazarus\""
#: lazarusidestrconsts.lislazcleanupbuildall
msgctxt "lazarusidestrconsts.lislazcleanupbuildall"
msgid "Clean Up + Build all"
msgstr "Очистить + Собрать все"
#: lazarusidestrconsts.lislazver
msgid "Lazarus Version (e.g. 1.2.4)"
msgstr "Версия Lazarus (например, 1.2.4)"
#: lazarusidestrconsts.lislclwidgettype
msgid "LCL widget type"
msgstr "Библиотека виджетов LCL"
#: lazarusidestrconsts.lisldaddlinktoinherited
msgid "Add link to inherited"
msgstr "Добавить ссылку на унаследованное"
#: lazarusidestrconsts.lisldcopyfrominherited
msgid "Copy from inherited"
msgstr "Копировать из унаследованного"
#: lazarusidestrconsts.lislddoesnothaveanyvalidfpdocpathunabletocreatethefpdo
#, object-pascal-format
msgid "%s does not have any valid FPDoc path.%sUnable to create the fpdoc file for %s"
msgstr "%s не содержит ни одного корректного пути FPDoc.%sНевозможно создать файл FPDoc для %s"
#: lazarusidestrconsts.lisldmoveentriestoinherited
msgid "Move entries to inherited"
msgstr "Переместить в унаследованное"
#: lazarusidestrconsts.lisldnovalidfpdocpath
msgid "No valid FPDoc path"
msgstr "Отсутствует корректный путь FPDoc"
#: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe
#, object-pascal-format
msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file."
msgstr "Модулем %s не владеет ни один из пакетов либо проектов.%sДобавьте модуль к пакету либо проекту.%sНевозможно создать файл FPDoc."
#: lazarusidestrconsts.lisleft
msgctxt "lazarusidestrconsts.lisleft"
msgid "Left"
msgstr "Слева"
#: lazarusidestrconsts.lisleftborderspacespinedithint
msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control."
msgstr "Левый зазор. Его значение добавляется к базовуму зазору и используется для определения пространства слева от компонента."
#: lazarusidestrconsts.lisleftgroupboxcaption
msgid "Left anchoring"
msgstr "Левая привязка"
#: lazarusidestrconsts.lisleftgutter
msgctxt "lazarusidestrconsts.lisleftgutter"
msgid "Left"
msgstr "Слева"
#: lazarusidestrconsts.lisleftsiblingcomboboxhint
msgid "This is the sibling control to which the left side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Это сосед, к которому привязывается левая граница. Оставьте пустым для привязки к родителю в стиле Delphi (BorderSpacing и ReferenceSide не имеют значения)."
#: lazarusidestrconsts.lisleftsides
msgid "Left sides"
msgstr "Левые края"
#: lazarusidestrconsts.lisleftspaceequally
msgid "Left space equally"
msgstr "Равномерно по левым краям"
#: lazarusidestrconsts.lisless
msgctxt "lazarusidestrconsts.lisless"
msgid "Less"
msgstr "Скрыть подробности"
#: lazarusidestrconsts.lislevels
msgctxt "lazarusidestrconsts.lislevels"
msgid "Levels"
msgstr "Уровни"
#: lazarusidestrconsts.lislfmfile
msgid "LFM file"
msgstr "Файл LFM"
#: lazarusidestrconsts.lislfmfilecontainsinvalidproperties
msgid "The LFM file contains unknown properties/classes which do not exist in the LCL. They can be replaced or removed."
msgstr "Файл LFM содержит неизвестные свойства/классы, не существующие в LCL. Они могут быть заменены либо удалены."
#: lazarusidestrconsts.lislfmfilecorrupt
msgid "LFM file corrupt"
msgstr "Файл LFM повреждён"
#: lazarusidestrconsts.lislfmisok
msgid "LFM is ok"
msgstr "Файл LFM верен"
#: lazarusidestrconsts.lislgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<одна строка с наименованием Библиотеки и кратким описанием её назначения>\n"
"\n"
"© <год первого опубликования библиотеки> <имя (наименование) автора или иного правообладателя> <способ связи>\n"
"\n"
"Данная библиотека является свободным программным обеспечением. Вы вправе распространять её и/или модифицировать в соответствии с условиями версии 2 либо по вашему выбору с условиями более поздней версии Стандартной Общественной Лицензии Ограниченного Применения GNU, опубликованной Free Software Foundation. \n"
"\n"
"Мы распространяем эту библиотеку в надежде на то, что она будет вам полезной, однако НЕ ПРЕДОСТАВЛЯЕМ НА НЕЕ НИКАКИХ ГАРАНТИЙ, в том числе ГАРАНТИИ ТОВАРНОГО СОСТОЯНИЯ ПРИ ПРОДАЖЕ и ПРИГОДНОСТИ ДЛЯ ИСПОЛЬЗОВАНИЯ В КОНКРЕТНЫХ ЦЕЛЯХ. Для получения более подробной информации ознакомьтесь со Стандартной Общественной Лицензией Ограниченного Применений GNU. \n"
"\n"
"Вместе с данной библиотекой вы должны были получить экземпляр Стандартной Общественной Лицензии Ограниченного Применения GNU. Если вы его не получили, сообщите об этом в Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
#: lazarusidestrconsts.lislibrarypath
msgid "library path"
msgstr "путь к библиотекам"
#: lazarusidestrconsts.lislibraryprogramdescriptor
msgid "A Free Pascal shared library (.dll under Windows, .so under Linux, .dylib under macOS)."
msgstr "Динамическая библиотека на Free Pascal (.dll под Windows, .so под Linux, .dylib под macOS)."
#: lazarusidestrconsts.lislink
msgid "Link:"
msgstr "Ссылка:"
#: lazarusidestrconsts.lislinkeroptions
msgid "linker options"
msgstr "параметры компоновщика"
#: lazarusidestrconsts.lislinktarget
msgid "Link target"
msgstr "Цель ссылки"
#: lazarusidestrconsts.lislistofallcasevalues
msgid "list of all case values"
msgstr "Список всех значений оператора case"
#: lazarusidestrconsts.lisloadingfailed
#, object-pascal-format
msgid "Loading %s failed."
msgstr "Загрузка %s не удалась."
#: lazarusidestrconsts.lisloadmacrofrom
msgid "Load macro from"
msgstr "Загрузить макрос"
#: lazarusidestrconsts.lislocal
msgid "&Local"
msgstr "Локальная (&L)"
#: lazarusidestrconsts.lislowercasestring
msgid "lowercase string"
msgstr "Преобразовать регистр строки в нижний"
#: lazarusidestrconsts.lislowercasestringgivenasparameter
msgid "Lowercase string given as parameter."
msgstr "Преобразовать регистр строки, переданной в качестве параметра, в нижний."
#: lazarusidestrconsts.lislpicompatibilitymodecheckbox
msgid "Maximize compatibility of project files (LPI and LPS)"
msgstr "Сохранять файлы проекта (LPI и LPS) в режиме расширенной совместимости"
#: lazarusidestrconsts.lislpicompatibilitymodecheckboxhint
msgid "Check this if you want to open your project in legacy (2.0 and older) Lazarus versions."
msgstr "Включите этот параметр, если хотите открывать проект в старых (2.0 и более ранних) версиях Lazarus."
#: lazarusidestrconsts.lislpkcompatibilitymodecheckbox
msgid "Maximize compatibility of package file (LPK)"
msgstr "Сохранять файл пакета (LPK) в режиме расширенной совместимости"
#: lazarusidestrconsts.lislpkcompatibilitymodecheckboxhint
msgid "Check this if you want to open your package in legacy (2.0 and older) Lazarus versions."
msgstr "Включите этот параметр, если хотите открывать пакет в старых (2.0 и более ранних) версиях Lazarus."
#: lazarusidestrconsts.lislpkhasvanishedondiskusingasalternative
#, object-pascal-format
msgid "lpk has vanished on disk. Using as alternative%s"
msgstr "LPK исчез с диска. Вместо него используется%s"
#: lazarusidestrconsts.lislpkismissing
msgid "lpk is missing"
msgstr "LPK отсутствует"
#: lazarusidestrconsts.lislrsincludefiles
msgid "Lazarus resources (.lrs) include files"
msgstr "Ресурсы Lazarus (.lrs)"
#: lazarusidestrconsts.lismacpreferences
msgid "Preferences..."
msgstr "Настройки..."
#: lazarusidestrconsts.lismacro
#, object-pascal-format
msgid "Macro %s"
msgstr "Макрос %s"
#: lazarusidestrconsts.lismacropromptenterdata
msgid "Enter data"
msgstr "Введите данные"
#: lazarusidestrconsts.lismacropromptenterrunparameters
msgid "Enter run parameters"
msgstr "Введите параметры запуска"
#: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject
msgid "Main unit has Uses section containing all units of project"
msgstr "Главный модуль имеет выражение uses, включающее все модули проекта"
#: lazarusidestrconsts.lismainunitispascalsource
msgid "Main unit is Pascal source"
msgstr "Главный модуль является исходным кодом на Паскале"
#: lazarusidestrconsts.lismainunitispascalsourcehint
msgid "Assume Pascal even if it does not end with .pas/.pp suffix."
msgstr "Предполагать, что файл содержит исходный код на Паскале, даже если он не имеет расширения .pas/.pp"
#: lazarusidestrconsts.lismajorchangesdetected
msgid "Major changes detected"
msgstr "Обнаружены значительные изменения"
#: lazarusidestrconsts.lismakecurrent
msgctxt "lazarusidestrconsts.lismakecurrent"
msgid "Current"
msgstr "Текущий"
#: lazarusidestrconsts.lismakeexe
msgid "Make Executable"
msgstr "Собрать исполнимый файл"
#: lazarusidestrconsts.lismakenotfound
msgid "Make not found"
msgstr "Не найден Make"
#: lazarusidestrconsts.lismakeresourcestring
msgid "Make ResourceString"
msgstr "Создать строку ресурсов"
#: lazarusidestrconsts.lismakeresstrappendtosection
msgid "Append to section"
msgstr "Добавить к секции"
#: lazarusidestrconsts.lismakeresstrchooseanothername
#, object-pascal-format
msgid "The resourcestring \"%s\" already exists.%sPlease choose another name.%sUse Ignore to add it anyway."
msgstr "Строка ресурсов \"%s\" уже имеется.%sВыберите другое имя.%sНажмите кнопку Пропустить, чтобы добавить всё равно."
#: lazarusidestrconsts.lismakeresstrconversionoptions
msgid "Conversion Options"
msgstr "Параметры преобразований"
#: lazarusidestrconsts.lismakeresstrcustomidentifier
msgid "Custom identifier"
msgstr "Пользовательский идентификатор"
#: lazarusidestrconsts.lismakeresstrdialogidentifier
msgctxt "lazarusidestrconsts.lismakeresstrdialogidentifier"
msgid "Identifier"
msgstr "Идентификатор"
#: lazarusidestrconsts.lismakeresstridentifierlength
msgid "Identifier length:"
msgstr "Длина идентификатора:"
#: lazarusidestrconsts.lismakeresstridentifierprefix
msgid "Identifier prefix:"
msgstr "Префикс идентификатора:"
#: lazarusidestrconsts.lismakeresstrinsertalphabetically
msgid "Insert alphabetically"
msgstr "Вставить по алфавиту"
#: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive
msgid "Insert context sensitive"
msgstr "Вставить с учётом контекста"
#: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect
msgid "Invalid Resourcestring section"
msgstr "Неверная секция Resourcestring"
#: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring
msgid "Please choose a resourcestring section from the list."
msgstr "Выберите секцию resourcestring из списка."
#: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis
msgid "Resourcestring already exists"
msgstr "Строка ресурсов уже существует"
#: lazarusidestrconsts.lismakeresstrresourcestringsection
msgid "Resourcestring section:"
msgstr "Секция Resourcestring:"
#: lazarusidestrconsts.lismakeresstrsourcepreview
msgid "Source preview"
msgstr "Предпросмотр исходного кода"
#: lazarusidestrconsts.lismakeresstrstringconstantinsource
msgid "String constant in source"
msgstr "Строковая константа в исходном коде"
#: lazarusidestrconsts.lismakeresstrstringswithsamevalue
msgid "Strings with same value:"
msgstr "Строки с тем же значением:"
#: lazarusidestrconsts.lismakesureallppufilesofapackageareinitsoutputdirecto
msgid "Make sure all ppu files of a package are in its output directory."
msgstr "Убедитесь, что все файлы PPU пакета находятся в его каталоге вывода."
#: lazarusidestrconsts.lismanagesourceeditors
msgid "Manage Source Editors ..."
msgstr "Управление редакторами исходного кода ..."
#: lazarusidestrconsts.lismaximumnumberofthreadsforcompilinginparalleldefaul
msgid "Maximum number of threads for compiling in parallel. Default is 0 which guesses the number of cores in the system."
msgstr "Максимальное количество потоков исполнения для параллельной сборки. Значение по умолчанию - 0 (пытаться определить количество ядер процессоров в системе автоматически)."
#: lazarusidestrconsts.lismaximumparallelprocesses0meansdefault
#, object-pascal-format
msgid "Maximum parallel processes, 0 means default (%s)"
msgstr "Максимально параллельных процессов, 0 - значение по умолчанию (%s)"
#: lazarusidestrconsts.lismaybeyouhavetorecompilethepackage
#, object-pascal-format
msgid "%s Maybe you have to recompile the package."
msgstr "%s Возможно, вам требуется пересобрать пакет."
#: lazarusidestrconsts.lismb
#, object-pascal-format
msgid "%s MB"
msgstr "%s МБ"
#: lazarusidestrconsts.lismenuabortbuild
msgid "Abort Build"
msgstr "Прервать сборку"
#: lazarusidestrconsts.lismenuaboutfpc
msgid "About FPC"
msgstr "Сведения о компиляторе FPC"
#: lazarusidestrconsts.lismenuaddbreakpoint
msgid "Add &Breakpoint"
msgstr "Добавить &точку останова"
#: lazarusidestrconsts.lismenuaddcurfiletopkg
msgid "Add Active File to Package ..."
msgstr "Добавить текущий файл к пакету ..."
#: lazarusidestrconsts.lismenuaddjumppointtohistory
msgid "Add Jump Point to History"
msgstr "Добавить точку перехода в историю"
#: lazarusidestrconsts.lismenuaddtoproject
msgid "Add Editor File to Project"
msgstr "Добавить файл редактора в проект"
#: lazarusidestrconsts.lismenuaddwatch
msgid "Add &Watch ..."
msgstr "Добавить &наблюдение ..."
#: lazarusidestrconsts.lismenubeaklinesinselection
msgid "Break Lines in Selection"
msgstr "Разбить строки в выделенном"
#: lazarusidestrconsts.lismenubuildfile
msgid "Build File"
msgstr "Собрать файл"
#: lazarusidestrconsts.lismenubuildlazarus
msgid "Build Lazarus with Current Profile"
msgstr "Собрать Lazarus по текущему профилю"
#: lazarusidestrconsts.lismenubuildlazarusprof
#, object-pascal-format
msgid "Build Lazarus with Profile: %s"
msgstr "Пересобрать Lazarus по профилю: %s"
#: lazarusidestrconsts.lismenuchecklfm
msgid "Check LFM File in Editor"
msgstr "Проверить файл LFM в редакторе"
#: lazarusidestrconsts.lismenucleandirectory
msgid "Clean Directory ..."
msgstr "Очистить каталог ..."
#: lazarusidestrconsts.lismenucleanupandbuild
msgid "Clean up and Build ..."
msgstr "Очистить и собрать ..."
#: lazarusidestrconsts.lismenucloseeditorfile
msgid "&Close Editor File"
msgstr "Закрыть файл &редактора"
#: lazarusidestrconsts.lismenucloseproject
msgid "Close Project"
msgstr "Закрыть проект"
#: lazarusidestrconsts.lismenucodetoolsdefineseditor
msgid "CodeTools Defines Editor ..."
msgstr "Редактор определений CodeTools ..."
#: lazarusidestrconsts.lismenucommentselection
msgid "Comment Selection"
msgstr "Закомментировать выделенное"
#: lazarusidestrconsts.lismenucomparefiles
msgid "Compare files ..."
msgstr "Сравнить файлы ..."
#: lazarusidestrconsts.lismenucompilemanymodes
msgid "Compile many Modes ..."
msgstr "Компилировать в нескольких режимах ..."
#: lazarusidestrconsts.lismenucompletecode
msgctxt "lazarusidestrconsts.lismenucompletecode"
msgid "Complete Code"
msgstr "Завершить код"
#: lazarusidestrconsts.lismenucompletecodeinteractive
msgid "Complete Code (with dialog)"
msgstr "Завершить код (с диалогом)"
#: lazarusidestrconsts.lismenuconfigbuildfile
msgid "Configure Build+Run File ..."
msgstr "Параметры сборки+запуска ..."
#: lazarusidestrconsts.lismenuconfigcustomcomps
msgid "Configure Custom Components ..."
msgstr "Настройка пользовательских компонентов ..."
#: lazarusidestrconsts.lismenuconfigexternaltools
msgid "Configure External Tools ..."
msgstr "Настроить внешние средства ..."
#: lazarusidestrconsts.lismenuconfigurebuildlazarus
msgid "Configure \"Build Lazarus\" ..."
msgstr "Параметры сборки Lazarus ..."
#: lazarusidestrconsts.lismenucontexthelp
msgid "Context sensitive Help"
msgstr "Контекстно-зависимая справка"
#: lazarusidestrconsts.lismenuconvertdelphipackage
msgid "Convert Delphi Package to Lazarus Package ..."
msgstr "Преобразовать пакет Delphi в пакет Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiproject
msgid "Convert Delphi Project to Lazarus Project ..."
msgstr "Преобразовать проект Delphi в проект Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdelphiunit
msgid "Convert Delphi Unit to Lazarus Unit ..."
msgstr "Преобразовать модуль Delphi в Lazarus ..."
#: lazarusidestrconsts.lismenuconvertdfmtolfm
msgid "Convert Binary DFM to LFM ..."
msgstr "Преобразовать двоичный файл DFM в LFM ..."
#: lazarusidestrconsts.lismenuconvertencoding
msgid "Convert Encoding of Projects/Packages ..."
msgstr "Преобразовать кодировку проектов/пакетов ..."
#: lazarusidestrconsts.lismenudebugwindows
msgid "Debug Windows"
msgstr "Окна отладки"
#: lazarusidestrconsts.lismenudelphiconversion
msgid "Delphi Conversion"
msgstr "Преобразование кода на Delphi"
#: lazarusidestrconsts.lismenuedit
msgid "&Edit"
msgstr "&Правка"
#: lazarusidestrconsts.lismenueditcodetemplates
msgid "Code Templates ..."
msgstr "Шаблоны кода ..."
#: lazarusidestrconsts.lismenueditcontexthelp
msgid "Edit context sensitive Help"
msgstr "Редактировать контекстно-зависимую справку"
#: lazarusidestrconsts.lismenueditinstallpkgs
msgid "Install/Uninstall Packages ..."
msgstr "Установить/удалить пакеты ..."
#: lazarusidestrconsts.lismenueditoracceleratorkeysneedschanging
#, object-pascal-format
msgid "Accelerator(&&) key \"%s\" needs changing"
msgstr "Клавишу (&&) быстрого вызова \"%s\" требуется изменить"
#: lazarusidestrconsts.lismenueditoraddanewitemaboveselecteditem
msgid "Add a new item above selected item"
msgstr "Добавить новый элемент над выделенным"
#: lazarusidestrconsts.lismenueditoraddanewitemafterselecteditem
msgid "Add a new item after selected item"
msgstr "Добавить новый элемент после выделенного"
#: lazarusidestrconsts.lismenueditoraddanewitembeforeselecteditem
msgid "Add a new item before selected item"
msgstr "Добавить новый элемент перед выделенным"
#: lazarusidestrconsts.lismenueditoraddanewitembelowselecteditem
msgid "Add a new item below selected item"
msgstr "Добавить новый элемент под выделенным"
#: lazarusidestrconsts.lismenueditoraddasubmenuattherightofselecteditem
msgid "Add a submenu at the right of selected item"
msgstr "Добавить подменю справа от выделенного элемента"
#: lazarusidestrconsts.lismenueditoraddasubmenubelowselecteditem
msgid "Add a submenu below selected item"
msgstr "Добавить подменю под выделенным элементом"
#: lazarusidestrconsts.lismenueditoraddfromtemplate
msgid "&Add from template ..."
msgstr "&Добавить из шаблона ..."
#: lazarusidestrconsts.lismenueditoraddiconfroms
#, object-pascal-format
msgid "Add icon from %s"
msgstr "Добавить значок из %s"
#: lazarusidestrconsts.lismenueditoraddimagelisticon
msgid "Add imagelist &icon"
msgstr "Добавить &значок из ImageList"
#: lazarusidestrconsts.lismenueditoraddmenuitem
msgid "Add menu item"
msgstr "Добавить элемент"
#: lazarusidestrconsts.lismenueditoraddnewitemabove
msgid "&Add new item above"
msgstr "Добавить новый элемент &выше"
#: lazarusidestrconsts.lismenueditoraddnewitemafter
msgid "Add ne&w item after"
msgstr "Добавить новый элемент &после"
#: lazarusidestrconsts.lismenueditoraddnewitembefore
msgid "&Add new item before"
msgstr "Добавить новый элемент п&еред"
#: lazarusidestrconsts.lismenueditoraddnewitembelow
msgid "Add ne&w item below"
msgstr "Добавить новый элемент &ниже"
#: lazarusidestrconsts.lismenueditoraddonclickhandler
msgid "Add &OnClick handler"
msgstr "Добавить &обработчик OnClick"
#: lazarusidestrconsts.lismenueditoraddseparatorafter
msgid "Add separator &after"
msgstr "Добавить разделитель &после"
#: lazarusidestrconsts.lismenueditoraddseparatorbefore
msgid "Add separator &before"
msgstr "Добавить разделитель п&еред"
#: lazarusidestrconsts.lismenueditoraddsubmenu
msgid "Add submenu"
msgstr "Добавить подменю"
#: lazarusidestrconsts.lismenueditoraddsubmenubelow
msgid "Add &submenu below"
msgstr "Добавить под&меню ниже"
#: lazarusidestrconsts.lismenueditoraddsubmenuright
msgid "Add &submenu right"
msgstr "Добавить под&меню справа"
#: lazarusidestrconsts.lismenueditoranewmenutemplatehasbeensaved
#, object-pascal-format
msgid "A new menu template described as \"%s\" has been saved based on %s, with %d sub items"
msgstr "Новый шаблон меню \"%s\" сохранён на базе %s (элементов: %d)"
#: lazarusidestrconsts.lismenueditorbasiceditmenutemplate
msgid "&Edit,Basic edit menu,&Undo,Ctrl+Z,&Redo,,-,,Select &All,Ctrl+A,C&ut,Ctrl+X,C&opy,Ctrl+C,P&aste,Ctrl+V,Paste &Special,,-,,F&ind,,R&eplace,,&Go to ...,,"
msgstr "&Правка,Базовое меню \"Правка\",&Отменить,Ctrl+Z,&Вернуть,,-,,Вы&делить все,Ctrl+A,В&ырезать,Ctrl+X,&Копировать,Ctrl+C,В&ставить,Ctrl+V,Сп&ециальная вставка,,-,,&Найти,,&Заменить,,&Перейти ...,,"
#: lazarusidestrconsts.lismenueditorbasicfilemenutemplate
msgid "&File,Basic file menu,&New,,&Open ...,,&Save,,Save &As,,-,,&Print,,P&rint Setup ...,,-,,E&xit,,"
msgstr "&Файл,Базовое меню \"Файл\",&Новый,,&Открыть ...,,&Сохранить,,Сохранить &как,,-,,&Печать,,П&араметры печати ...,,-,,В&ыход,,"
#: lazarusidestrconsts.lismenueditorbasichelpmenutemplate
msgid "&Help,Basic help menu,Help &Contents,F1,Help &Index,,&Online Help,,-,,&Licence Information,,&Check for Updates,,-,,&About,,"
msgstr "&Справка,Базовое меню \"Справка\",&Содержимое,F1,&Указатель,,Справка в с&ети,,-,,Сведения о &лицензии,,&Проверить обновления,,-,,&О программе,,"
#: lazarusidestrconsts.lismenueditorbasicwindowmenutemplate
msgid "&Window,Basic window menu,&New Window,,&Tile,,&Cascade,,&Arrange all,,-,,&Hide,,&Show,,"
msgstr "Ок&но,Базовое меню \"Окно\",&Новое окно,,&Замостить,,&Каскадировать,,&Упорядочить все,,-,,Ск&рыть,,&Отобразить,,"
#: lazarusidestrconsts.lismenueditorcaption
msgid "Caption"
msgstr "Заголовок"
#: lazarusidestrconsts.lismenueditorcaptioneditemss
#, object-pascal-format
msgid "Captioned items: %s"
msgstr "Элементов с заголовками: %s"
#: lazarusidestrconsts.lismenueditorcaptionshouldnotbeblank
msgid "Caption should not be blank"
msgstr "Заголовок не должен быть пустым"
#: lazarusidestrconsts.lismenueditorchangeconflictingaccelerators
#, object-pascal-format
msgid "Change conflicting accelerator \"%s\""
msgstr "Изменение конфликтующей клавиши быстрого вызова \"%s\""
#: lazarusidestrconsts.lismenueditorchangeimagelisticon
msgid "Change imagelist &icon"
msgstr "Сменить &значок из ImageList"
#: lazarusidestrconsts.lismenueditorchangeshortcutcaptionforcomponent
#, object-pascal-format
msgid "Change %s for %s"
msgstr "Изменение свойства \"%s\" в %s"
#: lazarusidestrconsts.lismenueditorchangeshortcutconflicts
#, object-pascal-format
msgid "Change shortcut conflict \"%s\""
msgstr "Изменение конфликтующей комбинации клавиш \"%s\""
#: lazarusidestrconsts.lismenueditorchangetheshortcutfors
#, object-pascal-format
msgid "Change the shortCut for %s"
msgstr "Изменение свойства ShortCut в %s"
#: lazarusidestrconsts.lismenueditorchangetheshortcutkey2fors
#, object-pascal-format
msgid "Change the shortCutKey2 for %s"
msgstr "Изменение свойства ShortCutKey2 в %s"
#: lazarusidestrconsts.lismenueditorchoosetemplatetodelete
msgid "Choose template to delete"
msgstr "Выберите шаблон для удаления"
#: lazarusidestrconsts.lismenueditorchoosetemplatetoinsert
msgid "Choose template to insert"
msgstr "Выберите шаблон для вставки"
#: lazarusidestrconsts.lismenueditorclickanongreyeditemtoedititsshortcut
msgid "Click a non-greyed item to edit its shortcut or click header to sort by that column"
msgstr "Щёлкните по активному элементу для редактирования комбинации клавиш либо по заголовку столбца списка для сортировки"
#: lazarusidestrconsts.lismenueditorcomponentisunexpectedkind
msgid "Component is unexpected kind"
msgstr "Компонент неизвестного типа"
#: lazarusidestrconsts.lismenueditorcomponentisunnamed
msgid "Component is unnamed"
msgstr "Компонент без имени"
#: lazarusidestrconsts.lismenueditorconflictresolutioncomplete
msgid "<conflict resolution complete>"
msgstr "<устранение конфликтов завершено>"
#: lazarusidestrconsts.lismenueditorconflictsfoundinitiallyd
#, object-pascal-format
msgid "Conflicts found initially: %d"
msgstr "Изначально найденных конфликтов: %d"
#: lazarusidestrconsts.lismenueditordeepestnestedmenulevels
#, object-pascal-format
msgid "Deepest nested menu level: %s"
msgstr "Максимальный уровень вложенности: %s"
#: lazarusidestrconsts.lismenueditordeleteitem
msgid "&Delete item"
msgstr "&Удалить элемент"
#: lazarusidestrconsts.lismenueditordeletemenutemplate
msgid "&Delete menu template ..."
msgstr "&Удалить шаблон меню ..."
#: lazarusidestrconsts.lismenueditordeletesavedmenutemplate
msgid "Delete saved menu template"
msgstr "Удалить сохранённый шаблон меню"
#: lazarusidestrconsts.lismenueditordeleteselectedmenutemplate
msgid "Delete selected menu template"
msgstr "Удалить выделенный шаблон меню"
#: lazarusidestrconsts.lismenueditordeletethisitemanditssubitems
msgid "Delete this item and its subitems?"
msgstr "Удалить этот элемент со всеми дочерними?"
#: lazarusidestrconsts.lismenueditordisplaypreviewaspopupmenu
msgid "Display preview as &Popup menu"
msgstr "Отображать предпросмотр как &всплывающее меню"
#: lazarusidestrconsts.lismenueditoreditcaption
msgid "Edit &Caption"
msgstr "Редактировать за&головок"
#: lazarusidestrconsts.lismenueditoreditingcaptionofs
#, object-pascal-format
msgid "Editing Caption of %s"
msgstr "Редактирование заголовка %s"
#: lazarusidestrconsts.lismenueditoreditingsdots
#, object-pascal-format
msgid "To resolve conflict edit %s.%s"
msgstr "Для устранения конфликта измените %s.%s"
#: lazarusidestrconsts.lismenueditoreditingsfors
#, object-pascal-format
msgid "Editing %s for %s"
msgstr "Редактирование свойства \"%s\" в %s"
#: lazarusidestrconsts.lismenueditoreditingssnomenuitemselected
#, object-pascal-format
msgid "Editing %s.%s - no menuitem selected"
msgstr "Правка %s.%s - элемент меню не выбран"
#: lazarusidestrconsts.lismenueditorenteramenudescription
msgid "Enter a menu &Description:"
msgstr "Введите &описание меню:"
#: lazarusidestrconsts.lismenueditorenteranewshortcutfors
#, object-pascal-format
msgid "Enter a new ShortCut for %s"
msgstr "Ввод значения свойства ShortCut в %s"
#: lazarusidestrconsts.lismenueditorenteranewshortcutkey2fors
#, object-pascal-format
msgid "Enter a new ShortCutKey2 for %s"
msgstr "Ввод значения свойства ShortCutKey2 в %s"
#: lazarusidestrconsts.lismenueditorexistingsavedtemplates
msgid "Existing saved templates"
msgstr "Имеющиеся сохранённые шаблоны"
#: lazarusidestrconsts.lismenueditorfurthershortcutconflict
msgid "Further shortcut conflict"
msgstr "Дополнительный конфликт комбинаций клавиш"
#: lazarusidestrconsts.lismenueditorgethelptousethiseditor
msgid "Get help to use this editor"
msgstr "Открыть справку для этого редактора"
#: lazarusidestrconsts.lismenueditorgrabkey
msgid "&Grab key"
msgstr "&Захватить клавишу"
#: lazarusidestrconsts.lismenueditorgroupindexd
#, object-pascal-format
msgid "GroupIndex: %d"
msgstr "GroupIndex: %d"
#: lazarusidestrconsts.lismenueditorgroupindexvaluess
#, object-pascal-format
msgid "Values in use: %s"
msgstr "Имеющиеся значения: %s"
#: lazarusidestrconsts.lismenueditorinadequatedescription
msgid "Inadequate Description"
msgstr "Некорректное описание"
#: lazarusidestrconsts.lismenueditorinsertmenutemplateintorootofs
#, object-pascal-format
msgid "Insert menu template into root of %s"
msgstr "Вставить шаблон меню на верхний уровень %s"
#: lazarusidestrconsts.lismenueditorinsertselectedmenutemplate
msgid "Insert selected menu template"
msgstr "Вставить выделенный шаблон меню"
#: lazarusidestrconsts.lismenueditorisnotassigned
msgid "is not assigned"
msgstr "не присвоен"
#: lazarusidestrconsts.lismenueditoritemswithicons
#, object-pascal-format
msgid "Items with icon: %s"
msgstr "Элементов со значками: %s"
#: lazarusidestrconsts.lismenueditorlistshortcutsandaccelerators
#, object-pascal-format
msgid "List shortcuts and &accelerators for %s ..."
msgstr "Показать комбинации и клавиши &быстрого вызова для %s ..."
#: lazarusidestrconsts.lismenueditorlistshortcutsfors
#, object-pascal-format
msgid "List shortcuts for %s ..."
msgstr "Показать комбинации клавиш для %s ..."
#: lazarusidestrconsts.lismenueditormenueditor
msgid "Menu Editor"
msgstr "Редактор меню"
#: lazarusidestrconsts.lismenueditormenuitemactions
msgid "Menu Item actions"
msgstr "Действия с элементами"
#: lazarusidestrconsts.lismenueditormenuitemshortcutconflictsins
#, object-pascal-format
msgid "Menuitem shortcut conflicts in %s"
msgstr "Конфликты комбинаций клавиш меню в %s"
#: lazarusidestrconsts.lismenueditormoveitemdown
msgid "Mo&ve item down"
msgstr "Переместить элемент вн&из"
#: lazarusidestrconsts.lismenueditormoveitemleft
msgid "&Move item left"
msgstr "Переместить элемент н&алево"
#: lazarusidestrconsts.lismenueditormoveitemright
msgid "Mo&ve item right"
msgstr "Переместить &элемент направо"
#: lazarusidestrconsts.lismenueditormoveitemup
msgid "&Move item up"
msgstr "Переместить элемент ввер&х"
#: lazarusidestrconsts.lismenueditormoveselecteditemdown
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemdown"
msgid "Move selected item down"
msgstr "Переместить выделенный элемент вниз"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheleft
msgid "Move selected item to the left"
msgstr "Переместить выделенный элемент налево"
#: lazarusidestrconsts.lismenueditormoveselecteditemtotheright
msgid "Move selected item to the right"
msgstr "Переместить выделенный элемент направо"
#: lazarusidestrconsts.lismenueditormoveselecteditemup
msgctxt "lazarusidestrconsts.lismenueditormoveselecteditemup"
msgid "Move selected item up"
msgstr "Переместить выделенный элемент вверх"
#: lazarusidestrconsts.lismenueditorna
msgid "n/a"
msgstr "недоступно"
#: lazarusidestrconsts.lismenueditornomenuselected
msgid "(no menu selected)"
msgstr "(меню не выбрано)"
#: lazarusidestrconsts.lismenueditornone
msgid "<none>"
msgstr "<нет>"
#: lazarusidestrconsts.lismenueditornonenone
msgid "<none>,<none>"
msgstr "<нет>,<нет>"
#: lazarusidestrconsts.lismenueditornoshortcutconflicts
msgid "<no shortcut conflicts>"
msgstr "<конфликты комбинаций клавиш отсутствуют>"
#: lazarusidestrconsts.lismenueditornousersavedtemplates
msgid "No user-saved templates"
msgstr "Пользовательские шаблоны меню отсутствуют"
#: lazarusidestrconsts.lismenueditorpickaniconfroms
#, object-pascal-format
msgid "Pick an icon from %s"
msgstr "Добавить значок из %s"
#: lazarusidestrconsts.lismenueditorpopupassignmentss
#, object-pascal-format
msgid "Popup assignments: %s"
msgstr "Присваиваний всплывающего меню: %s"
#: lazarusidestrconsts.lismenueditorradioitem
msgid "RadioItem"
msgstr "Элемент-переключатель"
#: lazarusidestrconsts.lismenueditorremainingconflictss
#, object-pascal-format
msgid "Remaining conflicts: %s"
msgstr "Оставшихся конфликтов: %s"
#: lazarusidestrconsts.lismenueditorremoveallseparators
msgid "&Remove all separators"
msgstr "Удалить &все разделители"
#: lazarusidestrconsts.lismenueditorresolvedconflictss
#, object-pascal-format
msgid "Resolved conflicts: %s"
msgstr "Устранённых конфликтов: %s"
#: lazarusidestrconsts.lismenueditorresolveselectedconflict
msgid "Resolve selected conflict"
msgstr "Устранить выбранный конфликт"
#: lazarusidestrconsts.lismenueditorresolveshortcutconflicts
msgid "&Resolve shortcut conflicts ..."
msgstr "&Устранить конфликты комбинаций клавиш ..."
#: lazarusidestrconsts.lismenueditorsavedtemplates
msgid "Saved templates"
msgstr "Сохранённые шаблоны"
#: lazarusidestrconsts.lismenueditorsavemenuasatemplate
msgid "&Save menu as a template ..."
msgstr "&Сохранить меню в качестве шаблона ..."
#: lazarusidestrconsts.lismenueditorsavemenuastemplate
msgid "Save menu as template"
msgstr "Сохранить меню в качестве шаблона"
#: lazarusidestrconsts.lismenueditorsavemenuastemplateforfutureuse
msgid "Save menu as template for future use"
msgstr "Сохранить меню в качестве шаблона для дальнейшего использования"
#: lazarusidestrconsts.lismenueditorsavemenushownasanewtemplate
msgid "Save menu shown as a new template"
msgstr "Сохранить показанное меню в качестве шаблона"
#: lazarusidestrconsts.lismenueditorsconflictswiths
#, object-pascal-format
msgid "%s conflicts with %s"
msgstr "%s конфликтует с %s"
#: lazarusidestrconsts.lismenueditorseparators
msgid "Se¶tors"
msgstr "&Разделители"
#: lazarusidestrconsts.lismenueditorshortcutitemss
#, object-pascal-format
msgid "Shortcut items: %s"
msgstr "Элементов с комбинациями клавиш: %s"
#: lazarusidestrconsts.lismenueditorshortcutnotyetchanged
msgid "Shortcut not yet changed"
msgstr "Комбинация клавиш ещё не изменена"
#: lazarusidestrconsts.lismenueditorshortcuts
msgid "Shortcuts"
msgstr "Комбинации клавиш"
#: lazarusidestrconsts.lismenueditorshortcuts2
msgid "Shortc&uts"
msgstr "&Комбинации клавиш"
#: lazarusidestrconsts.lismenueditorshortcutsandacceleratorkeys
msgid "Shortcuts and Accelerator keys"
msgstr "Комбинации и клавиши быстрого вызова"
#: lazarusidestrconsts.lismenueditorshortcutsd
#, object-pascal-format
msgid "Shortcuts (%d)"
msgstr "Комбинации клавиш (%d)"
#: lazarusidestrconsts.lismenueditorshortcutsdandacceleratorkeysd
#, object-pascal-format
msgid "Shortcuts (%d) and Accelerator keys (%d)"
msgstr "Комбинации (%d) и клавиши быстрого вызова (%d)"
#: lazarusidestrconsts.lismenueditorshortcutsourceproperty
msgid "Shortcut,Source Property"
msgstr "Комбинация клавиш,Свойство-источник"
#: lazarusidestrconsts.lismenueditorshortcutsusedins
#, object-pascal-format
msgid "Shortcuts used in %s"
msgstr "Комбинации клавиш в %s"
#: lazarusidestrconsts.lismenueditorshortcutsusedinsd
#, object-pascal-format
msgid "Shortcuts used in %s (%d)"
msgstr "Комбинации клавиш в %s (%d)"
#: lazarusidestrconsts.lismenueditorsins
#, object-pascal-format
msgid "\"%s\" in %s"
msgstr "\"%s\" в %s"
#: lazarusidestrconsts.lismenueditorsisalreadyinuse
#, object-pascal-format
msgid ""
"\"%s\" is already in use in %s as a shortcut.\n"
"Try a different shortcut."
msgstr ""
"Комбинация клавиш \"%s\" уже используется в %s.\n"
"Попробуйте другую."
#: lazarusidestrconsts.lismenueditorsisnotasufficientdescriptionpleaseexpand
#, object-pascal-format
msgid "Please expand: \"%s\" is not a sufficient Description"
msgstr "Введите более длинное описание: \"%s\" слишком коротко."
#: lazarusidestrconsts.lismenueditorsshortcuts
#, object-pascal-format
msgid "%s: Shortcuts"
msgstr "%s: Комбинации клавиш"
#: lazarusidestrconsts.lismenueditorsshortcutsandacceleratorkeys
#, object-pascal-format
msgid "%s: Shortcuts and accelerator keys"
msgstr "%s: Комбинации и клавиши быстрого вызова"
#: lazarusidestrconsts.lismenueditorsssonclicks
#, object-pascal-format
msgid "%s.%s.%s - OnClick: %s"
msgstr "%s.%s.%s - обработчик OnClick: %s"
#: lazarusidestrconsts.lismenueditorstandardtemplates
msgid "Standard templates"
msgstr "Стандартные шаблоны"
#: lazarusidestrconsts.lismenueditortemplatedescription
msgid "Template description:"
msgstr "Описание шаблона:"
#: lazarusidestrconsts.lismenueditortemplates
msgid "&Templates"
msgstr "&Шаблоны"
#: lazarusidestrconsts.lismenueditortemplatesaved
msgid "Template saved"
msgstr "Шаблон сохранён"
#: lazarusidestrconsts.lismenueditortherearenousersavedmenutemplates
msgid ""
"There are no user-saved menu templates.\n"
"\n"
"Only standard default templates are available."
msgstr ""
"Пользовательские шаблоны меню отсутствуют.\n"
"\n"
"Доступны только стандартные шаблоны, имеющиеся по умолчанию."
#: lazarusidestrconsts.lismenueditortsclistgetscanlistcompnameinvalidindexdforfscanlis
#, object-pascal-format
msgid "TSCList.GetScanListCompName: invalid index %d for FScanList"
msgstr "TSCList.GetScanListCompName: некорректный индекс %d в FScanList"
#: lazarusidestrconsts.lismenueditoryouhavetochangetheshortcutfromsstoavoidaconflict
#, object-pascal-format
msgid ""
"You have to change the shortcut from %s\n"
"to avoid a conflict"
msgstr ""
"Вам следует изменить комбинацию клавиш %s\n"
"для избежания конфликта."
#: lazarusidestrconsts.lismenueditoryoumustentertextforthecaption
msgid "You must enter text for the Caption"
msgstr "Необходимо ввести текст заголовка"
#: lazarusidestrconsts.lismenuencloseinifdef
msgid "Enclose in $IFDEF ..."
msgstr "Заключить в $IFDEF ..."
#: lazarusidestrconsts.lismenuencloseselection
msgid "Enclose Selection ..."
msgstr "Заключить выделенное в ..."
#: lazarusidestrconsts.lismenuevaluate
msgid "E&valuate/Modify ..."
msgstr "&Вычислить/Изменить ..."
#: lazarusidestrconsts.lismenuextractproc
msgid "Extract Procedure ..."
msgstr "Извлечь в процедуру ..."
#: lazarusidestrconsts.lismenufile
msgid "&File"
msgstr "&Файл"
#: lazarusidestrconsts.lismenufind
msgctxt "lazarusidestrconsts.lismenufind"
msgid "Find"
msgstr "Найти"
#: lazarusidestrconsts.lismenufind2
msgid "&Find ..."
msgstr "&Найти ..."
#: lazarusidestrconsts.lismenufindblockotherendofcodeblock
msgid "Find Other End of Code Block"
msgstr "Найти другой конец блока кода"
#: lazarusidestrconsts.lismenufindcodeblockstart
msgid "Find Start of Code Block"
msgstr "Найти начало блока кода"
#: lazarusidestrconsts.lismenufinddeclarationatcursor
msgid "Find Declaration at Cursor"
msgstr "Найти объявление под курсором"
#: lazarusidestrconsts.lismenufindidentifierrefs
msgid "Find Identifier References ..."
msgstr "Найти ссылки на идентификатор ..."
#: lazarusidestrconsts.lismenufindinfiles
msgid "Find &in Files ..."
msgstr "Найти в &файлах ..."
#: lazarusidestrconsts.lismenufindnext
msgid "Find &Next"
msgstr "Найти следующее"
#: lazarusidestrconsts.lismenufindprevious
msgid "Find &Previous"
msgstr "Найти предыдущее"
#: lazarusidestrconsts.lismenufindreferencesofusedunit
msgid "Find References Of Used Unit"
msgstr "Найти обращения к коду модуля"
#: lazarusidestrconsts.lismenugeneraloptions
msgid "Options ..."
msgstr "Параметры ..."
#: lazarusidestrconsts.lismenugotoincludedirective
msgid "Goto Include Directive"
msgstr "Перейти по директиве $I"
#: lazarusidestrconsts.lismenugotoline
msgid "Goto Line ..."
msgstr "Перейти к строке ..."
#: lazarusidestrconsts.lismenuguessmisplacedifdef
msgid "Guess Misplaced IFDEF/ENDIF"
msgstr "Исправить несоответствие IFDEF/ENDIF"
#: lazarusidestrconsts.lismenuguessunclosedblock
msgid "Guess Unclosed Block"
msgstr "Исправить незавершённый блок"
#: lazarusidestrconsts.lismenuhelp
msgid "&Help"
msgstr "&Справка"
#: lazarusidestrconsts.lismenuideinternals
msgid "IDE Internals"
msgstr "Внутреннее состояние IDE"
#: lazarusidestrconsts.lismenuincrementalfind
msgid "Incremental Find"
msgstr "Найти инкрементно"
#: lazarusidestrconsts.lismenuindentselection
msgid "Indent Selection"
msgstr "Увеличить отступ выделенного"
#: lazarusidestrconsts.lismenuinsertchangelogentry
msgid "ChangeLog Entry"
msgstr "Элемент ChangeLog"
#: lazarusidestrconsts.lismenuinsertcharacter
msgid "Insert from Character Map ..."
msgstr "Вставить из таблицы символов ..."
#: lazarusidestrconsts.lismenuinsertcvskeyword
msgid "Insert CVS Keyword"
msgstr "Вставить ключ CVS"
#: lazarusidestrconsts.lismenuinsertdatetime
msgid "Current Date and Time"
msgstr "Текущие дата и время"
#: lazarusidestrconsts.lismenuinsertfilename
msgid "Insert Full Filename ..."
msgstr "Вставить полное имя файла ..."
#: lazarusidestrconsts.lismenuinsertgeneral
msgctxt "lazarusidestrconsts.lismenuinsertgeneral"
msgid "Insert General"
msgstr "Вставить общие"
#: lazarusidestrconsts.lismenuinsertgplnotice
msgid "GPL Notice"
msgstr "Заметка о GPL"
#: lazarusidestrconsts.lismenuinsertgplnoticetranslated
msgid "GPL Notice (translated)"
msgstr "Заметка о GPL (перевод)"
#: lazarusidestrconsts.lismenuinsertlgplnotice
msgid "LGPL Notice"
msgstr "Заметка об LGPL"
#: lazarusidestrconsts.lismenuinsertlgplnoticetranslated
msgid "LGPL Notice (translated)"
msgstr "Заметка об LGPL (перевод)"
#: lazarusidestrconsts.lismenuinsertmitnotice
msgid "MIT Notice"
msgstr "Заметка о MIT"
#: lazarusidestrconsts.lismenuinsertmitnoticetranslated
msgid "MIT Notice (translated)"
msgstr "Заметка о MIT (перевод)"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice
msgid "Modified LGPL Notice"
msgstr "Заметка о модифицированной LGPL"
#: lazarusidestrconsts.lismenuinsertmodifiedlgplnoticetranslated
msgid "Modified LGPL Notice (translated)"
msgstr "Заметка о модифицированной LGPL (перевод)"
#: lazarusidestrconsts.lismenuinsertusername
msgid "Current Username"
msgstr "Текущее имя пользователя"
#: lazarusidestrconsts.lismenuinspect
msgctxt "lazarusidestrconsts.lismenuinspect"
msgid "&Inspect ..."
msgstr "&Просмотреть ..."
#: lazarusidestrconsts.lismenujumpback
msgctxt "lazarusidestrconsts.lismenujumpback"
msgid "Jump Back"
msgstr "Перейти назад"
#: lazarusidestrconsts.lismenujumpforward
msgctxt "lazarusidestrconsts.lismenujumpforward"
msgid "Jump Forward"
msgstr "Перейти вперёд"
#: lazarusidestrconsts.lismenujumpto
msgid "Jump to"
msgstr "Перейти к"
#: lazarusidestrconsts.lismenujumptoimplementation
msgid "Jump to Implementation"
msgstr "Перейти к секции Implementation"
#: lazarusidestrconsts.lismenujumptoimplementationuses
msgid "Jump to Implementation uses"
msgstr "Перейти к выражению Uses секции Implementation"
#: lazarusidestrconsts.lismenujumptoinitialization
msgid "Jump to Initialization"
msgstr "Перейти к секции Initialization"
#: lazarusidestrconsts.lismenujumptointerface
msgid "Jump to Interface"
msgstr "Перейти к секции Interface"
#: lazarusidestrconsts.lismenujumptointerfaceuses
msgid "Jump to Interface uses"
msgstr "Перейти к выражению Uses секции Interface"
#: lazarusidestrconsts.lismenujumptonextbookmark
msgid "Jump to Next Bookmark"
msgstr "Перейти к следующей закладке"
#: lazarusidestrconsts.lismenujumptonexterror
msgid "Jump to Next Error"
msgstr "Перейти к следующей ошибке"
#: lazarusidestrconsts.lismenujumptoprevbookmark
msgid "Jump to Previous Bookmark"
msgstr "Перейти к предыдущей закладке"
#: lazarusidestrconsts.lismenujumptopreverror
msgid "Jump to Previous Error"
msgstr "Перейти к предыдущей ошибке"
#: lazarusidestrconsts.lismenujumptoprocedurebegin
msgid "Jump to Procedure begin"
msgstr "Перейти к началу тела процедуры"
#: lazarusidestrconsts.lismenujumptoprocedureheader
msgid "Jump to Procedure header"
msgstr "Перейти к заголовку процедуры"
#: lazarusidestrconsts.lismenulowercaseselection
msgid "Lowercase Selection"
msgstr "Нижний регистр выделенного"
#: lazarusidestrconsts.lismenumacrolistview
msgctxt "lazarusidestrconsts.lismenumacrolistview"
msgid "Editor Macros"
msgstr "Макросы редактора"
#: lazarusidestrconsts.lismenumakeresourcestring
msgid "Make Resource String ..."
msgstr "Создать строку ресурсов ..."
#: lazarusidestrconsts.lismenumultipaste
msgctxt "lazarusidestrconsts.lismenumultipaste"
msgid "MultiPaste ..."
msgstr "Вставить с форматированием ..."
#: lazarusidestrconsts.lismenunewcomponent
msgctxt "lazarusidestrconsts.lismenunewcomponent"
msgid "New Component"
msgstr "Новый компонент"
#: lazarusidestrconsts.lismenunewcustom
#, object-pascal-format
msgid "New %s"
msgstr "Новый элемент: %s"
#: lazarusidestrconsts.lismenunewform
msgid "New Form"
msgstr "Создать форму"
#: lazarusidestrconsts.lismenunewother
msgid "New ..."
msgstr "Создать ..."
#: lazarusidestrconsts.lismenunewpackage
msgid "New Package ..."
msgstr "Новый пакет ..."
#: lazarusidestrconsts.lismenunewproject
msgid "New Project ..."
msgstr "Создать проект ..."
#: lazarusidestrconsts.lismenunewprojectfromfile
msgid "New Project from File ..."
msgstr "Создать проект из файла ..."
#: lazarusidestrconsts.lismenunewunit
msgctxt "lazarusidestrconsts.lismenunewunit"
msgid "New Unit"
msgstr "Создать модуль"
#: lazarusidestrconsts.lismenuonlinehelp
msgid "Online Help"
msgstr "Справка в сети"
#: lazarusidestrconsts.lismenuopen
msgid "&Open ..."
msgstr "&Открыть ..."
#: lazarusidestrconsts.lismenuopenfilenameatcursor
msgid "Open Filename at Cursor"
msgstr "Открыть файл с именем под курсором"
#: lazarusidestrconsts.lismenuopenfolder
msgid "Open Folder ..."
msgstr "Открыть каталог ..."
#: lazarusidestrconsts.lismenuopenpackage
msgid "Open Loaded Package ..."
msgstr "Открыть загруженный пакет ..."
#: lazarusidestrconsts.lismenuopenpackagefile
msgid "Open Package File (.lpk) ..."
msgstr "Открыть файл пакета (.lpk) ..."
#: lazarusidestrconsts.lismenuopenpackageofcurunit
msgid "Open Package of Current Unit"
msgstr "Открыть пакет текущего модуля"
#: lazarusidestrconsts.lismenuopenproject
msgid "Open Project ..."
msgstr "Открыть проект ..."
#: lazarusidestrconsts.lismenuopenrecent
msgid "Open &Recent"
msgstr "Открыть &недавний"
#: lazarusidestrconsts.lismenuopenrecentpkg
msgid "Open Recent Package"
msgstr "Открыть недавний пакет"
#: lazarusidestrconsts.lismenuopenrecentproject
msgctxt "lazarusidestrconsts.lismenuopenrecentproject"
msgid "Open Recent Project"
msgstr "Открыть недавний проект"
#: lazarusidestrconsts.lismenuopenunit
msgid "Open Unit ..."
msgstr "Открыть модуль ..."
#: lazarusidestrconsts.lismenupackage
msgid "Pa&ckage"
msgstr "П&акет"
#: lazarusidestrconsts.lismenupackagegraph
msgid "Package Graph"
msgstr "Диаграмма пакетов"
#: lazarusidestrconsts.lismenupackagelinks
msgid "Package Links ..."
msgstr "Ссылки на пакеты ..."
#: lazarusidestrconsts.lismenupastefromclipboard
msgctxt "lazarusidestrconsts.lismenupastefromclipboard"
msgid "Paste from clipboard"
msgstr "Вставить из буфера обмена"
#: lazarusidestrconsts.lismenupkgnewpackagecomponent
msgid "New package component"
msgstr "Новый компонент пакета"
#: lazarusidestrconsts.lismenuprocedurelist
msgctxt "lazarusidestrconsts.lismenuprocedurelist"
msgid "Procedure List ..."
msgstr "Список процедур ..."
#: lazarusidestrconsts.lismenuproject
msgid "&Project"
msgstr "Про&ект"
#: lazarusidestrconsts.lismenuprojectinspector
msgid "Project Inspector"
msgstr "Инспектор проекта"
#: lazarusidestrconsts.lismenuprojectoptions
msgid "Project Options ..."
msgstr "Параметры проекта ..."
#: lazarusidestrconsts.lismenuprojectrun
msgctxt "lazarusidestrconsts.lismenuprojectrun"
msgid "&Run"
msgstr "&Запустить"
#: lazarusidestrconsts.lismenupublishproject
msgid "Publish Project ..."
msgstr "Опубликовать проект ..."
#: lazarusidestrconsts.lismenuquickcompile
msgid "Quick Compile"
msgstr "Быстрая компиляция"
#: lazarusidestrconsts.lismenuquicksyntaxcheck
msgid "Quick Syntax Check"
msgstr "Быстрая проверка синтаксиса"
#: lazarusidestrconsts.lismenuquicksyntaxcheckok
msgid "Quick syntax check OK"
msgstr "Быстрая проверка синтаксиса прошла успешно."
#: lazarusidestrconsts.lismenuremovefromproject
msgid "Remove from Project ..."
msgstr "Убрать из проекта ..."
#: lazarusidestrconsts.lismenurenameidentifier
msgid "Rename Identifier ..."
msgstr "Переименовать идентификатор ..."
#: lazarusidestrconsts.lismenurenamelowercase
msgid "Rename Unit Files to LowerCase ..."
msgstr "Переименовать файлы модулей в нижний регистр ..."
#: lazarusidestrconsts.lismenureportingbug
msgctxt "lazarusidestrconsts.lismenureportingbug"
msgid "Reporting a Bug"
msgstr "Сообщить об ошибке"
#: lazarusidestrconsts.lismenuresaveformswithi18n
msgid "Resave forms with enabled i18n"
msgstr "Пересохранить формы с включённой поддержкой i18n"
#: lazarusidestrconsts.lismenurescanfpcsourcedirectory
msgid "Rescan FPC Source Directory"
msgstr "Пересмотреть каталог исходного кода FPC"
#: lazarusidestrconsts.lismenuresetdebugger
msgid "Reset Debugger"
msgstr "Сбросить отладчик"
#: lazarusidestrconsts.lismenurevert
msgid "Revert"
msgstr "Возвратить"
#: lazarusidestrconsts.lismenurun
msgctxt "lazarusidestrconsts.lismenurun"
msgid "&Run"
msgstr "&Запуск"
#: lazarusidestrconsts.lismenurunfile
msgid "Run File"
msgstr "Запустить файл"
#: lazarusidestrconsts.lismenurunparameters
msgid "Run &Parameters ..."
msgstr "П&араметры запуска ..."
#: lazarusidestrconsts.lismenuruntocursor
msgctxt "lazarusidestrconsts.lismenuruntocursor"
msgid "Run to Cursor"
msgstr "Запустить до курсора"
#: lazarusidestrconsts.lismenurunwithdebugging
msgid "Run with Debugging"
msgstr "Запустить с отладкой"
#: lazarusidestrconsts.lismenurunwithoutdebugging
msgid "Run without Debugging"
msgstr "Запустить без отладки"
#: lazarusidestrconsts.lismenusave
msgctxt "lazarusidestrconsts.lismenusave"
msgid "&Save"
msgstr "&Сохранить"
#: lazarusidestrconsts.lismenusaveas
msgid "Save &As ..."
msgstr "Сохранить &как ..."
#: lazarusidestrconsts.lismenusaveproject
msgid "Save Project"
msgstr "Сохранить проект"
#: lazarusidestrconsts.lismenusaveprojectas
msgid "Save Project As ..."
msgstr "Сохранить проект как ..."
#: lazarusidestrconsts.lismenusearch
msgid "&Search"
msgstr "П&оиск"
#: lazarusidestrconsts.lismenuselect
msgid "Select"
msgstr "Выделить"
#: lazarusidestrconsts.lismenuselectall
msgctxt "lazarusidestrconsts.lismenuselectall"
msgid "Select All"
msgstr "Выделить все"
#: lazarusidestrconsts.lismenuselectcodeblock
msgid "Select Code Block"
msgstr "Выделить блок кода"
#: lazarusidestrconsts.lismenuselectline
msgid "Select Line"
msgstr "Выделить строку"
#: lazarusidestrconsts.lismenuselectparagraph
msgid "Select Paragraph"
msgstr "Выделить абзац"
#: lazarusidestrconsts.lismenuselecttobrace
msgid "Select to Brace"
msgstr "Выделить до скобки"
#: lazarusidestrconsts.lismenuselectword
msgid "Select Word"
msgstr "Выделить слово"
#: lazarusidestrconsts.lismenusetfreebookmark
msgctxt "lazarusidestrconsts.lismenusetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Установить свободную закладку"
#: lazarusidestrconsts.lismenushowexecutionpoint
msgid "S&how Execution Point"
msgstr "Показать точку &исполнения"
#: lazarusidestrconsts.lismenushowsmarthint
msgid "Context sensitive smart hint"
msgstr "Контекстно-зависимая умная подсказка"
#: lazarusidestrconsts.lismenusortselection
msgid "Sort Selection ..."
msgstr "Сортировать выделенное ..."
#: lazarusidestrconsts.lismenusource
msgid "S&ource"
msgstr "&Код"
#: lazarusidestrconsts.lismenuswapcaseselection
msgid "Swap Case in Selection"
msgstr "Переключить регистр выделенного"
#: lazarusidestrconsts.lismenutabstospacesselection
msgid "Tabs to Spaces in Selection"
msgstr "Преобразовать ТАБ в пробелы в выделенном"
#: lazarusidestrconsts.lismenutemplateabout
msgctxt "lazarusidestrconsts.lismenutemplateabout"
msgid "About"
msgstr "О проекте"
#: lazarusidestrconsts.lismenutogglecomment
msgid "Toggle Comment in Selection"
msgstr "Переключить комментарий"
#: lazarusidestrconsts.lismenutools
msgid "&Tools"
msgstr "Се&рвис"
#: lazarusidestrconsts.lismenuuncommentselection
msgid "Uncomment Selection"
msgstr "Раскомментировать"
#: lazarusidestrconsts.lismenuunindentselection
msgid "Unindent Selection"
msgstr "Уменьшить отступ выделенного"
#: lazarusidestrconsts.lismenuuppercaseselection
msgid "Uppercase Selection"
msgstr "Верхний регистр выделенного"
#: lazarusidestrconsts.lismenuuseunit
msgctxt "lazarusidestrconsts.lismenuuseunit"
msgid "Add Unit to Uses Section ..."
msgstr "Добавить модуль в выражение Uses ..."
#: lazarusidestrconsts.lismenuview
msgid "&View"
msgstr "&Вид"
#: lazarusidestrconsts.lismenuviewanchoreditor
msgid "Anchor Editor"
msgstr "Редактор привязок"
#: lazarusidestrconsts.lismenuviewcodebrowser
msgctxt "lazarusidestrconsts.lismenuviewcodebrowser"
msgid "Code Browser"
msgstr "Браузер кода"
#: lazarusidestrconsts.lismenuviewcodeexplorer
msgctxt "lazarusidestrconsts.lismenuviewcodeexplorer"
msgid "Code Explorer"
msgstr "Обозреватель кода"
#: lazarusidestrconsts.lismenuviewcomponentpalette
msgid "Component Palette"
msgstr "Палитра компонентов"
#: lazarusidestrconsts.lismenuviewcomponents
msgid "&Components"
msgstr "&Компоненты"
#: lazarusidestrconsts.lismenuviewdebugevents
msgctxt "lazarusidestrconsts.lismenuviewdebugevents"
msgid "Event Log"
msgstr "Журнал событий"
#: lazarusidestrconsts.lismenuviewdebugoutput
msgid "Debug Output"
msgstr "Вывод отладчика"
#: lazarusidestrconsts.lismenuviewforms
msgid "Forms ..."
msgstr "Формы ..."
#: lazarusidestrconsts.lismenuviewhistory
msgctxt "lazarusidestrconsts.lismenuviewhistory"
msgid "History"
msgstr "История"
#: lazarusidestrconsts.lismenuviewjumphistory
msgctxt "lazarusidestrconsts.lismenuviewjumphistory"
msgid "Jump History"
msgstr "История переходов"
#: lazarusidestrconsts.lismenuviewlocalvariables
msgctxt "lazarusidestrconsts.lismenuviewlocalvariables"
msgid "Local Variables"
msgstr "Локальные переменные"
#: lazarusidestrconsts.lismenuviewmessages
msgctxt "lazarusidestrconsts.lismenuviewmessages"
msgid "Messages"
msgstr "Сообщения"
#: lazarusidestrconsts.lismenuviewobjectinspector
msgctxt "lazarusidestrconsts.lismenuviewobjectinspector"
msgid "Object Inspector"
msgstr "Инспектор объектов"
#: lazarusidestrconsts.lismenuviewprojectsource
msgid "&View Project Source"
msgstr "&Просмотреть исходный код проекта"
#: lazarusidestrconsts.lismenuviewpseudoterminal
msgctxt "lazarusidestrconsts.lismenuviewpseudoterminal"
msgid "Console In/Output"
msgstr "Ввод/вывод в консоли"
#: lazarusidestrconsts.lismenuviewregisters
msgctxt "lazarusidestrconsts.lismenuviewregisters"
msgid "Registers"
msgstr "Регистры"
#: lazarusidestrconsts.lismenuviewrestrictionbrowser
msgid "Restriction Browser"
msgstr "Браузер ограничений"
#: lazarusidestrconsts.lismenuviewsearchresults
msgid "Search Results"
msgstr "Результаты поиска"
#: lazarusidestrconsts.lismenuviewsourceeditor
msgctxt "lazarusidestrconsts.lismenuviewsourceeditor"
msgid "Source Editor"
msgstr "Редактор исходного кода"
#: lazarusidestrconsts.lismenuviewtaborder
msgid "Tab Order"
msgstr "Порядок перехода"
#: lazarusidestrconsts.lismenuviewthreads
msgctxt "lazarusidestrconsts.lismenuviewthreads"
msgid "Threads"
msgstr "Потоки исполнения"
#: lazarusidestrconsts.lismenuviewtoggleformunit
msgid "Toggle Form/Unit View"
msgstr "Переключить форму/модуль"
#: lazarusidestrconsts.lismenuviewunitdependencies
msgctxt "lazarusidestrconsts.lismenuviewunitdependencies"
msgid "Unit Dependencies"
msgstr "Зависимости модуля"
#: lazarusidestrconsts.lismenuviewunitinfo
msgid "Unit Information ..."
msgstr "Сведения о модуле ..."
#: lazarusidestrconsts.lismenuviewunits
msgid "Units ..."
msgstr "Модули ..."
#: lazarusidestrconsts.lismenuviewwatches
msgctxt "lazarusidestrconsts.lismenuviewwatches"
msgid "Watches"
msgstr "Окно наблюдений"
#: lazarusidestrconsts.lismenuwhatneedsbuilding
msgid "What Needs Building"
msgstr "Что требует сборки"
#: lazarusidestrconsts.lismenuwindow
msgid "&Window"
msgstr "Ок&но"
#: lazarusidestrconsts.lismeother
msgctxt "lazarusidestrconsts.lismeother"
msgid "Other tabs"
msgstr "Прочие вкладки"
#: lazarusidestrconsts.lismessageseditor
msgid "Messages Editor"
msgstr "Редактор сообщений"
#: lazarusidestrconsts.lismessageswindow
msgid "Messages Window"
msgstr "Окно сообщений"
#: lazarusidestrconsts.lismethodclassnotfound
msgid "Method class not found"
msgstr "Класс метода не найден"
#: lazarusidestrconsts.lismissingdirectory
#, object-pascal-format
msgid "missing directory \"%s\""
msgstr "каталог \"%s\" отсутствует"
#: lazarusidestrconsts.lismissingevents
msgid "Missing Events"
msgstr "Отсутствующие события"
#: lazarusidestrconsts.lismissingexecutable
#, object-pascal-format
msgid "missing executable \"%s\""
msgstr "исполнимый файл \"%s\" отсутствует"
#: lazarusidestrconsts.lismissingidentifiers
msgid "Missing identifiers"
msgstr "Отсутствующие идентификаторы"
#: lazarusidestrconsts.lismissingpackages
msgid "Missing Packages"
msgstr "Отсутствующие пакеты"
#: lazarusidestrconsts.lismissingunitschoices
msgid "Your choices are:"
msgstr "Вы можете:"
#: lazarusidestrconsts.lismissingunitscomment
msgid "Comment Out"
msgstr "Закомментировать"
#: lazarusidestrconsts.lismissingunitsfordelphi
msgid "For Delphi only"
msgstr "Только для Delphi"
#: lazarusidestrconsts.lismissingunitsinfo1
msgid "1) Comment out the selected units."
msgstr "1) Закомментировать выбранные модули."
#: lazarusidestrconsts.lismissingunitsinfo1b
msgid "1) Use the units only for Delphi."
msgstr "1) Использовать модули только для Delphi."
#: lazarusidestrconsts.lismissingunitsinfo2
msgid "2) Search for units. Found paths are added to project settings."
msgstr "2) Найти модули. Обнаруженные пути добавить в проект."
#: lazarusidestrconsts.lismissingunitsinfo3
msgid "3) Leave these units in uses sections as they are."
msgstr "3) Оставить эти модули в выражениях Uses без изменений."
#: lazarusidestrconsts.lismissingunitssearch
msgid "Search Unit Path"
msgstr "Найти путь к модулю"
#: lazarusidestrconsts.lismissingunitsskip
msgctxt "lazarusidestrconsts.lismissingunitsskip"
msgid "Skip"
msgstr "Пропустить"
#: lazarusidestrconsts.lismitnotice
msgid ""
"<description>\n"
"\n"
"Copyright (c) <year> <copyright holders>\n"
"\n"
"Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the \"Software\"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions:\n"
"\n"
"The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software.\n"
"\n"
"THE SOFTWARE IS PROVIDED \"AS IS\", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE."
msgstr ""
"<описание>\n"
"\n"
"© <год первого опубликования программы> <имя (наименование) автора или иного правообладателя>\n"
"\n"
"Данная лицензия разрешает лицам, получившим копию данного программного обеспечения и сопутствующей документации (в дальнейшем именуемыми «Программное Обеспечение»), безвозмездно использовать Программное Обеспечение без ограничений, включая неограниченное право на использование, копирование, изменение, добавление, публикацию, распространение, сублицензирование и/или продажу копий Программного Обеспечения, также как и лицам, которым предоставляется данное Программное Обеспечение, при соблюдении следующих условий:\n"
"\n"
"Указанное выше уведомление об авторском праве и данные условия должны быть включены во все копии или значимые части данного Программного Обеспечения.\n"
"\n"
"ДАННОЕ ПРОГРАММНОЕ ОБЕСПЕЧЕНИЕ ПРЕДОСТАВЛЯЕТСЯ «КАК ЕСТЬ», БЕЗ КАКИХ-ЛИБО ГАРАНТИЙ, ЯВНО ВЫРАЖЕННЫХ ИЛИ ПОДРАЗУМЕВАЕМЫХ, ВКЛЮЧАЯ, НО НЕ ОГРАНИЧИВАЯСЬ ГАРАНТИЯМИ ТОВАРНОЙ ПРИГОДНОСТИ, СООТВЕТСТВИЯ ПО ЕГО КОНКРЕТНОМУ НАЗНАЧЕНИЮ И ОТСУТСТВИЯ НАРУШЕНИЙ ПРАВ. НИ В КАКОМ СЛУЧАЕ АВТОРЫ ИЛИ ПРАВООБЛАДАТЕЛИ НЕ НЕСУТ ОТВЕТСТВЕННОСТИ ПО ИСКАМ О ВОЗМЕЩЕНИИ УЩЕРБА, УБЫТКОВ ИЛИ ДРУГИХ ТРЕБОВАНИЙ ПО ДЕЙСТВУЮЩИМ КОНТРАКТАМ, ДЕЛИКТАМ ИЛИ ИНОМУ, ВОЗНИКШИМ ИЗ, ИМЕЮЩИМ ПРИЧИНОЙ ИЛИ СВЯЗАННЫМ С ПРОГРАММНЫМ ОБЕСПЕЧЕНИЕМ ИЛИ ИСПОЛЬЗОВАНИЕМ ПРОГРАММНОГО ОБЕСПЕЧЕНИЯ ИЛИ ИНЫМИ ДЕЙСТВИЯМИ С ПРОГРАММНЫМ ОБЕСПЕЧЕНИЕМ."
#: lazarusidestrconsts.lismmadditionsandoverrides
msgid "Additions and Overrides"
msgstr "Дополнения и перекрытия"
#: lazarusidestrconsts.lismmaddscustomoptions
msgid "Adds custom options:"
msgstr "Добавляются пользовательские параметры:"
#: lazarusidestrconsts.lismmappendarbitraryfpcoptionsego1ghtldflag
msgid "Append arbitrary fpc options, e.g. -O1 -ghtl -dFlag"
msgstr "Добавить произвольные параметры FPC, например, -O1 -ghtl -dFlag"
#: lazarusidestrconsts.lismmapplytoallpackages
msgid "Apply to all packages."
msgstr "Применить ко всем пакетам."
#: lazarusidestrconsts.lismmapplytoallpackagesandprojects
msgid "Apply to all packages and projects."
msgstr "Применить ко всем пакетам и проектам."
#: lazarusidestrconsts.lismmapplytoallpackagesmatching
#, object-pascal-format
msgid "Apply to all packages matching name \"%s\""
msgstr "Применить ко всем пакетам, содержащим в имени \"%s\""
#: lazarusidestrconsts.lismmapplytoproject
msgid "Apply to project."
msgstr "Применить к проекту."
#: lazarusidestrconsts.lismmcreateanewgroupofoptions
msgid "Create a new group of options"
msgstr "Создать новую группу параметров"
#: lazarusidestrconsts.lismmcustomoption
msgid "Custom Option"
msgstr "Пользовательский параметр"
#: lazarusidestrconsts.lismmdeletetheselectedtargetoroption
msgid "Delete the selected target or option"
msgstr "Удалить выбранную цель либо параметр"
#: lazarusidestrconsts.lismmdoesnotaddcustomoptions
msgid "Does not add custom options:"
msgstr "Не добавляются пользовательские параметры:"
#: lazarusidestrconsts.lismmdoesnothaveidemacro
#, object-pascal-format
msgid "Does not have IDE Macro %s:=%s"
msgstr "Не имеется макроса IDE %s:=%s"
#: lazarusidestrconsts.lismmdoesnotoverrideoutdirfu
msgid "Does not override OutDir (-FU)"
msgstr "Не перекрывается OutDir (-FU)"
#: lazarusidestrconsts.lismmexcludeallpackagesmatching
#, object-pascal-format
msgid "Exclude all packages matching name \"%s\""
msgstr "Исключить все пакеты, содержащие в имени \"%s\""
#: lazarusidestrconsts.lismmexpectedaftermacronamebutfound
#, object-pascal-format
msgid "expected \":=\" after macro name but found \"%s\""
msgstr "после имени макроса ожидается \":=\", но найдено \"%s\""
#: lazarusidestrconsts.lismmexpectedmacronamebutfound
#, object-pascal-format
msgid "expected macro name but found \"%s\""
msgstr "ожидается имя макроса, но найдено \"%s\""
#: lazarusidestrconsts.lismmfromto
#, object-pascal-format
msgid "From %s to %s"
msgstr "Относительно %s в %s"
#: lazarusidestrconsts.lismmidemacro
msgid "IDE Macro"
msgstr "Макрос IDE"
#: lazarusidestrconsts.lismmidemacro2
#, object-pascal-format
msgid "IDE Macro %s:=%s"
msgstr "Макрос IDE %s:=%s"
#: lazarusidestrconsts.lismminvalidcharacterat
#, object-pascal-format
msgid "invalid character \"%s\" at %s"
msgstr "неверный символ \"%s\", смещение %s"
#: lazarusidestrconsts.lismminvalidcharacterinmacrovalue
#, object-pascal-format
msgid "invalid character in macro value \"%s\""
msgstr "неверный символ в значении макроса \"%s\""
#: lazarusidestrconsts.lismmmissingmacroname
msgid "missing macro name"
msgstr "отсутствует имя макроса"
#: lazarusidestrconsts.lismmmoveselecteditemdown
msgctxt "lazarusidestrconsts.lismmmoveselecteditemdown"
msgid "Move selected item down"
msgstr "Переместить выбранный элемент вниз"
#: lazarusidestrconsts.lismmmoveselecteditemup
msgctxt "lazarusidestrconsts.lismmmoveselecteditemup"
msgid "Move selected item up"
msgstr "Переместить выбранный элемент вверх"
#: lazarusidestrconsts.lismmnewtarget
msgid "New Target"
msgstr "Новая цель"
#: lazarusidestrconsts.lismmoverrideoutdirfu
#, object-pascal-format
msgid "Override OutDir (-FU): %s"
msgstr "Перекрывается OutDir (-FU): %s"
#: lazarusidestrconsts.lismmoverrideoutputdirectory
msgid "Override output directory (-FU)"
msgstr "Перекрытие каталога вывода (-FU)"
#: lazarusidestrconsts.lismmoverrideoutputdirectoryfuoftarget
msgid "Override output directory -FU of target"
msgstr "Перекрыть каталог вывода -FU цели"
#: lazarusidestrconsts.lismmredolastundotothisgrid
msgid "Redo last undo to this grid"
msgstr "Вернуть последнюю отменённую правку в данной таблице"
#: lazarusidestrconsts.lismmsetanidemacroeglclwidgettypewin32
msgid "Set an IDE macro, e.g.: LCLWidgetType:=win32"
msgstr "Установить значение макроса IDE, например, LCLWidgetType:=win32"
#: lazarusidestrconsts.lismmsets
#, object-pascal-format
msgid "Set \"%s\""
msgstr "Присвоить \"%s\""
#: lazarusidestrconsts.lismmstoredinideenvironmentoptionsxml
msgid "Stored in IDE (environmentoptions.xml)"
msgstr "Хранящиеся в IDE (environmentoptions.xml)"
#: lazarusidestrconsts.lismmstoredinprojectlpi
msgid "Stored in project (.lpi)"
msgstr "Хранящиеся в проекте (.lpi)"
#: lazarusidestrconsts.lismmstoredinsessionofprojectlps
msgid "Stored in session of project (.lps)"
msgstr "Хранящиеся в сеансе работы с проектом (.lps)"
#: lazarusidestrconsts.lismmtargets
msgid "Targets: "
msgstr "Цели: "
#: lazarusidestrconsts.lismmundolastchangetothisgrid
msgid "Undo last change to this grid"
msgstr "Отменить последнюю правку в данной таблице"
#: lazarusidestrconsts.lismmvalues
#, object-pascal-format
msgid "Value \"%s\""
msgstr "Значение \"%s\""
#: lazarusidestrconsts.lismmwas
#, object-pascal-format
msgid "(was \"%s\")"
msgstr "(было \"%s\")"
#: lazarusidestrconsts.lismmwidgetsetavailableforlclproject
msgid "WidgetSet change is available only for LCL projects"
msgstr "Изменение библиотеки виджетов доступно только в проектах LCL"
#: lazarusidestrconsts.lismode
#, object-pascal-format
msgid ", Mode: %s"
msgstr ", режим: %s"
#: lazarusidestrconsts.lismodifiedlgplnotice
msgid ""
"<description>\n"
"\n"
"Copyright (C) <year> <name of author> <contact>\n"
"\n"
"This library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:\n"
"\n"
"As a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.\n"
"\n"
"This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. \n"
"\n"
"You should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
msgstr ""
"<одна строка с наименованием Библиотеки и кратким описанием её назначения>\n"
"\n"
"© <год первого опубликования библиотеки> <имя (наименование) автора или иного правообладателя> <способ связи>\n"
"\n"
"Данная библиотека является свободным программным обеспечением. Вы вправе распространять её и/или модифицировать в соответствии с условиями версии 2 либо по вашему выбору с условиями более поздней версии Стандартной Общественной Лицензии Ограниченного Применения GNU, опубликованной Free Software Foundation, со слудующим изменением:\n"
"\n"
"В качестве особого исключения правообладатели библиотеки дают вам право компоновать её с независимыми модулями для получения исполнимого файла, невзирая на условия лицензий таких независимых модулей, а также копировать и распространять получившийся исполнимый файл на ваших условиях, в том случае, если вы также соблюдаете для каждого скомпонованного независимого модуля условия его лицензии. Независимый модуль — это модуль, не являющийся производным от данной библиотеки. При внесении изменений в эту библиотеку вы вправе распространить на свою версию действие этого исключения, но не обязаны делать это. Если вы не желаете это делать, удалите текст этого исключения из своей версии.\n"
"\n"
"Мы распространяем эту библиотеку в надежде на то, что она будет вам полезной, однако НЕ ПРЕДОСТАВЛЯЕМ НА НЕЕ НИКАКИХ ГАРАНТИЙ, в том числе ГАРАНТИИ ТОВАРНОГО СОСТОЯНИЯ ПРИ ПРОДАЖЕ и ПРИГОДНОСТИ ДЛЯ ИСПОЛЬЗОВАНИЯ В КОНКРЕТНЫХ ЦЕЛЯХ. Для получения более подробной информации ознакомьтесь со Стандартной Общественной Лицензией Ограниченного Применений GNU. \n"
"\n"
"Вместе с данной библиотекой вы должны были получить экземпляр Стандартной Общественной Лицензии Ограниченного Применения GNU. Если вы его не получили, сообщите об этом в Free Software Foundation, Inc., 51 Franklin Street - Fifth Floor, Boston, MA 02110-1335, USA."
#: lazarusidestrconsts.lismore
msgctxt "lazarusidestrconsts.lismore"
msgid "More"
msgstr "Подробнее"
#: lazarusidestrconsts.lismoresub
msgctxt "lazarusidestrconsts.lismoresub"
msgid "More"
msgstr "Прочие"
#: lazarusidestrconsts.lismove
msgid "Move"
msgstr "Переместить"
#: lazarusidestrconsts.lismovedown
msgid "Move Down"
msgstr "Переместить вниз"
#: lazarusidestrconsts.lismovefiles
msgid "Move Files"
msgstr "Перемещение файлов"
#: lazarusidestrconsts.lismovefiles2
msgid "Move files?"
msgstr "Переместить файлы?"
#: lazarusidestrconsts.lismovefilesfromtothedirectoryof
#, object-pascal-format
msgid "Move %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Переместить файлы (%s шт.) сущности \"%s\" в каталог%s%s,%sпринадлежащий сущности \"%s\"?"
#: lazarusidestrconsts.lismoveonepositiondown
#, object-pascal-format
msgid "Move \"%s\" one position down"
msgstr "Переместить \"%s\" на позицию вниз"
#: lazarusidestrconsts.lismoveonepositionup
#, object-pascal-format
msgid "Move \"%s\" one position up"
msgstr "Переместить \"%s\" на позицию вверх"
#: lazarusidestrconsts.lismoveorcopyfiles
msgid "Move or Copy files?"
msgstr "Переместить или копировать файлы?"
#: lazarusidestrconsts.lismoveorcopyfilesfromtothedirectoryofpackage
#, object-pascal-format
msgid "Move or copy %s file(s) from %s to the directory%s%s%sof %s?"
msgstr "Переместить или копировать файлы (%s шт.) сущности \"%s\" в каталог%s%s,%sпринадлежащий сущности \"%s\"?"
#: lazarusidestrconsts.lismovepage
msgid "Move Page"
msgstr "Переместить вкладку"
#: lazarusidestrconsts.lismoveselecteddown
msgid "Move selected item down (Ctrl+Down)"
msgstr "Переместить выделенный элемент вниз (Ctrl+Down)"
#: lazarusidestrconsts.lismoveselectedup
msgid "Move selected item up (Ctrl+Up)"
msgstr "Переместить выделенный элемент вверх (Ctrl+Up)"
#: lazarusidestrconsts.lismoveto
msgid "Move to: "
msgstr "Переместить в: "
#: lazarusidestrconsts.lismoveup
msgid "Move Up"
msgstr "Переместить вверх"
#: lazarusidestrconsts.lismovingtheseunitswillbreaktheirusessectionsseemessa
msgid "Moving these units will break their uses sections. See Messages window for details."
msgstr "Перемещение этих модулей приведёт в негодность их выражения Uses. Подробности смотрите в окне сообщений."
#: lazarusidestrconsts.lismpcstyle
msgid "C style: \" => \\\""
msgstr "В стиле C: \" => \\\""
#: lazarusidestrconsts.lismpescapequotes
msgid "Escape "es"
msgstr "Экранировать &кавычки"
#: lazarusidestrconsts.lismpmultipaste
msgctxt "lazarusidestrconsts.lismpmultipaste"
msgid "MultiPaste"
msgstr "Вставить с форматированием"
#: lazarusidestrconsts.lismppascalstyle
msgid "Pascal style: ' => ''"
msgstr "В стиле Паскаля: ' => ''"
#: lazarusidestrconsts.lismppasteoptions
msgid "Paste &options"
msgstr "Параметры &вставки"
#: lazarusidestrconsts.lismppreview
msgid "&Preview"
msgstr "&Предварительный просмотр"
#: lazarusidestrconsts.lismptextaftereachline
msgid "Text &after each line"
msgstr "Текст пос&ле каждой строки"
#: lazarusidestrconsts.lismptextbeforeeachline
msgid "Text &before each line"
msgstr "Текст пере&д каждой строкой"
#: lazarusidestrconsts.lismptrimclipboardcontents
msgid "&Trim clipboard contents"
msgstr "Обре&зать содержимое буфера обмена"
#: lazarusidestrconsts.lismsgcolors
msgid "Message colors"
msgstr "Цвета сообщений"
#: lazarusidestrconsts.lismultipledirectoriesareseparatedwithsemicolons
msgid "Multiple directories are separated with semicolons"
msgstr "Разделителем каталогов является точка с запятой"
#: lazarusidestrconsts.lismultiplepack
msgid ", multiple packages: "
msgstr ", несколько пакетов: "
#: lazarusidestrconsts.lismvsavemessagestofiletxt
msgid "Save messages to file (*.txt)"
msgstr "Сохранить сообщения в файл (*.txt)"
#: lazarusidestrconsts.lisname
msgctxt "lazarusidestrconsts.lisname"
msgid "Name"
msgstr "Имя"
#: lazarusidestrconsts.lisnameconflict
msgid "Name conflict"
msgstr "Конфликт имён"
#: lazarusidestrconsts.lisnameofactivebuildmode
msgid "Name of active build mode"
msgstr "Имя активного режима сборки"
#: lazarusidestrconsts.lisnameofnewprocedure
msgid "Name of new procedure"
msgstr "Имя новой процедуры"
#: lazarusidestrconsts.lisnew
msgctxt "lazarusidestrconsts.lisnew"
msgid "New"
msgstr "Создать"
#: lazarusidestrconsts.lisnewclass
msgid "New Class"
msgstr "Новый Класс"
#: lazarusidestrconsts.lisnewconsoleapplication
msgid "New console application"
msgstr "Новое консольное приложение"
#: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype
#, object-pascal-format
msgid "Create a new editor file.%sChoose a type."
msgstr "Создать новый файл редактора.%s Выберите тип."
#: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile
msgid "Create a new empty text file."
msgstr "Создать новый пустой текстовый файл."
#: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype
#, object-pascal-format
msgid "Create a new project.%sChoose a type."
msgstr "Создать проект.%sВыберите тип."
#: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun
#, object-pascal-format
msgid "Create a new standard package.%sA package is a collection of units and components."
msgstr "Создать стандартный пакет%sПакет - это набор модулей и компонентов."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule
msgid "Create a new unit with a datamodule."
msgstr "Создать модуль с модулем данных."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe
msgid "Create a new unit with a frame."
msgstr "Создать новый модуль с фреймом."
#: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform
msgid "Create a new unit with a LCL form."
msgstr "Создать модуль с формой LCL."
#: lazarusidestrconsts.lisnewdlginheritfromaprojectformcomponent
msgid "Inherit from a project form or component"
msgstr "Унаследовать от формы или компонента проекта"
#: lazarusidestrconsts.lisnewdlgnoitemselected
msgid "No item selected"
msgstr "Не выделено элементов"
#: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst
msgid "Please select an item first."
msgstr "Выберите сначала элемент"
#: lazarusidestrconsts.lisnewencoding
msgid "New encoding:"
msgstr "Новая кодировка:"
#: lazarusidestrconsts.lisnewmacroname
#, object-pascal-format
msgid "Macro %d"
msgstr "Макрос %d"
#: lazarusidestrconsts.lisnewmacroname2
msgid "New Macroname"
msgstr "Новое имя макроса"
#: lazarusidestrconsts.lisnewmethodimplementationsareinsertedbetweenexisting
msgid "New method implementations are inserted between existing methods of this class. Either alphabetically, or as last, or in declaration order."
msgstr "Новые реализации методов вставляются между уже существующими для этого класса. Они могут вставляться по алфавиту, последними либо в порядке объявления методов."
#: lazarusidestrconsts.lisnewmethodsandmembersareinsertedalphabeticallyoradd
msgid "New method and member declarations in the class..end sections are inserted alphabetically or added last."
msgstr "Объявления новых методов и элементов класса в секциях class..end вставляются по алфавиту либо последними."
#: lazarusidestrconsts.lisnewpage
msgid "New page"
msgstr "Новая вкладка"
#: lazarusidestrconsts.lisnewproject
msgid "(new project)"
msgstr "(новый проект)"
#: lazarusidestrconsts.lisnewrecordedmacrosnottobesaved
msgid "New recorded macros. Not to be saved"
msgstr "Вновь записанные макросы. Сохранены не будут"
#: lazarusidestrconsts.lisnewunitsareaddedtousessections
msgid "New units are added to uses sections"
msgstr "Новые модули добавляются в выражения uses"
#: lazarusidestrconsts.lisnoautosaveactivedesktop
msgid "'Auto save active desktop' option is turned off, you will need to save current desktop manually."
msgstr "Автоматическое сохранение активного рабочего стола отключено, вам потребуется делать это вручную."
#: lazarusidestrconsts.lisnobackupfiles
msgid "No backup files"
msgstr "Без файлов резервных копий"
#: lazarusidestrconsts.lisnobuildprofilesselected
msgid "No profiles are selected to be built."
msgstr "Профилей сборки не выбрано."
#: lazarusidestrconsts.lisnochange
msgid "No change"
msgstr "Без изменений"
#: lazarusidestrconsts.lisnocodeselected
msgid "No code selected"
msgstr "Не выбрано кода"
#: lazarusidestrconsts.lisnocompileroptionsinherited
msgid "No compiler options inherited."
msgstr "Не унаследовано параметров компилятора."
#: lazarusidestrconsts.lisnofppkgprefix
msgid "empty Free Pascal compiler prefix."
msgstr "префикс установки компилятора Free Pascal пуст."
#: lazarusidestrconsts.lisnohints
msgid "no hints"
msgstr "подсказок нет"
#: lazarusidestrconsts.lisnoidewindowselected
msgid "No IDE window selected"
msgstr "Окно IDE не выбрано"
#: lazarusidestrconsts.lisnolfmfile
msgid "No LFM file"
msgstr "Файл LFM отсутствует"
#: lazarusidestrconsts.lisnomacroselected
msgid "No macro selected"
msgstr "Макрос не выбран"
#: lazarusidestrconsts.lisnomessageselected
msgid "(no message selected)"
msgstr "(сообщение не выбрано)"
#: lazarusidestrconsts.lisnoname
msgid "noname"
msgstr "без имени"
#: lazarusidestrconsts.lisnoneclicktochooseone
msgid "none, click to choose one"
msgstr "нет, щёлкните для выбора"
#: lazarusidestrconsts.lisnoneselected
msgid "(None selected)"
msgstr "(Не выбрано)"
#: lazarusidestrconsts.lisnonewfilefound
msgid "No new file found"
msgstr "Новых файлов не найдено"
#: lazarusidestrconsts.lisnonodeselected
msgid "no node selected"
msgstr "элементов не выбрано"
#: lazarusidestrconsts.lisnopascalfile
msgid "No Pascal file"
msgstr "Файл Паскаля отсутствует"
#: lazarusidestrconsts.lisnoprogramfilesfound
#, object-pascal-format
msgid "No program file \"%s\" found."
msgstr "Файл программы \"%s\" не найден."
#: lazarusidestrconsts.lisnoresourcestringsectionfound
msgid "No ResourceString Section found"
msgstr "Не найдено секции ResourceString"
#: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta
msgid "Normally the filter is a regular expression. In simple syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$"
msgstr "Обычно фильтр - это регулярное выражение. В простом синтаксисе . означает обычный символ, * - любую последовательность, ? - любой одиночный символ, а запятая и точка с запятой являются разделителями. Например: *.pas;*.pp соответствует ^(.*\\.pas|.*\\.pp)$"
#: lazarusidestrconsts.lisnostringconstantfound
msgid "No string constant found"
msgstr "Не найдено строковой константы"
#: lazarusidestrconsts.lisnotadesigntimepackage
msgid "Not a designtime package"
msgstr "Не пакет времени разработки"
#: lazarusidestrconsts.lisnotaninstallpackage
msgid "Not an install package"
msgstr "Пакет не является устанавливаемым"
#: lazarusidestrconsts.lisnotavalidfppkgprefix
msgid "Free Pascal compiler not found at the given prefix."
msgstr "компилятор Free Pascal не найден по данному префиксу."
#: lazarusidestrconsts.lisnote
msgctxt "lazarusidestrconsts.lisnote"
msgid "Note"
msgstr "Заметка"
#: lazarusidestrconsts.lisnotebooktabposbottom
msgctxt "lazarusidestrconsts.lisnotebooktabposbottom"
msgid "Bottom"
msgstr "Снизу"
#: lazarusidestrconsts.lisnotebooktabposleft
msgctxt "lazarusidestrconsts.lisnotebooktabposleft"
msgid "Left"
msgstr "Слева"
#: lazarusidestrconsts.lisnotebooktabposright
msgctxt "lazarusidestrconsts.lisnotebooktabposright"
msgid "Right"
msgstr "Справа"
#: lazarusidestrconsts.lisnotebooktabpostop
msgctxt "lazarusidestrconsts.lisnotebooktabpostop"
msgid "Top"
msgstr "Сверху"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal
msgid "NOTE: Could not create Define Template for Free Pascal Sources"
msgstr "ЗАМЕТКА: Невозможно создать шаблон определений из исходного кода Free Pascal"
#: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources
msgid "NOTE: Could not create Define Template for Lazarus Sources"
msgstr "ЗАМЕТКА: Невозможно создать шаблон определений из исходного кода Lazarus"
#: lazarusidestrconsts.lisnotemplateselected
msgid "no template selected"
msgstr "шаблон не выбран"
#: lazarusidestrconsts.lisnothingtodo
msgid "Nothing to do"
msgstr "Нечего выполнять"
#: lazarusidestrconsts.lisnotinstalled
msgid "not installed"
msgstr "не установлен"
#: lazarusidestrconsts.lisnotinstalledpackages
msgid "Not installed packages"
msgstr "Неустановленные пакеты"
#: lazarusidestrconsts.lisnotnow
msgid "Not now"
msgstr "Не сейчас"
#: lazarusidestrconsts.lisnowloadedscheme
msgid "Now loaded: "
msgstr "Сейчас загружена: "
#: lazarusidestrconsts.lisnpcreateanewproject
msgid "Create a new project"
msgstr "Создать новый проект"
#: lazarusidestrconsts.lisnumberoffilestoconvert
#, object-pascal-format
msgid "Number of files to convert: %s"
msgstr "Количество преобразуемых файлов: %s"
#: lazarusidestrconsts.lisobjectinspectorbecomesvisible
msgid "Object Inspector becomes visible when components are selected in designer."
msgstr "Показывать инспектор объектов при выборе компонентов в редакторе форм"
#: lazarusidestrconsts.lisobjectpascaldefault
msgid "Object Pascal - default"
msgstr "Object Pascal - по умолчанию"
#: lazarusidestrconsts.lisobjectpath
msgid "object path"
msgstr "пути к объектным файлам"
#: lazarusidestrconsts.lisofeswitchtoobjectinspectorfavoritestab
msgid "Switch to Object Inspector Favorites tab"
msgstr "Переключаться на вкладку 'Избранное' инспектора объектов"
#: lazarusidestrconsts.lisofpackage
#, object-pascal-format
msgid " of package %s"
msgstr " пакета %s"
#: lazarusidestrconsts.lisoftheprojectinspector
msgid " of the Project Inspector"
msgstr " в инспекторе проекта"
#: lazarusidestrconsts.lisoifaddtofavoriteproperties
msgid "Add to favorite properties"
msgstr "Добавить в избранные свойства"
#: lazarusidestrconsts.lisoifchooseabaseclassforthefavoriteproperty
#, object-pascal-format
msgid "Choose a base class for the favorite property \"%s\"."
msgstr "Выберите базовый класс для избранного свойства \"%s\"."
#: lazarusidestrconsts.lisoifclassnotfound
#, object-pascal-format
msgid "Class \"%s\" not found."
msgstr "Класс \"%s\" не найден."
#: lazarusidestrconsts.lisoifremovefromfavoriteproperties
msgid "Remove from favorite properties"
msgstr "Удалить из избранных свойств"
#: lazarusidestrconsts.lisoipautoinstalldynamic
msgid "auto install dynamic"
msgstr "автоустановить динамически"
#: lazarusidestrconsts.lisoipautoinstallstatic
msgid "auto install static"
msgstr "автоустановить статически"
#: lazarusidestrconsts.lisoipdescription
msgid "Description: "
msgstr "Описание: "
#: lazarusidestrconsts.lisoipdescriptiondescription
#, object-pascal-format
msgid "%sDescription: %s"
msgstr "%sОписание: %s"
#: lazarusidestrconsts.lisoipfilename
#, object-pascal-format
msgid "Filename: %s"
msgstr "Имя файла: %s"
#: lazarusidestrconsts.lisoipinstalleddynamic
msgid "installed dynamic"
msgstr "установлен динамически"
#: lazarusidestrconsts.lisoipinstalledstatic
msgid "installed static"
msgstr "установлен статически"
#: lazarusidestrconsts.lisoiplicenselicense
#, object-pascal-format
msgid "%sLicense: %s"
msgstr "%sЛицензия: %s"
#: lazarusidestrconsts.lisoipmissing
msgid "missing"
msgstr "отсутствует"
#: lazarusidestrconsts.lisoipmodified
msgid "modified"
msgstr "изменён"
#: lazarusidestrconsts.lisoipopenloadedpackage
msgid "Open Loaded Package"
msgstr "Открыть загруженный пакет"
#: lazarusidestrconsts.lisoippackagename
msgid "Package Name"
msgstr "Имя пакета"
#: lazarusidestrconsts.lisoippleaseselectapackage
msgid "Please select a package"
msgstr "Выберите пакет"
#: lazarusidestrconsts.lisoipreadonly
msgid "readonly"
msgstr "только чтение"
#: lazarusidestrconsts.lisoipstate
msgctxt "lazarusidestrconsts.lisoipstate"
msgid "State"
msgstr "Состояние"
#: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound
#, object-pascal-format
msgid "%sThis package is installed but the lpk file was not found"
msgstr "%sЭтот пакет установлен, но файл lpk не найден"
#: lazarusidestrconsts.lisoldclass
msgid "Old Class"
msgstr "Старый класс"
#: lazarusidestrconsts.lisonbreaklineiereturnorenterkey
msgid "On break line (i.e. return or enter key)"
msgstr "При разрыве строки (то есть при нажатии клавиши 'Ввод')"
#: lazarusidestrconsts.lisonlinepackage
msgid "available in the main repository"
msgstr "доступен в главном репозитории"
#: lazarusidestrconsts.lisonly32bit
msgid "only 32bit"
msgstr "только 32 бита"
#: lazarusidestrconsts.lisonlyavailableonwindowsrunthetoolhidden
msgid "Only available on Windows. Run the tool hidden."
msgstr "Доступно только в Windows. Запускать средство в скрытом режиме."
#: lazarusidestrconsts.lisonlyavailableonwindowsruntoolinanewconsole
msgid "Only available on Windows. Run tool in a new console."
msgstr "Доступно только в Windows. Запускать средство в новой консоли."
#: lazarusidestrconsts.lisonlymessagesfittingthisregularexpression
msgid "Only messages fitting this regular expression:"
msgstr "Только сообщения, отвечающие регулярному выражению:"
#: lazarusidestrconsts.lisonlymessageswiththesefpcidscommaseparated
msgid "Only messages with these FPC IDs (comma separated):"
msgstr "Только сообщения со следующими FPC ID (разделяются запятыми):"
#: lazarusidestrconsts.lisonlyregisterthelazaruspackagefileslpkdonotbuild
msgid "Only register the Lazarus package files (.lpk). Do not build."
msgstr "Только зарегистрировать файлы пакета Lazarus (.lpk), не собирать."
#: lazarusidestrconsts.lisonlysearchforwholewords
msgid "Only search for whole words"
msgstr "Поиск только целых слов"
#: lazarusidestrconsts.lisonpastefromclipboard
msgid "On paste from clipboard"
msgstr "При вставке из буфера обмена"
#: lazarusidestrconsts.lisopen
msgctxt "lazarusidestrconsts.lisopen"
msgid "Open"
msgstr "Открыть"
#: lazarusidestrconsts.lisopenasxmlfile
msgid "Open as XML file"
msgstr "Открыть как файл XML"
#: lazarusidestrconsts.lisopendesigneronopenunit
msgid "Open designer on open unit"
msgstr "Открывать редактор форм при открытии модуля"
#: lazarusidestrconsts.lisopendesigneronopenunithint
msgid "Form is loaded in designer always when source unit is opened."
msgstr "Форма всегда загружается при открытии её модуля"
#: lazarusidestrconsts.lisopenexistingfile
msgid "Open existing file"
msgstr "Открыть существующий файл"
#: lazarusidestrconsts.lisopenfile
msgctxt "lazarusidestrconsts.lisopenfile"
msgid "Open File"
msgstr "Открыть файл"
#: lazarusidestrconsts.lisopenfile2
msgctxt "lazarusidestrconsts.lisopenfile2"
msgid "Open file"
msgstr "Открыть файл"
#: lazarusidestrconsts.lisopenfileatcursor
msgid "Open file at cursor"
msgstr "Открытие файла у курсора"
#: lazarusidestrconsts.lisopeninfileman
msgid "Open in file manager"
msgstr "Открыть в диспетчере файлов"
#: lazarusidestrconsts.lisopeninfilemanhint
msgid "Open destination directory in file manager"
msgstr "Открыть каталог назначения в диспетчере файлов"
#: lazarusidestrconsts.lisopenlfm
#, object-pascal-format
msgid "Open %s"
msgstr "Открыть %s"
#: lazarusidestrconsts.lisopenpackage
msgid "Open Package?"
msgstr "Открыть пакет?"
#: lazarusidestrconsts.lisopenpackage2
#, object-pascal-format
msgid "Open package %s"
msgstr "Открыть пакет %s"
#: lazarusidestrconsts.lisopenpackage3
msgid "Open Package"
msgstr "Открыть пакет"
#: lazarusidestrconsts.lisopenpackagefile
msgid "Open Package File"
msgstr "Открыть файл пакета"
#: lazarusidestrconsts.lisopenproject
msgid "Open Project?"
msgstr "Открыть проект?"
#: lazarusidestrconsts.lisopenproject2
msgid "Open project"
msgstr "Открыть проект"
#: lazarusidestrconsts.lisopenprojectagain
msgid "Open project again"
msgstr "Открыть проект снова"
#: lazarusidestrconsts.lisopenprojectfile
msgid "Open Project File"
msgstr "Открыть проект"
#: lazarusidestrconsts.lisopenthefileasnormalsource
msgid "Open the file as normal source"
msgstr "Открыть файл как обычный исходный код"
#: lazarusidestrconsts.lisopenthepackage
#, object-pascal-format
msgid "Open the package %s?"
msgstr "Открыть пакет %s?"
#: lazarusidestrconsts.lisopentheproject
#, object-pascal-format
msgid "Open the project %s?"
msgstr "Открыть проект %s?"
#: lazarusidestrconsts.lisopentooloptions
msgid "Open Tool Options"
msgstr "Открыть диалог параметров"
#: lazarusidestrconsts.lisopenunit
msgid "Open Unit"
msgstr "Открыть модуль"
#: lazarusidestrconsts.lisopenurl
msgid "Open URL"
msgstr "Открыть страницу"
#: lazarusidestrconsts.lisopenxml
msgid "Open XML"
msgstr "Открыть XML"
#: lazarusidestrconsts.lisoptions
msgctxt "lazarusidestrconsts.lisoptions"
msgid "Options"
msgstr "Параметры"
#: lazarusidestrconsts.lisoptionvalueignored
msgid "ignored"
msgstr "игнорируется"
#: lazarusidestrconsts.lisos
#, object-pascal-format
msgid ", OS: %s"
msgstr ", ОС: %s"
#: lazarusidestrconsts.lisothersourcespathofpackagecontainsdirectorywhichisa
#, object-pascal-format
msgid "other sources path of package \"%s\" contains directory \"%s\" which is already in the unit search path."
msgstr "список путей к \"другим модулям\" пакета \"%s\" содержит каталог \"%s\", уже имеющийся в списке путей поиска модулей."
#: lazarusidestrconsts.lisoutputdirectoryofcontainspascalunitsource
#, object-pascal-format
msgid "output directory of %s contains Pascal unit source \"%s\""
msgstr "каталог вывода %s содержит исходный код модуля Паскаля \"%s\""
#: lazarusidestrconsts.lisoutputfilenameofproject
msgid "Output filename of project"
msgstr "Имя результирующего файла проекта"
#: lazarusidestrconsts.lisoverridelanguage
msgid "Override language. For possible values see files in the \"languages\" directory. Example: \"--language=de\"."
msgstr "Перекрыть язык. Возможные значения можно посмотреть в каталоге \"languages\". Пример: \"--language=de\"."
#: lazarusidestrconsts.lisoverridestringtypeswithfirstparamtype
msgid "Override function result string types with the first parameter expression type"
msgstr "Заменять строковый тип результата функции типом выражения первого параметра"
#: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd
msgid "Override the default compiler. For example: ppc386 ppcx64 ppcppc. Default value is stored in environmentoptions.xml."
msgstr "Перекрыть компилятор по умолчанию. Например: ppc386, ppcx64, ppcppc. Значение по умолчанию хранится в environmentoptions.xml."
#: lazarusidestrconsts.lisoverridetheprojectbuildmode
msgid "Override the project or IDE build mode."
msgstr "Перекрыть режим сборки проекта или IDE."
#: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64
#, object-pascal-format
msgid "Override the project CPU. For example: i386 x86_64 powerpc powerpc_64. Default: %s."
msgstr "Перекрыть целевое семейство процессоров проекта. Например: i386, x86_64, powerpc, powerpc_64. Значение по умолчанию: %s."
#: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau
#, object-pascal-format
msgid "Override the project operating system. For example: win32 linux. Default: %s."
msgstr "Перекрыть операционную систему проекта. Например: win32, linux. Значение по умолчанию: %s."
#: lazarusidestrconsts.lisoverridetheprojectsubtarg
msgid "Override the project subtarget."
msgstr "Перекрыть подцель проекта."
#: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond
#, object-pascal-format
msgid "Override the project widgetset. For example: gtk gtk2 qt win32 carbon. Default: %s."
msgstr "Перекрыть библиотеку виджетов проекта. Например: gtk, gtk2, qt, win32, carbon. Значение по умолчанию: %s."
#: lazarusidestrconsts.lisownerisalreadyusedbytreadertwriterpleasechooseanot
msgid "'Owner' is already used by TReader/TWriter. Please choose another name."
msgstr "'Owner' уже используется классами TReader/TWriter. Выберите другое имя."
#: lazarusidestrconsts.lispackage
msgid "Package"
msgstr "Пакет"
#: lazarusidestrconsts.lispackage2
#, object-pascal-format
msgid "package %s"
msgstr "пакет %s"
#: lazarusidestrconsts.lispackage3
#, object-pascal-format
msgid ", package %s"
msgstr ", пакет %s"
#: lazarusidestrconsts.lispackageinfo
msgid "Package info"
msgstr "Сведения о пакете"
#: lazarusidestrconsts.lispackageisdesigntimeonlysoitshouldonlybecompiledint
#, object-pascal-format
msgid "Package \"%s\" is designtime only, so it should only be compiled into the IDE, and not with the project settings.%sPlease use \"Install\" or \"Tools / Build Lazarus\" to build the IDE packages."
msgstr "Пакет времени разработки \"%s\" должен устанавливаться только в IDE, его не следует собирать с параметрами проекта.%sДля сборки таких пакетов их следует установить либо пересобрать Lazarus через меню Сервис."
#: lazarusidestrconsts.lispackagenamebeginswith
msgid "Package name begins with ..."
msgstr "Имя пакета начинается с ..."
#: lazarusidestrconsts.lispackagenamecontains
msgid "Package name contains ..."
msgstr "Имя пакета содержит ..."
#: lazarusidestrconsts.lispackageneedsanoutputdirectory
msgid "Package needs an output directory."
msgstr "Пакету требуется каталог вывода."
#: lazarusidestrconsts.lispackageneedsinstallation
msgid "Package needs installation"
msgstr "Пакет требует установки"
#: lazarusidestrconsts.lispackageoption
#, object-pascal-format
msgid "Package \"%s\" Option"
msgstr "Параметр пакета \"%s\""
#: lazarusidestrconsts.lispackageoutputdirectories
msgid "Package output directories"
msgstr "Каталоги вывода пакетов"
#: lazarusidestrconsts.lispackagesourcedirectories
msgid "Package source directories"
msgstr "Каталоги исходного кода пакетов"
#: lazarusidestrconsts.lispackagesunitsidentifierslinesbytes
#, object-pascal-format
msgid "packages=%s/%s units=%s/%s identifiers=%s/%s lines=%s bytes=%s"
msgstr "пакетов=%s/%s модулей=%s/%s идентификаторов=%s/%s строк=%s байт=%s"
#: lazarusidestrconsts.lispackageunit
msgid "package unit"
msgstr "модуль пакета"
#: lazarusidestrconsts.lispage
msgctxt "lazarusidestrconsts.lispage"
msgid "Page"
msgstr "Вкладка"
#: lazarusidestrconsts.lispagename
msgid "Page name"
msgstr "Имя вкладки"
#: lazarusidestrconsts.lispagenamealreadyexists
#, object-pascal-format
msgid "Page name \"%s\" already exists. Not added."
msgstr "Вкладка с именем \"%s\" уже имеется. Добавление отменено."
#: lazarusidestrconsts.lispanic
msgctxt "lazarusidestrconsts.lispanic"
msgid "Panic"
msgstr "Чрезвычайное"
#: lazarusidestrconsts.lisparsed
msgid ", parsed "
msgstr ", проанализировано "
#: lazarusidestrconsts.lisparser
#, object-pascal-format
msgid "parser \"%s\": %s"
msgstr "анализатор \"%s\": %s"
#: lazarusidestrconsts.lisparsers
msgid "Parsers:"
msgstr "Анализаторы:"
#: lazarusidestrconsts.lispassingquiettwotimeswillp
msgid "Passing --quiet two times will pass -vw-n-h-i-l-d-u-t-p-c-x- to the compiler."
msgstr "Дважды заданный --quiet повлечёт за собой передачу -vw-n-h-i-l-d-u-t-p-c-x- компилятору."
#: lazarusidestrconsts.lispasteclipboard
msgid "paste clipboard"
msgstr "Вставить из буфера обмена"
#: lazarusidestrconsts.lispastefromclipboard
msgctxt "lazarusidestrconsts.lispastefromclipboard"
msgid "Paste from clipboard."
msgstr "Вставить из буфера обмена."
#: lazarusidestrconsts.lispastelcolors
msgid "Pastel Colors"
msgstr "Пастельные цвета"
#: lazarusidestrconsts.lispath
msgid "Path"
msgstr "Путь"
#: lazarusidestrconsts.lispatheditbrowse
msgctxt "lazarusidestrconsts.lispatheditbrowse"
msgid "Browse"
msgstr "Обзор"
#: lazarusidestrconsts.lispatheditdeleteinvalidpaths
msgid "Delete Invalid Paths"
msgstr "Удалить неверные пути"
#: lazarusidestrconsts.lispatheditmovepathdown
msgid "Move path down (Ctrl+Down)"
msgstr "Переместить путь вниз (Ctrl+Down)"
#: lazarusidestrconsts.lispatheditmovepathup
msgid "Move path up (Ctrl+Up)"
msgstr "Переместить путь вверх (Ctrl+Up)"
#: lazarusidestrconsts.lispatheditoraddhint
msgid "Add new path to the list"
msgstr "Добавить новый путь в список"
#: lazarusidestrconsts.lispatheditordeletehint
msgid "Delete the selected path"
msgstr "Удалить выделенный путь"
#: lazarusidestrconsts.lispatheditordeleteinvalidhint
msgid "Remove non-existent (gray) paths from the list"
msgstr "Удалить несуществующие пути (серого цвета) из списка"
#: lazarusidestrconsts.lispatheditorreplacehint
msgid "Replace the selected path with a new path"
msgstr "Заменить выделенный путь новым"
#: lazarusidestrconsts.lispatheditortempladdhint
msgid "Add template to the list"
msgstr "Добавить шаблон в список"
#: lazarusidestrconsts.lispatheditpathtemplates
msgid "Path templates"
msgstr "Шаблоны пути"
#: lazarusidestrconsts.lispatheditsearchpaths
msgid "Search paths:"
msgstr "Пути поиска:"
#: lazarusidestrconsts.lispathisnodirectory
msgid "is not a directory"
msgstr "не является каталогом"
#: lazarusidestrconsts.lispathoftheinstantfpccache
msgid "path of the instantfpc cache"
msgstr "Путь к кэшу InstantFPC"
#: lazarusidestrconsts.lispathofthemakeutility
msgid "Path of the make utility"
msgstr "Путь к утилите Make"
#: lazarusidestrconsts.lispathtoinstance
msgid "Path to failed Instance:"
msgstr "Путь к необработанному экземпляру:"
#: lazarusidestrconsts.lispause
msgctxt "lazarusidestrconsts.lispause"
msgid "Pause"
msgstr "Приостановить"
#: lazarusidestrconsts.lispckcleartousethepackagename
msgid "Clear to use the package name"
msgstr "Очистите это поле для использования имени пакета"
#: lazarusidestrconsts.lispckdisablei18noflfm
msgid "Disable I18N of lfm"
msgstr "Отключить i18n для LFM"
#: lazarusidestrconsts.lispckeditaddfilesfromfilesystem
msgid "Add Files from File System"
msgstr "Добавить файлы с диска"
#: lazarusidestrconsts.lispckeditaddtoproject
msgctxt "lazarusidestrconsts.lispckeditaddtoproject"
msgid "Add to Project"
msgstr "Добавить к проекту"
#: lazarusidestrconsts.lispckeditapplychanges
msgid "Apply changes"
msgstr "Применить"
#: lazarusidestrconsts.lispckeditavailableonline
msgid "(available online)"
msgstr "(доступен в сети)"
#: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit
#, object-pascal-format
msgid "Call %sRegister%s procedure of selected unit"
msgstr "Вызвать процедуру %sRegister%s выбранного модуля"
#: lazarusidestrconsts.lispckeditcheckavailabilityonline
msgid "Check availability online"
msgstr "Проверить доступность в сети"
#: lazarusidestrconsts.lispckeditcleanupdependencies
msgid "Clean up dependencies ..."
msgstr "Очистить зависимости ..."
#: lazarusidestrconsts.lispckeditcleardefaultpreferredfilenameofdependency
msgid "Clear default/preferred filename of dependency"
msgstr "Очистить выбранное имя файла зависимости"
#: lazarusidestrconsts.lispckeditcommonoptions
msgid "Common"
msgstr "Общие"
#: lazarusidestrconsts.lispckeditcompileeverything
msgid "Compile everything?"
msgstr "Собрать всё?"
#: lazarusidestrconsts.lispckeditcompilepackage
msgid "Compile package"
msgstr "Собрать пакет"
#: lazarusidestrconsts.lispckeditcreatefpmakefile
msgid "Create fpmake.pp"
msgstr "Создать fpmake.pp"
#: lazarusidestrconsts.lispckeditcreatemakefile
msgctxt "lazarusidestrconsts.lispckeditcreatemakefile"
msgid "Create Makefile"
msgstr "Создать Makefile"
#: lazarusidestrconsts.lispckeditdependencyproperties
msgid "Dependency Properties"
msgstr "Свойства зависимости"
#: lazarusidestrconsts.lispckediteditgeneraloptions
msgid "Edit general options"
msgstr "Изменить общие параметры"
#: lazarusidestrconsts.lispckeditfileproperties
msgid "File Properties"
msgstr "Свойства файла"
#: lazarusidestrconsts.lispckeditinstall
msgid "Install"
msgstr "Установить"
#: lazarusidestrconsts.lispckeditinvalidmaximumversion
msgid "Invalid maximum version"
msgstr "Неверная максимальная версия"
#: lazarusidestrconsts.lispckeditinvalidminimumversion
msgid "Invalid minimum version"
msgstr "Неверная минимальная версия"
#: lazarusidestrconsts.lispckeditmaximumversion
msgid "Maximum Version:"
msgstr "Максимальная версия:"
#: lazarusidestrconsts.lispckeditminimumversion
msgid "Minimum Version:"
msgstr "Минимальная версия:"
#: lazarusidestrconsts.lispckeditmodified
#, object-pascal-format
msgid "Modified: %s"
msgstr "Изменён: %s"
#: lazarusidestrconsts.lispckeditmovedependencydown
msgid "Move dependency down"
msgstr "Переместить зависимость вниз"
#: lazarusidestrconsts.lispckeditmovedependencyup
msgid "Move dependency up"
msgstr "Переместить зависимость вверх"
#: lazarusidestrconsts.lispckeditoptionsforpackage
#, object-pascal-format
msgid "Options for Package %s"
msgstr "Параметры пакета %s"
#: lazarusidestrconsts.lispckeditpackage
#, object-pascal-format
msgid "Package %s"
msgstr "Пакет %s"
#: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage
#, object-pascal-format
msgid "Package \"%s\" has changed.%sSave package?"
msgstr "Пакет \"%s\" был изменён.%sСохранить его?"
#: lazarusidestrconsts.lispckeditpackagenotsaved
#, object-pascal-format
msgid "package %s not saved"
msgstr "пакет %s не сохранён"
#: lazarusidestrconsts.lispckeditpage
#, object-pascal-format
msgid "%s, Page: %s"
msgstr "%s, Вкладка: %s"
#: lazarusidestrconsts.lispckeditreadddependency
msgid "Re-Add dependency"
msgstr "Обновить зависимость"
#: lazarusidestrconsts.lispckeditreaddfile
msgid "Re-Add file"
msgstr "Обновить файл"
#: lazarusidestrconsts.lispckeditreadonly
#, object-pascal-format
msgid "Read Only: %s"
msgstr "Только чтение: %s"
#: lazarusidestrconsts.lispckeditrecompileallrequired
msgid "Recompile All Required"
msgstr "Пересобрать всё требуемое"
#: lazarusidestrconsts.lispckeditrecompileclean
msgid "Recompile Clean"
msgstr "Очистить и пересобрать"
#: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages
msgid "Re-Compile this and all required packages?"
msgstr "Перекомпилировать"
#: lazarusidestrconsts.lispckeditregisteredplugins
msgid "Registered plugins"
msgstr "Зарегистрированные дополнения"
#: lazarusidestrconsts.lispckeditregisterunit
msgid "Register unit"
msgstr "Зарегистрировать модуль"
#: lazarusidestrconsts.lispckeditremovedependency
msgid "Remove dependency"
msgstr "Удалить зависимость"
#: lazarusidestrconsts.lispckeditremovedependencyfrompackage
#, object-pascal-format
msgid "Remove dependency \"%s\"%sfrom package \"%s\"?"
msgstr "Удалить зависимость \"%s\"%sиз пакета \"%s\"?"
#: lazarusidestrconsts.lispckeditremovedfiles
msgid "Removed Files"
msgstr "Удалённые файлы"
#: lazarusidestrconsts.lispckeditremovedrequiredpackages
msgctxt "lazarusidestrconsts.lispckeditremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Удалённые требуемые пакеты"
#: lazarusidestrconsts.lispckeditremovefile
msgid "Remove file"
msgstr "Удалить файл"
#: lazarusidestrconsts.lispckeditremovefile2
msgid "Remove file?"
msgstr "Удалить файл?"
#: lazarusidestrconsts.lispckeditremovefilefrompackage
#, object-pascal-format
msgid "Remove file \"%s\"%sfrom package \"%s\"?"
msgstr "Удалить файл \"%s\"%sиз пакета \"%s\"?"
#: lazarusidestrconsts.lispckeditremoveselecteditem
msgid "Remove selected item"
msgstr "Удалить выбранный элемент"
#: lazarusidestrconsts.lispckeditrequiredpackages
msgid "Required Packages"
msgstr "Требуемые пакеты"
#: lazarusidestrconsts.lispckeditsavepackage
msgid "Save Package"
msgstr "Сохранить пакет"
#: lazarusidestrconsts.lispckeditstorefilenameasdefaultforthisdependency
msgid "Store file name as default for this dependency"
msgstr "Сохранить как имя файла по умолчанию для этой зависимости"
#: lazarusidestrconsts.lispckeditstorefilenameaspreferredforthisdependency
msgid "Store file name as preferred for this dependency"
msgstr "Сохранить как предпочтительное имя файла для этой зависимости"
#: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The maximum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Максимальная версия \"%s\" пакета некорректна.%s(корректный пример - 1.2.3.4)"
#: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion
#, object-pascal-format
msgid "The minimum version \"%s\" is not a valid package version.%s(good example 1.2.3.4)"
msgstr "Минимальная версия \"%s\" пакета некорректна.%s(корректный пример - 1.2.3.4)"
#: lazarusidestrconsts.lispckedituninstall
msgid "Uninstall"
msgstr "Удалить"
#: lazarusidestrconsts.lispckeditviewpackagesource
msgctxt "lazarusidestrconsts.lispckeditviewpackagesource"
msgid "View Package Source"
msgstr "Показать исходный код пакета"
#: lazarusidestrconsts.lispckexplbase
msgid "Base, cannot be uninstalled"
msgstr "базовый, не может быть удалён"
#: lazarusidestrconsts.lispckexplinstalled
msgctxt "lazarusidestrconsts.lispckexplinstalled"
msgid "Installed"
msgstr "Установлен"
#: lazarusidestrconsts.lispckexplinstallonnextstart
msgid "Install on next start"
msgstr "Будет установлен при следующем запуске"
#: lazarusidestrconsts.lispckexplstate
#, object-pascal-format
msgid "%sState: "
msgstr "%sСостояние: "
#: lazarusidestrconsts.lispckexpluninstallonnextstart
msgid "Uninstall on next start (unless needed by an installed package)"
msgstr "Будет удалён при следующем запуске (если не требуется другому пакету)"
#: lazarusidestrconsts.lispckexpluninstallpackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispckexpluninstallpackage"
msgid "Uninstall package %s"
msgstr "Удалить пакет %s"
#: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects
msgid "Add options to dependent packages and projects"
msgstr "Добавление параметров к зависимым пакетам и проектам"
#: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects
msgid "Add paths to dependent packages/projects"
msgstr "Добавление путей к зависимым пакетам и проектам"
#: lazarusidestrconsts.lispckoptsauthor
msgid "Author"
msgstr "Автор"
#: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded
msgid "Automatically rebuild as needed"
msgstr "Автоматически пересобирать по необходимости"
#: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall
msgid "Auto rebuild when rebuilding all"
msgstr "Автоматически пересобирать при пересборке всех"
#: lazarusidestrconsts.lispckoptscustom
msgid "Custom"
msgstr "Пользовательские"
#: lazarusidestrconsts.lispckoptsdescriptionabstract
msgid "Description / Abstract"
msgstr "Описание или аннотация"
#: lazarusidestrconsts.lispckoptsdesigntime
msgid "Designtime"
msgstr "Времени разработки"
#: lazarusidestrconsts.lispckoptsdesigntimeandruntime
msgid "Designtime and runtime"
msgstr "Времени разработки и исполнения"
#: lazarusidestrconsts.lispckoptsideintegration
msgid "IDE Integration"
msgstr "Встраивание в IDE"
#: lazarusidestrconsts.lispckoptsinclude
msgid "Include"
msgstr "Включаемый"
#: lazarusidestrconsts.lispckoptsinvalidpackagetype
msgid "Invalid package type"
msgstr "Неверный тип пакета"
#: lazarusidestrconsts.lispckoptslibrary
msgid "Library"
msgstr "Библиотека"
#: lazarusidestrconsts.lispckoptslicense
msgid "License"
msgstr "Лицензия"
#: lazarusidestrconsts.lispckoptslinker
msgid "Linker"
msgstr "Компоновщик"
#: lazarusidestrconsts.lispckoptsmajor
msgid "Major"
msgstr "Старшая"
#: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically
msgid "Manual compilation (never automatically)"
msgstr "Ручная компиляция (не автоматически)"
#: lazarusidestrconsts.lispckoptsminor
msgid "Minor"
msgstr "Младшая"
#: lazarusidestrconsts.lispckoptsobject
msgid "Object"
msgstr "Объект"
#: lazarusidestrconsts.lispckoptspackagetype
msgid "Package type"
msgstr "Тип пакета"
#: lazarusidestrconsts.lispckoptsprovides
msgid "Provides"
msgstr "Возможности"
#: lazarusidestrconsts.lispckoptsrelease
msgid "Release"
msgstr "Релиз"
#: lazarusidestrconsts.lispckoptsruntime
msgid "Runtime"
msgstr "Времени исполнения"
#: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans
#, object-pascal-format
msgid "The package \"%s\" has the auto install flag.%sThis means it will be installed in the IDE.%sInstallation packages must be designtime Packages."
msgstr "Пакет \"%s\" имеет флаг автоматической установки.%sЭто значит, что он будет установлен в IDE.%sУстанавливаемые пакеты должны являться пакетами времени разработки."
#: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages
msgid "This package provides the same as the following packages:"
msgstr "Этот пакет предоставляет те же возможности, что и следующие пакеты"
#: lazarusidestrconsts.lispckoptsupdaterebuild
msgid "Update / Rebuild"
msgstr "Обновление и пересборка"
#: lazarusidestrconsts.lispckoptsusage
msgid "Usage"
msgstr "Использование"
#: lazarusidestrconsts.lispckpackage
msgid "Package:"
msgstr "Пакет:"
#: lazarusidestrconsts.lispcksearchpathsforfpdocxmlfilesmultiplepathsmustbesepa
msgid "Search paths for fpdoc xml files. Multiple paths must be separated by semicolon."
msgstr "Пути поиска файлов XML FPDoc. Несколько путей разделяются точкой с запятой."
#: lazarusidestrconsts.lispckshowunneededdependencies
msgid "Show unneeded dependencies"
msgstr "Показать нетребуемые зависимости"
#: lazarusidestrconsts.lispckwhentheformissavedtheidecanstoreallttranslatestring
msgid "When the form is saved, the IDE can store all TTranslateString properties to the package po file. For this you must enable I18N for this package, provide a po output directory and leave this option unchecked."
msgstr "При сохранении формы IDE может помещать значения всех свойств типа TTranslateString в файл PO пакета. Для этого следует включить i18n для этого пакета, указать каталог вывода файлов PO и отключить данный параметр."
#: lazarusidestrconsts.lispdabort
msgctxt "lazarusidestrconsts.lispdabort"
msgid "Abort"
msgstr "Прервать"
#: lazarusidestrconsts.lispdprogress
msgid "Progress"
msgstr "Ход операции"
#: lazarusidestrconsts.lispecollapsedirectory
msgid "Collapse directory"
msgstr "Свернуть каталог"
#: lazarusidestrconsts.lispeconflictfound
msgid "Conflict found"
msgstr "Найден конфликт"
#: lazarusidestrconsts.lispeeditvirtualunit
msgid "Edit Virtual Unit"
msgstr "Редактировать виртуальный модуль"
#: lazarusidestrconsts.lispeexpanddirectory
msgid "Expand directory"
msgstr "Развернуть каталог"
#: lazarusidestrconsts.lispefilename
msgid "Filename:"
msgstr "Имя файла:"
#: lazarusidestrconsts.lispefixfilescase
msgid "Fix Files Case"
msgstr "Исправить регистр файлов"
#: lazarusidestrconsts.lispeinvalidunitfilename
msgid "Invalid unit filename"
msgstr "Неверное имя файла модуля"
#: lazarusidestrconsts.lispeinvalidunitname
msgid "Invalid unitname"
msgstr "Неверное имя модуля"
#: lazarusidestrconsts.lispemissingfilesofpackage
#, object-pascal-format
msgid "Missing files of package %s"
msgstr "Отсутствующие файлы пакета %s"
#: lazarusidestrconsts.lispenewfilenotinincludepath
msgid "New file not in include path"
msgstr "Путь к новому файлу отсутствует в списке путей к включаемым файлам"
#: lazarusidestrconsts.lispenofilesmissingallfilesexist
msgctxt "lazarusidestrconsts.lispenofilesmissingallfilesexist"
msgid "No files missing. All files exist."
msgstr "Все файлы имеются в наличии."
#: lazarusidestrconsts.lisperemovefiles
msgid "Remove files"
msgstr "Удалить файлы"
#: lazarusidestrconsts.lisperevertpackage
msgid "Revert Package"
msgstr "Возвратить пакет"
#: lazarusidestrconsts.lispesavepackageas
msgid "Save Package As ..."
msgstr "Сохранить пакет как ..."
#: lazarusidestrconsts.lispeshowdirectoryhierarchy
msgid "Show directory hierarchy"
msgstr "Показывать иерархию каталогов"
#: lazarusidestrconsts.lispeshowmissingfiles
msgid "Show Missing Files"
msgstr "Показать отсутствующие файлы"
#: lazarusidestrconsts.lispesortfiles
msgid "Sort Files Permanently"
msgstr "Сортировать файлы (без возможности отмены)"
#: lazarusidestrconsts.lispesortfilesalphabetically
msgid "Sort files alphabetically"
msgstr "Сортировать файлы в алфавитном порядке"
#: lazarusidestrconsts.lispethefileiscurrentlynotintheincludepathofthepackagea
#, object-pascal-format
msgid "The file \"%s\" is currently not in the include path of the package.%sAdd \"%s\" to the include path?"
msgstr "Файл \"%s\" отсутствует в списке путей к включаемым файлам пакета.%sДобавить \"%s\" в список путей к включаемым файлам?"
#: lazarusidestrconsts.lispeunitname
msgid "Unitname:"
msgstr "Имя модуля:"
#: lazarusidestrconsts.lispeuseallunitsindirectory
msgid "Use all units in directory"
msgstr "Использовать все модули в каталоге"
#: lazarusidestrconsts.lispeusenounitsindirectory
msgid "Use no units in directory"
msgstr "Не использовать модули из каталога"
#: lazarusidestrconsts.lispkgcleanuppackagedependencies
msgid "Clean up package dependencies"
msgstr "Очистка зависимостей пакетов"
#: lazarusidestrconsts.lispkgclearselection
msgid "Clear Selection"
msgstr "Снять выделение"
#: lazarusidestrconsts.lispkgdeletedependencies
msgid "Delete dependencies"
msgstr "Удалить зависимости"
#: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand
#, object-pascal-format
msgid "Do you really want to forget all changes to package %s and reload it from file?"
msgstr "Вы действительно хотите сбросить все изменения в пакете %s и загрузить его из файла?"
#: lazarusidestrconsts.lispkgeditnewunitnotinunitpath
msgid "New unit not in unitpath"
msgstr "Новый модуль не в пути поиска"
#: lazarusidestrconsts.lispkgeditpublishpackage
msgid "Publish Package"
msgstr "Опубликовать пакет"
#: lazarusidestrconsts.lispkgeditrevertpackage
msgid "Revert package?"
msgstr "Возвратить пакет?"
#: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage
#, object-pascal-format
msgid "The file \"%s\"%sis currently not in the unit path of the package.%sAdd \"%s\" to unit path?"
msgstr "Файл \"%s\"%sсейчас не находится в списке путей к модулям пакета.%sДобавить \"%s\" к списку путей к модулям?"
#: lazarusidestrconsts.lispkgedmorefunctionsforthepackage
msgid "More functions for the package"
msgstr "Прочие возможности управления пакетом"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage
#, object-pascal-format
msgid "%sAdding new Dependency for package %s: package %s"
msgstr "%sДобавление новой зависимости пакета %s: пакет %s"
#: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage
#, object-pascal-format
msgid "%sAdding new Dependency for project %s: package %s"
msgstr "%sДобавление новой зависимости проекта %s: пакет %s"
#: lazarusidestrconsts.lispkgmangaddunittousesclause
msgid "Add unit to uses clause of package main file. Disable this only for units that should not be compiled in all cases."
msgstr "Добавить модуль в выражение Uses главного файла пакета. Отключайте это только для модулей, которые не должны компилироваться во всех случаях."
#: lazarusidestrconsts.lispkgmangambiguousunitsfound
msgid "Ambiguous units found"
msgstr "Найдены модули с с дублирующимися именами"
#: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages
msgid "Automatically installed packages"
msgstr "Автоустановленные пакеты"
#: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu
#, object-pascal-format
msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package."
msgstr "%sОба пакета связаны. Это значит, что либо один из них использует другой, либо оба они используются третьим пакетом."
#: lazarusidestrconsts.lispkgmangbrokendependency
msgid "Broken dependency"
msgstr "Нарушенная зависимость"
#: lazarusidestrconsts.lispkgmangcirculardependencies
msgid "Circular dependencies found"
msgstr "Обнаружен порочный круг зависимостей"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile
msgid "Delete Old Package File?"
msgstr "Удалить старый файл пакета?"
#: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2
#, object-pascal-format
msgid "Delete old package file \"%s\"?"
msgstr "Удалить старый файл пакета \"%s\"?"
#: lazarusidestrconsts.lispkgmangdependencywithoutowner
#, object-pascal-format
msgid "Dependency without Owner: %s"
msgstr "Зависимость без владельца:%s"
#: lazarusidestrconsts.lispkgmangerrorreadingpackage
msgid "Error Reading Package"
msgstr "Ошибка чтения пакета"
#: lazarusidestrconsts.lispkgmangerrorwritingpackage
msgid "Error Writing Package"
msgstr "Ошибка записи пакета"
#: lazarusidestrconsts.lispkgmangfileisalreadyinpackage
msgid "File is already in package"
msgstr "Файл уже есть в пакете"
#: lazarusidestrconsts.lispkgmangfileisinproject
msgid "File is in Project"
msgstr "Файл в проекте"
#: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename
msgid "Filename differs from Packagename"
msgstr "Имя файла отличается от имени пакета"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage
msgid "Filename is used by other package"
msgstr "Имя файла использовано другим пакетом"
#: lazarusidestrconsts.lispkgmangfilenameisusedbyproject
msgid "Filename is used by project"
msgstr "Имя файла использовано проектом"
#: lazarusidestrconsts.lispkgmangfilenotfound
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangfilenotfound"
msgid "File \"%s\" not found."
msgstr "Файл \"%s\" не найден."
#: lazarusidestrconsts.lispkgmangfilenotsaved
msgid "File not saved"
msgstr "Файл не сохранён"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac
#, object-pascal-format
msgid "Installing the package %s will automatically install the package:"
msgstr "При установке пакета %s автоматически установится пакет:"
#: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2
#, object-pascal-format
msgid "Installing the package %s will automatically install the packages:"
msgstr "При установке пакета %s автоматически установятся эти пакеты:"
#: lazarusidestrconsts.lispkgmanginvalidfileextension
msgid "Invalid file extension"
msgstr "Неверное расширение файла"
#: lazarusidestrconsts.lispkgmanginvalidpackagefileextension
msgid "Invalid package file extension"
msgstr "Неверное расширение файла пакета"
#: lazarusidestrconsts.lispkgmanginvalidpackagefilename
msgid "Invalid package filename"
msgstr "Неверное имя файла пакета"
#: lazarusidestrconsts.lispkgmanginvalidpackagename
msgid "Invalid package name"
msgstr "Неверное имя пакета"
#: lazarusidestrconsts.lispkgmanginvalidpackagename2
msgid "Invalid Package Name"
msgstr "Неверное имя пакета"
#: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage
#, object-pascal-format
msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%sSave old package %s?"
msgstr "Загрузка пакета %s заменит пакет %s%sиз файла %s.%sСтарый пакет был изменён.%sСохранить старый пакет %s?"
#: lazarusidestrconsts.lispkgmangpackage
#, object-pascal-format
msgid "Package: %s"
msgstr "Пакет: %s"
#: lazarusidestrconsts.lispkgmangpackageconflicts
msgid "Package conflicts"
msgstr "Конфликты пакетов"
#: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage
msgid "Package is not a designtime package"
msgstr "Пакет не является пакетом времени разработки"
#: lazarusidestrconsts.lispkgmangpackageisrequired
msgid "Package is required"
msgstr "Требуется пакет"
#: lazarusidestrconsts.lispkgmangpackagenamealreadyexists
msgid "Package name already exists"
msgstr "Имя пакета уже занято"
#: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk
msgid "Packages must have the extension .lpk"
msgstr "Пакеты должны иметь расширение .lpk"
#: lazarusidestrconsts.lispkgmangpleasecompilethepackagefirst
msgid "Please compile the package first."
msgstr "Сначала откомпилируйте пакет."
#: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage
msgid "Please save the file before adding it to a package."
msgstr "Сохраните файл перед добавлением в пакет."
#: lazarusidestrconsts.lispkgmangproject
#, object-pascal-format
msgid "Project: %s"
msgstr "Проект: %s"
#: lazarusidestrconsts.lispkgmangrebuildlazarus
msgid "Rebuild Lazarus?"
msgstr "Пересобрать Lazarus?"
#: lazarusidestrconsts.lispkgmangrenamefilelowercase
msgid "Rename File lowercase?"
msgstr "Переименовать файл в нижний регистр?"
#: lazarusidestrconsts.lispkgmangreplaceexistingfile
#, object-pascal-format
msgid "Replace existing file \"%s\"?"
msgstr "Заменить существующий файл \"%s\"?"
#: lazarusidestrconsts.lispkgmangreplacefile
msgid "Replace File"
msgstr "Заменить файл"
#: lazarusidestrconsts.lispkgmangrequiredpackageswerenotfound
msgid "One or more required packages were not found. See package graph for details."
msgstr "Некоторых требуемых пакетов не найдено. Для получения подробностей смотрите диаграмму пакетов."
#: lazarusidestrconsts.lispkgmangsaveasalreadyopenedpackage
#, object-pascal-format
msgid ""
"The package %s is already open in the IDE.\n"
"You cannot save a package with the same name."
msgstr ""
"Пакет %s уже открыт в IDE.\n"
"Невозможно сохранить пакет с таким же именем."
#: lazarusidestrconsts.lispkgmangsavepackage
msgid "Save package?"
msgstr "Сохранить пакет?"
#: lazarusidestrconsts.lispkgmangsavepackagelpk
#, object-pascal-format
msgid "Save Package %s (*.lpk)"
msgstr "Сохранить пакет %s (*.lpk)"
#: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto
#, object-pascal-format
msgid "Should the file be renamed lowercase to%s\"%s\"?"
msgstr "Переименовать файл в нижний регистр%s(в \"%s\")?"
#: lazarusidestrconsts.lispkgmangskipthispackage
msgid "Skip this package"
msgstr "Пропустить это сообщение"
#: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage"
msgid "The file \"%s\"%sis already in the package %s."
msgstr "Файл \"%s\"%sуже имеется в пакете %s."
#: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus package."
msgstr "Файл \"%s\" не является пакетом Lazarus."
#: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage
#, object-pascal-format
msgid "The filename \"%s\" does not correspond to the package name \"%s\" in the file.%sChange package name to \"%s\"?"
msgstr "Имя файла \"%s\" не соответствует имени пакета \"%s\" в файле.%sСменить имя пакета на \"%s\"?"
#: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject
#, object-pascal-format
msgid "The file name \"%s\" is part of the current project.%sProjects and Packages should not share files."
msgstr "Файл с именем \"%s\" имеется в текущем проекте.%sПроекты и пакеты не должны иметь общих файлов."
#: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile
#, object-pascal-format
msgid "The file name \"%s\" is used by%sthe package \"%s\"%sin file \"%s\"."
msgstr "Имя файла \"%s\" упоминается%sв пакете \"%s\"%s(в файле \"%s\")."
#: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload
msgid "The following package failed to load:"
msgstr "Следующий пакет не был загружен:"
#: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload
msgid "The following packages failed to load:"
msgstr "Следующие пакеты не были загружены:"
#: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof
#, object-pascal-format
msgid "%sThe following units will be added to the uses section of%s%s:%s%s"
msgstr "%sСледующие модули будут добавлены в выражение Uses%s%s:%s%s"
#: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename
#, object-pascal-format
msgid "The package file name \"%s\" in%s\"%s\" is not a valid Lazarus package name."
msgstr "Имя файла пакета \"%s\" в%s\"%s\" не является корректным именем пакета Lazarus."
#: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages
#, object-pascal-format
msgid "The package %s is a runtime only package.%sRuntime only packages cannot be installed in the IDE."
msgstr "Пакет %s является пакетом времени исполнения.%sТакие пакеты не могут встраиваться в IDE."
#: lazarusidestrconsts.lispkgmangthepackageiscompiledautomaticallyanditsoutputdirec
#, object-pascal-format
msgid "The package \"%s\" is compiled automatically and its output directory is \"%s\" which is in the default unit search path of the compiler. The package uses other packages which also use the default unit search of the compiler. This creates an endless loop.%sYou can fix this issue by removing the path from your compiler config (e.g. fpc.cfg)%sor by disabling the auto update of this package or by removing dependencies."
msgstr "Пакет \"%s\" откомпилирован автоматически, и его каталогом вывода является \"%s\", присутствующий в списке путей поиска модулей по умолчанию компилятора. Пакет использует другие пакеты, которые также используют поиск модулей по умолчанию компилятором. Это порождает порочный круг.%sВы можете исправить ситуацию путём удаления пути из файла настройки компилятора (например, fpc.cfg),%sлибо отключения автоматического обновления данного пакета, либо удаления зависимостей."
#: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound
#, object-pascal-format
msgid "The package \"%s\" is marked for installation but cannot be found.%sRemove dependency from the installation list of packages?"
msgstr "Пакет \"%s\" отмечен на установку, но не найден.%sУдалить зависимость из списка установки пакетов?"
#: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation
#, object-pascal-format
msgid "The package %s is required by %s which is marked for installation.%sSee package graph."
msgstr "Пакет %s требуется для %s, который помечен на установку.%sСмотрите диаграмму пакетов."
#: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean
#, object-pascal-format
msgid "The package name \"%s\" is not a valid package name%sPlease choose another name (e.g. package1.lpk)"
msgstr "Имя пакета \"%s\" некорректно.%sВыберите другой пакет (например, package1.lpk)."
#: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid
#, object-pascal-format
msgid "The package name \"%s\" of%sthe file \"%s\" is invalid."
msgstr "Имя пакета \"%s\"%sфайла \"%s\" некорректно."
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked.%sCurrently Lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Был отмечен пакет \"%s\".%sСейчас Lazarus поддерживает только статически скомпонованные пакеты. Действительное удаление требует пересборки и перезапуска Lazarus.%sВы хотите пересобрать Lazarus сейчас?"
#: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus
#, object-pascal-format
msgid "The package \"%s\" was marked for installation.%sCurrently Lazarus only supports static linked packages. The real installation needs rebuilding and restarting of Lazarus.%sDo you want to rebuild Lazarus now?"
msgstr "Пакет \"%s\" был отмечен для установки.%sСейчас Lazarus поддерживает только статически скомпонованные пакеты. Действительная установка требует пересборки и перезапуска Lazarus.%sВы хотите пересобрать Lazarus сейчас?"
#: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound
#, object-pascal-format
msgid "The project requires the package \"%s\".%sBut it was not found. See Project -> Project Inspector."
msgstr "Проект требует пакет \"%s\".%sОн не найден. Смотрите Проект -> Инспектор проекта."
#: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from
#, object-pascal-format
msgid "There are two units with the same name:%s1. \"%s\" from %s%s2. \"%s\" from %s"
msgstr "Имеется два модуля с одинаковыми именами:%s1. \"%s\" из %s%s2. \"%s\" из %s"
#: lazarusidestrconsts.lispkgmangthereisacirculardependency
msgid "There is a circular dependency in the packages. See package graph."
msgstr "В зависимостях пакетов имеется порочный круг. Смотрите диаграмму пакетов."
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage
#, object-pascal-format
msgid "There is a FPC unit with the same name as a package:%s\"%s\""
msgstr "Имеется модуль FPC с таким же именем, как и пакет:%s\"%s\""
#: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom
#, object-pascal-format
msgid "There is a FPC unit with the same name as:%s\"%s\" from %s"
msgstr "Имеется модуль FPC с таким же именем, как:%s\"%s\" из %s"
#: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename
#, object-pascal-format
msgid "There is already another package with the name \"%s\".%sConflict package: \"%s\"%sFile: \"%s\""
msgstr "Уже имеется другой пакет с именем \"%s\".%sКонфликтующий пакет: \"%s\"%sФайл: \"%s\""
#: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile
#, object-pascal-format
msgid "There is already a package \"%s\" loaded%sfrom file \"%s\".%sSee Package -> Package Graph.%sReplace is impossible."
msgstr "Загруженный пакет \"%s\"%sиз файла \"%s\" уже имеется.%sСмотрите Пакет -> Диаграмма пакетов.%sЗамена невозможна."
#: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages
msgid "There is an unsaved package in the required packages. See package graph."
msgstr "Среди требуемых пакетов есть несохранённый. Смотрите диаграмму пакетов."
#: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2
#, object-pascal-format
msgid "There is a unit with the same name as a package:%s1. \"%s\" from %s%s2. \"%s\""
msgstr "Имеется модуль с тем же именем, что и пакет:%s1. \"%s\" из %s%s2. \"%s\""
#: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe
msgid "This is a virtual package. It has no source yet. Please save the package first."
msgstr "Это виртуальный пакет. Он ещё не имеет исходного кода. Сначала сохраните пакет."
#: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus
#, object-pascal-format
msgid "Unable to create target directory for Lazarus:%s\"%s\".%sThis directory is needed for the new changed Lazarus IDE with your custom packages."
msgstr "Невозможно создать целевой каталог для Lazarus:%s\"%s\".%sЭтот каталог нужен для вновь изменённой IDE Lazarus с вашими пакетами."
#: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror
#, object-pascal-format
msgid "Unable to write package \"%s\"%sto file \"%s\".%sError: %s"
msgstr "Невозможно записать пакет \"%s\"%sв файл \"%s\".%sОшибка: %s"
#: lazarusidestrconsts.lispkgmanguninstallpackage
msgid "Uninstall package?"
msgstr "Удалить пакет?"
#: lazarusidestrconsts.lispkgmanguninstallpackage2
#, object-pascal-format
msgid "Uninstall package %s?"
msgstr "Удалить пакет %s?"
#: lazarusidestrconsts.lispkgmangunsavedpackage
msgid "Unsaved package"
msgstr "Несохранённый пакет"
#: lazarusidestrconsts.lispkgmanguseunit
msgid "Use unit"
msgstr "Использовать модуль"
#: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject
#, object-pascal-format
msgid "Warning: The file \"%s\"%sbelongs to the current project."
msgstr "Внимание: Файл \"%s\"%sпринадлежит текущему проекту."
#: lazarusidestrconsts.lispkgmgrkeep
msgctxt "lazarusidestrconsts.lispkgmgrkeep"
msgid "keep"
msgstr "оставить"
#: lazarusidestrconsts.lispkgmgrnew
msgctxt "lazarusidestrconsts.lispkgmgrnew"
msgid "new"
msgstr "новый"
#: lazarusidestrconsts.lispkgmgrremove
msgctxt "lazarusidestrconsts.lispkgmgrremove"
msgid "remove"
msgstr "удалить"
#: lazarusidestrconsts.lispkgselectapackage
msgid "Select a package"
msgstr "Выбор пакета"
#: lazarusidestrconsts.lispkgthefollowingdependenciesarenotneededbecauseoftheau
msgid "The following dependencies are not needed because of the automatic transitivity between package dependencies."
msgstr "Следующие зависимости не требуются, так как они уже автоматически унаследованы."
#: lazarusidestrconsts.lispkgtheprojectoverridestheoutputdirectoryofthefollowin
#, object-pascal-format
msgid "The project overrides the output directory of the following packages.%sSee Project / Project Options (compiler options section) / Additions and Overrides%s%s"
msgstr "Проект перекрывает каталоги вывода следующих пакетов.%sСмотрите Проект -> Параметры проекта (раздел параметров компилятора) -> Дополнения и перекрытия%s%s"
#: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage
msgid "This file is not in any loaded package."
msgstr "Этот файл отсутствует во всех загруженных пакетах."
#: lazarusidestrconsts.lispkgunabletoreadpackagefileerror
#, object-pascal-format
msgid "Unable to read package file \"%s\".%sError: %s"
msgstr "Невозможно прочитать файл пакета \"%s\".%sОшибка: %s"
#: lazarusidestrconsts.lisplay
msgid "Play"
msgstr "Воспроизвести"
#: lazarusidestrconsts.lispldglobal
msgctxt "lazarusidestrconsts.lispldglobal"
msgid "Global"
msgstr "Глобальные"
#: lazarusidestrconsts.lispldonline
msgid "Online"
msgstr "Сетевые"
#: lazarusidestrconsts.lispldonlinepackagescannotbedeleted
msgid "Online packages cannot be deleted"
msgstr "Пакеты из сети не могут быть удалены"
#: lazarusidestrconsts.lispldpackagelinks
msgid "Package Links"
msgstr "Ссылки на пакеты"
#: lazarusidestrconsts.lispldshowgloballinksin
msgid "Show global links in "
msgstr "Показывать глобальные ссылки в "
#: lazarusidestrconsts.lispldshowonlinelinks
msgid "Show online links"
msgstr "Показывать сетевые ссылки"
#: lazarusidestrconsts.lispldshowuserlinksin
msgid "Show user links in "
msgstr "Показывать пользовательские ссылки в "
#: lazarusidestrconsts.lispldsomepackagescannotbedeleted
msgid "Some packages cannot be deleted"
msgstr "Некоторые пакеты не могут быть удалены"
#: lazarusidestrconsts.lisplduser
msgid "User"
msgstr "Пользовательские"
#: lazarusidestrconsts.lispleasefixtheerrorinthemessagewindow
msgid "Please fix the error shown in the message window which is normally below the source editor."
msgstr "Исправьте ошибку, указанную в окне сообщений, которое обычно находится под редактором исходного кода."
#: lazarusidestrconsts.lispleaseopenaunitbeforerun
msgid "Please open a unit before run."
msgstr "Откройте модуль перед запуском."
#: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod
msgid "Please select some code to extract a new procedure/method."
msgstr "Выделите некоторый код, чтобы извлечь новую процедуру/метод."
#: lazarusidestrconsts.lisplistall
msgctxt "lazarusidestrconsts.lisplistall"
msgid "<All>"
msgstr "<Все>"
#: lazarusidestrconsts.lisplistchangefont
msgid "Change Font"
msgstr "Сменить шрифт"
#: lazarusidestrconsts.lisplistcopymethodtoclipboard
msgid "Copy method name to the clipboard"
msgstr "Копировать имя метода в буфер обмена"
#: lazarusidestrconsts.lisplistfilterany
msgid "Filter by matching any part of method"
msgstr "Фильтровать по любой части метода"
#: lazarusidestrconsts.lisplistfilterstart
msgid "Filter by matching with start of method"
msgstr "Фильтровать по началу метода"
#: lazarusidestrconsts.lisplistjumptoselection
msgid "Jump To Selection"
msgstr "Перейти к выбранному"
#: lazarusidestrconsts.lisplistnone
msgid "<None>"
msgstr "<Нет>"
#: lazarusidestrconsts.lisplistobjects
msgid "&Objects"
msgstr "&Объекты"
#: lazarusidestrconsts.lisplistprocedurelist
msgid "Procedure List"
msgstr "Список процедур"
#: lazarusidestrconsts.lisplisttype
msgctxt "lazarusidestrconsts.lisplisttype"
msgid "Type"
msgstr "Тип"
#: lazarusidestrconsts.lispochoosepofiledirectory
msgid "Choose .po file directory"
msgstr "Выберите каталог для файлов .po"
#: lazarusidestrconsts.lispodonotsaveanysessioninfo
msgid "Do not save any session info"
msgstr "Не сохранять сведения о сеансе работы"
#: lazarusidestrconsts.lisposaveinideconfigdirectory
msgid "Save in .lps file in IDE config directory"
msgstr "Сохранять в файле .lps в каталоге настройки IDE"
#: lazarusidestrconsts.lisposaveinlpifil
msgid "Save in .lpi file"
msgstr "Сохранять в файле .lpi"
#: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory
msgid "Save in .lps file in project directory"
msgstr "Сохранять в файле .lps в каталоге проекта"
#: lazarusidestrconsts.lisposavesessioninformationin
msgid "Save session information in"
msgstr "Сохранять сведения о сеансе работы в"
#: lazarusidestrconsts.lisposavesessioninformationinhint
msgid ".lpi is the project main info file, .lps is a separate file for session data only."
msgstr "Файл .lpi является главным хранилищем сведений о проекте, в то время как .lps содержит только сведения о сеансе работы"
#: lazarusidestrconsts.lisposition
msgid "Position"
msgstr "Положение"
#: lazarusidestrconsts.lispositionoutsideofsource
#, object-pascal-format
msgid "%s (position outside of source)"
msgstr "%s (положение вне границ исходного кода)"
#: lazarusidestrconsts.lisppuinwrongdirectory
#, object-pascal-format
msgid "ppu in wrong directory=%s."
msgstr "PPU в неверном каталоге=%s."
#: lazarusidestrconsts.lisppunotfoundcheckyourfpccfg
#, object-pascal-format
msgid "%s.ppu not found. Check your fpc.cfg."
msgstr "%s.ppu не найден. Проверьте файл fpc.cfg."
#: lazarusidestrconsts.lisprecedingword
msgid "Preceding word"
msgstr "Предыдущее слово"
#: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig
#, object-pascal-format
msgid "Primary config directory where Lazarus stores its config files. Default is \"%s\"."
msgstr "Первичный каталог настройки, где Lazarus хранит свои файлы настройки. По умолчанию - \"%s\"."
#: lazarusidestrconsts.lisprimaryconfigpath
msgid "Primary config path"
msgstr "Путь к первичному каталогу настройки"
#: lazarusidestrconsts.lisprior
#, object-pascal-format
msgid "prior %s"
msgstr "до %s"
#: lazarusidestrconsts.lispriority
msgctxt "lazarusidestrconsts.lispriority"
msgid "Priority"
msgstr "Приоритет"
#: lazarusidestrconsts.lisprivate
msgid "Private"
msgstr "Private"
#: lazarusidestrconsts.lisprivatemethod
msgid "Private Method"
msgstr "Скрытый метод"
#: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti
#, object-pascal-format
msgid "Probably you need to install some packages before continuing.%sWarning:%sThe project uses the following design time packages which might be needed to open the form in the designer. If you continue, you might get errors about missing components and the form loading will probably create very unpleasant results.%sIt is recommended to cancel and install these packages first."
msgstr "Вероятно, вам следует установить некоторые пакеты перед продолжением.%sВнимание:%sПроект зависит от пакетов времени разработки, которые могут понадобиться для открытия форм в редакторе. При продолжении вы можете получить ошибки об отсутствующих компонентах, и загрузка формы, возможно, приведёт к очень неприятным результатам.%sРекомендуется прервать процесс и установить сначала эти пакеты."
#: lazarusidestrconsts.lisprocedure
msgctxt "lazarusidestrconsts.lisprocedure"
msgid "Procedure"
msgstr "Процедура"
#: lazarusidestrconsts.lisprocedurewithinterface
msgid "Procedure with interface"
msgstr "Процедура с интерфейсом"
#: lazarusidestrconsts.lisprogram
msgctxt "lazarusidestrconsts.lisprogram"
msgid "Program"
msgstr "Программа"
#: lazarusidestrconsts.lisprogramdetected
msgid "Program detected"
msgstr "Обнаружена программа"
#: lazarusidestrconsts.lisprogramprogramdescriptor
msgid "A Free Pascal command line program with some useful settings added."
msgstr "Консольная программа на Free Pascal со включёнными дополнительными возможностями."
#: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp
msgid "Program source must have a Pascal extension like .pas, .pp or .lpr"
msgstr "Исходный код программы должен иметь расширение Паскаля, например, .pas, .pp или .lpr"
#: lazarusidestrconsts.lisprojadddependencyalreadyexists
msgid "Dependency already exists"
msgstr "Зависимость уже есть"
#: lazarusidestrconsts.lisprojaddeditorfile
msgid "Add Editor Files"
msgstr "Добавить файлы редактора"
#: lazarusidestrconsts.lisprojaddinvalidminmaxversion
msgid "Invalid Min-Max version"
msgstr "Неверные версии (минимальная/максимальная)"
#: lazarusidestrconsts.lisprojaddinvalidversion
msgid "Invalid version"
msgstr "Неверная версия"
#: lazarusidestrconsts.lisprojaddlocalpkg
#, object-pascal-format
msgid "Local (%s)"
msgstr "Локальный (%s)"
#: lazarusidestrconsts.lisprojaddmaximumversionoptional
msgid "Maximum Version (optional):"
msgstr "Максимальная версия (необязательна):"
#: lazarusidestrconsts.lisprojaddminimumversionoptional
msgid "Minimum Version (optional):"
msgstr "Минимальная версия (необязательна):"
#: lazarusidestrconsts.lisprojaddnewfpmakerequirement
msgid "New FPMake Requirement"
msgstr "Новая зависимость FPMake"
#: lazarusidestrconsts.lisprojaddnewrequirement
msgid "New Requirement"
msgstr "Новая зависимость"
#: lazarusidestrconsts.lisprojaddonlinepkg
#, object-pascal-format
msgid "Online (%s)"
msgstr "Из сети (%s)"
#: lazarusidestrconsts.lisprojaddpackagename
msgid "Package Name:"
msgstr "Имя пакета:"
#: lazarusidestrconsts.lisprojaddpackagenotfound
msgid "Package not found"
msgstr "Пакет не найден"
#: lazarusidestrconsts.lisprojaddpackagetype
msgid "Package Type:"
msgstr "Тип пакета:"
#: lazarusidestrconsts.lisprojaddthedependencywasnotfound
#, object-pascal-format
msgid "The dependency \"%s\" was not found.%sPlease choose an existing package."
msgstr "Зависимость \"%s\" не найдена.%sВыберите существующий пакет."
#: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionisinvalid"
msgid "The Maximum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Максимальная версия \"%s\" некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion
msgctxt "lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion"
msgid "The Maximum Version is lower than the Minimim Version."
msgstr "Максимальная версия меньше минимальной."
#: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid
#, object-pascal-format
msgctxt "lazarusidestrconsts.lisprojaddtheminimumversionisinvalid"
msgid "The Minimum Version \"%s\" is invalid.%sPlease use the format major.minor.release.build%sFor example: 1.0.20.10"
msgstr "Минимальная версия \"%s\" некорректна.%sИспользуйте формат главная.вторичная.релиз.сборка%sНапример: 1.0.20.10"
#: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency
#, object-pascal-format
msgid "The project has already a dependency for the package \"%s\"."
msgstr "Проект уже зависит от пакета \"%s\"."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the project%swith file: \"%s\"."
msgstr "Имя модуля \"%s\" уже имеется в проекте%s(в файле: \"%s\")."
#: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection
#, object-pascal-format
msgid "The unit name \"%s\" already exists in the selection%swith file: \"%s\"."
msgstr "Имя модуля \"%s\" уже имеется в выделенном%s(в файле: \"%s\")."
#: lazarusidestrconsts.lisprojaddunitnamealreadyexists
msgid "Unit name already exists"
msgstr "Имя модуля уже существует"
#: lazarusidestrconsts.lisproject
#, object-pascal-format
msgid "Project %s"
msgstr "Проект %s"
#: lazarusidestrconsts.lisproject2
msgid "Project: "
msgstr "Проект: "
#: lazarusidestrconsts.lisproject3
msgid "project"
msgstr "проект"
#: lazarusidestrconsts.lisprojectchanged
msgid "Project changed"
msgstr "Проект изменен"
#: lazarusidestrconsts.lisprojectchangedondisk
msgid "Project changed on disk"
msgstr "Проект изменён на диске"
#: lazarusidestrconsts.lisprojectdirectory
msgctxt "lazarusidestrconsts.lisprojectdirectory"
msgid "Project directory"
msgstr "Имя каталога проекта"
#: lazarusidestrconsts.lisprojectfilename
msgid "Project filename"
msgstr "Имя файла проекта"
#: lazarusidestrconsts.lisprojectincpath
msgid "Project Include Path"
msgstr "Путь поиска включаемых файлов проекта"
#: lazarusidestrconsts.lisprojectinfofiledetected
msgid "Project info file detected"
msgstr "Обнаружен файл сведений о проекте"
#: lazarusidestrconsts.lisprojectinspectorshowprops
msgid "Show properties pane in Project Inspector"
msgstr "Показывать панель свойств в инспекторе проекта"
#: lazarusidestrconsts.lisprojectisrunnable
msgid "Project is runnable"
msgstr "Проект является запускаемым"
#: lazarusidestrconsts.lisprojectisrunnablehint
msgid "Generates a binary executable which can be run."
msgstr "Создаёт двоичный исполнимый файл, который можно непосредственно запустить"
#: lazarusidestrconsts.lisprojectmacro
msgctxt "lazarusidestrconsts.lisprojectmacro"
msgid "Project"
msgstr "Проект"
#: lazarusidestrconsts.lisprojectmacroproperties
msgid "Project macro properties"
msgstr "Свойства макросов проекта"
#: lazarusidestrconsts.lisprojectnamespaces
msgid "Project Namespaces"
msgstr "Пространства имён проекта"
#: lazarusidestrconsts.lisprojectoption
msgid "Project Option"
msgstr "Параметр проекта"
#: lazarusidestrconsts.lisprojectoutdir
msgid "Project Output directory (e.g. the ppu directory)"
msgstr "Каталог вывода проекта (например, каталог с ppu)"
#: lazarusidestrconsts.lisprojectoutputdirectory
msgid "Project output directory"
msgstr "Каталог вывода проекта"
#: lazarusidestrconsts.lisprojectpathhint
msgid "Directory where project's main file must be"
msgstr "Каталог, в котором располагается главный файл проекта"
#: lazarusidestrconsts.lisprojectsession
msgid "Project Session"
msgstr "Сеанс работы с проектом"
#: lazarusidestrconsts.lisprojectsessionchanged
msgid "Project session changed"
msgstr "Сеанс работы с проектом изменён"
#: lazarusidestrconsts.lisprojectsourcedirectories
msgid "Project source directories"
msgstr "Каталоги исходного кода проекта"
#: lazarusidestrconsts.lisprojectsraisedexceptionataddress
#, object-pascal-format
msgid "%0:s%0:s At address %1:x"
msgstr "%0:s%0:s По адресу %1:x"
#: lazarusidestrconsts.lisprojectsraisedexceptionclasss
#, object-pascal-format
msgid "Project %s raised exception class '%s'."
msgstr "Проект %s вызвал класс исключения '%s'."
#: lazarusidestrconsts.lisprojectsraisedexceptionclassswithmessagess
#, object-pascal-format
msgid "Project %s raised exception class '%s' with message:%s%s"
msgstr "Проект %s вызвал класс исключения '%s' с сообщением:%s%s"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileaddress
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at address %2:x"
msgstr "%0:s%0:s В файле '%1:s' по адресу %2:x"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfileline
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d"
msgstr "%0:s%0:s В файле '%1:s' на строке %2:d"
#: lazarusidestrconsts.lisprojectsraisedexceptioninfilelinesrc
#, object-pascal-format
msgid "%0:s%0:s In file '%1:s' at line %2:d:%0:s%3:s"
msgstr "%0:s%0:s В файле '%1:s' на строке %2:d:%0:s%3:s"
#: lazarusidestrconsts.lisprojectsrcpath
msgid "Project Src Path"
msgstr "Путь поиска файлов исходного кода проекта"
#: lazarusidestrconsts.lisprojectunit
msgid "project unit"
msgstr "модуль проекта"
#: lazarusidestrconsts.lisprojectunitpath
msgid "Project Unit Path"
msgstr "Путь поиска модулей проекта"
#: lazarusidestrconsts.lisprojectwizard
msgid "Project Wizard"
msgstr "Мастер создания проекта"
#: lazarusidestrconsts.lisprojinspconfirmdeletingdependency
msgid "Confirm deleting dependency"
msgstr "Подтвердите удаление зависимости"
#: lazarusidestrconsts.lisprojinspconfirmremovingfile
msgid "Confirm removing file"
msgstr "Подтвердите удаление файла"
#: lazarusidestrconsts.lisprojinspdeletedependencyfor
#, object-pascal-format
msgid "Delete dependency for %s?"
msgstr "Удалить зависимость от %s?"
#: lazarusidestrconsts.lisprojinspprojectinspector
#, object-pascal-format
msgid "Project Inspector - %s"
msgstr "Инспектор проекта - %s"
#: lazarusidestrconsts.lisprojinspremovedrequiredpackages
msgctxt "lazarusidestrconsts.lisprojinspremovedrequiredpackages"
msgid "Removed required packages"
msgstr "Удалённые требуемые пакеты"
#: lazarusidestrconsts.lisprojinspremovefilefromproject
#, object-pascal-format
msgid "Remove file %s from project?"
msgstr "Удалить файл %s из проекта?"
#: lazarusidestrconsts.lisprojinspremoveitemsf
#, object-pascal-format
msgid "Remove %s items from project?"
msgstr "Удалить элементы (%s шт.) из проекта?"
#: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged
msgid "Always build (even if nothing changed)"
msgstr "Собирать всегда (даже при отсутствии изменений)"
#: lazarusidestrconsts.lisprojoptsalwaysbuildhint
msgid "May be needed if there is a bug in dependency check, normally not needed."
msgstr "Может понадобиться для обхода ошибок при проверке зависимостей. В норме не требуется."
#: lazarusidestrconsts.lisprojoptserror
msgctxt "lazarusidestrconsts.lisprojoptserror"
msgid "Error"
msgstr "Ошибка"
#: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist
#, object-pascal-format
msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first."
msgstr "Невозможно изменить список автосоздаваемых форм в исходном коде программы.%sИсправьте сначала ошибки."
#: lazarusidestrconsts.lispromptforvalue
msgid "Prompt for value"
msgstr "Запрос значения"
#: lazarusidestrconsts.lisproperties
msgid "Properties (replace or remove)"
msgstr "Свойства (заменять или удалять)"
#: lazarusidestrconsts.lisproperty
#, object-pascal-format
msgid "%s property"
msgstr "Свойство %s"
#: lazarusidestrconsts.lisprotected
msgid "Protected"
msgstr "Protected"
#: lazarusidestrconsts.lisprotectedmethod
msgid "Protected Method"
msgstr "Защищённый метод"
#: lazarusidestrconsts.lispublicmethod
msgid "Public Method"
msgstr "Общий метод"
#: lazarusidestrconsts.lispublishedmethod
msgid "Published Method"
msgstr "Опубликованный метод"
#: lazarusidestrconsts.lispublishedto
#, object-pascal-format
msgid "Published to %s"
msgstr "Опубликование произведено в %s"
#: lazarusidestrconsts.lispublishmodulenote
msgid "Files belonging to project / package will be included automatically."
msgstr "Файлы, принадлежащие проекту/пакету, будут добавлены автоматически."
#: lazarusidestrconsts.lispublishprojdir
msgid "Publish project directory"
msgstr "Каталог опубликования проекта"
#: lazarusidestrconsts.lispublishproject
msgid "Publish Project"
msgstr "Опубликовать проект"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectory
msgid "Save .lrs files in the output directory"
msgstr "Сохранять файлы .lrs в каталоге вывода"
#: lazarusidestrconsts.lisputlrsfilesinoutputdirectoryhint
msgid "The resource will be available for FPC."
msgstr "Ресурсы будут доступны для FPC"
#: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas
msgctxt "lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas"
msgid "A Pascal unit must have the extension .pp or .pas"
msgstr "Модуль Паскаля должен иметь расширение .pp или .pas"
#: lazarusidestrconsts.lispvueditvirtualunit
msgid "Edit virtual unit"
msgstr "Редактировать виртуальный модуль"
#: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile"
msgid "There is already an unit with this name.%sFile: %s"
msgstr "Модуль с таким именем уже существует. %sФайл: %s"
#: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier
msgctxt "lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier"
msgid "The unitname is not a valid Pascal identifier."
msgstr "Имя модуля не является корректным идентификатором Паскаля."
#: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni
#, object-pascal-format
msgctxt "lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni"
msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1"
msgstr "Имена модуля и файла не совпадают.%sПример: unit1.pas и Unit1"
#: lazarusidestrconsts.lispwconvertproject
msgid "Convert &Delphi Project"
msgstr "Преобразовать &проект Delphi"
#: lazarusidestrconsts.lispwnewproject
msgid "&New Project"
msgstr "Новый &проект"
#: lazarusidestrconsts.lispwopenproject
msgid "&Open Project"
msgstr "&Открыть проект"
#: lazarusidestrconsts.lispwopenrecentproject
msgctxt "lazarusidestrconsts.lispwopenrecentproject"
msgid "Open &Recent Project"
msgstr "Открыть &недавний проект"
#: lazarusidestrconsts.lispwviewexampleprojects
msgid "View &Example Projects"
msgstr "Просмотреть пр&имеры проектов"
#: lazarusidestrconsts.lisquickcheckfppkgconfigurationatstart
msgid "Quick check Fppkg configuration at start"
msgstr "Проводить быструю проверку настройки Fppkg при запуске"
#: lazarusidestrconsts.lisquickfixerror
msgid "QuickFix error"
msgstr "Ошибка при быстром исправлении"
#: lazarusidestrconsts.lisquickfixes
msgid "Quick fixes"
msgstr "Быстрые исправления"
#: lazarusidestrconsts.lisquickfixsearchidentifier
msgid "Search identifier"
msgstr "Найти идентификатор"
#: lazarusidestrconsts.lisquit
msgctxt "lazarusidestrconsts.lisquit"
msgid "Quit"
msgstr "Выход"
#: lazarusidestrconsts.lisquitlazarus
msgid "&Quit Lazarus"
msgstr "В&ыход из Lazarus"
#: lazarusidestrconsts.lisreallydelete
msgid "Really delete?"
msgstr "Действительно удалить?"
#: lazarusidestrconsts.lisrecenttabs
msgid "Recent tabs"
msgstr "Недавние вкладки"
#: lazarusidestrconsts.lisrecord
msgctxt "lazarusidestrconsts.lisrecord"
msgid "Record"
msgstr "Записать"
#: lazarusidestrconsts.lisrecordedmacros
msgid "Recorded"
msgstr "Записанные"
#: lazarusidestrconsts.lisredo
msgctxt "lazarusidestrconsts.lisredo"
msgid "Redo"
msgstr "Вернуть"
#: lazarusidestrconsts.lisregularexpression
msgid "Regular expression"
msgstr "Регулярное выражение"
#: lazarusidestrconsts.lisrelative
msgid "Relative"
msgstr "Относительное"
#: lazarusidestrconsts.lisremove
msgctxt "lazarusidestrconsts.lisremove"
msgid "Remove"
msgstr "Удалить"
#: lazarusidestrconsts.lisremove2
msgid "Remove?"
msgstr "Удалить?"
#: lazarusidestrconsts.lisremoveallinvalidproperties
msgid "Remove all invalid properties"
msgstr "Удалить все некорректные свойства"
#: lazarusidestrconsts.lisremoveallmessagetypefilters
msgid "Remove all message type filters"
msgstr "Удалить все фильтры для типов сообщений"
#: lazarusidestrconsts.lisremoveallunits
msgid "Remove all units"
msgstr "Удалить все модули"
#: lazarusidestrconsts.lisremovecompileroptionhidemessage
msgid "Remove Compiler Option Hide Message"
msgstr "Не скрывать сообщение параметром компилятора"
#: lazarusidestrconsts.lisremovedependenciesfrompackage
#, object-pascal-format
msgid "Remove %s dependencies from package \"%s\"?"
msgstr "Удалить зависимости (%s шт.) пакета \"%s\"?"
#: lazarusidestrconsts.lisremovedpropertys
#, object-pascal-format
msgid "Removed property \"%s\"."
msgstr "Удалено свойство \"%s\"."
#: lazarusidestrconsts.lisremovefilesfrompackage
#, object-pascal-format
msgid "Remove %s files from package \"%s\"?"
msgstr "Удалить файлы (%s шт.) из пакета \"%s\"?"
#: lazarusidestrconsts.lisremovefromproject
msgid "Remove from Project"
msgstr "Удалить из проекта"
#: lazarusidestrconsts.lisremovefromsearchpath
msgid "Remove from search path"
msgstr "Удалить из путей поиска"
#: lazarusidestrconsts.lisremoveincludepath
msgid "Remove include path?"
msgstr "Удалить путь к включаемым файлам?"
#: lazarusidestrconsts.lisremovelocalvariable3
#, object-pascal-format
msgid "Remove local variable \"%s\""
msgstr "Удалить локальную переменную \"%s\""
#: lazarusidestrconsts.lisremovemessagetypefilter
msgid "Remove Message Type Filter"
msgstr "Удалить фильтр для типа сообщений"
#: lazarusidestrconsts.lisremovenonexistingfiles
msgid "Remove nonexistent files"
msgstr "Удалить несуществующие файлы"
#: lazarusidestrconsts.lisremoveselectedunits
msgid "Remove selected units"
msgstr "Удалить выбранные модули"
#: lazarusidestrconsts.lisremovethem
msgid "Remove them"
msgstr "Удалить их"
#: lazarusidestrconsts.lisremovethepathsfromothersources
msgid "Remove the paths from \"Other sources\""
msgstr "Удалить пути из списка \"Прочие файлы исходного кода\""
#: lazarusidestrconsts.lisremoveunitpath
msgid "Remove unit path?"
msgstr "Удалить путь к модулям?"
#: lazarusidestrconsts.lisremoveuses
#, object-pascal-format
msgid "Remove uses \"%s\""
msgstr "Удалить \"%s\" из выражения Uses"
#: lazarusidestrconsts.lisrename
msgctxt "lazarusidestrconsts.lisrename"
msgid "Rename"
msgstr "Переименовать"
#: lazarusidestrconsts.lisrename2
msgid "Rename ..."
msgstr "Переименовать ..."
#: lazarusidestrconsts.lisrenamefile
msgid "Rename file?"
msgstr "Переименовать файл?"
#: lazarusidestrconsts.lisrenamefilefailed
msgid "Rename file failed"
msgstr "Не удалось переименовать файл"
#: lazarusidestrconsts.lisrenameshowresult
msgid "Show list of renamed Identifiers"
msgstr "Показать список переименованных идентификаторов"
#: lazarusidestrconsts.lisrenameto
#, object-pascal-format
msgid "Rename to %s"
msgstr "Переименовать в %s"
#: lazarusidestrconsts.lisrenametolowercase
msgid "Rename to lowercase"
msgstr "Преобразовать в нижний регистр"
#: lazarusidestrconsts.lisreopenproject
msgid "Reopen project"
msgstr "Переоткрыть проект"
#: lazarusidestrconsts.lisreopenwithanotherencoding
msgid "Reopen with another encoding"
msgstr "Открыть с другой кодировкой"
#: lazarusidestrconsts.lisrepeat
msgctxt "lazarusidestrconsts.lisrepeat"
msgid "Repeat"
msgstr "Повторить"
#: lazarusidestrconsts.lisreplace
msgctxt "lazarusidestrconsts.lisreplace"
msgid "Replace"
msgstr "Заменить"
#: lazarusidestrconsts.lisreplacedpropertyswiths
#, object-pascal-format
msgid "Replaced property \"%s\" with \"%s\"."
msgstr "Свойство \"%s\" заменено на \"%s\"."
#: lazarusidestrconsts.lisreplacedtypeswiths
#, object-pascal-format
msgid "Replaced type \"%s\" with \"%s\"."
msgstr "Тип \"%s\" заменён на \"%s\"."
#: lazarusidestrconsts.lisreplacement
msgid "Replacement"
msgstr "Замена"
#: lazarusidestrconsts.lisreplacementfuncs
msgid "Replacement functions"
msgstr "Функции замены"
#: lazarusidestrconsts.lisreplacements
msgid "Replacements"
msgstr "Замены"
#: lazarusidestrconsts.lisreplaceremoveunknown
msgid "Fix unknown properties and types"
msgstr "Исправить неизвестные свойства и типы"
#: lazarusidestrconsts.lisreplacewholeidentifier
msgid "Replace whole identifier"
msgstr "Заменять идентификатор целиком"
#: lazarusidestrconsts.lisreplacingselectionfailed
msgid "Replacing selection failed."
msgstr "Замена выделенного не удалась."
#: lazarusidestrconsts.lisreportingbugurl
msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
msgstr "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report"
#: lazarusidestrconsts.lisrescan
msgid "Rescan"
msgstr "Пересмотреть"
#: lazarusidestrconsts.lisreset
msgctxt "lazarusidestrconsts.lisreset"
msgid "Reset"
msgstr "Сброс"
#: lazarusidestrconsts.lisresetallfilefilterstodefaults
msgid "Reset all file filters to defaults?"
msgstr "Установить значения файловых фильтров по умолчанию?"
#: lazarusidestrconsts.lisresetlefttopwidthheightofselectedcomponentstotheir
msgid "Reset Left, Top, Width, Height of selected components to their ancestor values?"
msgstr "Сбросить свойства Left, Top, Width, Height выбранных компонентов к унаследованным значениям?"
#: lazarusidestrconsts.lisresourcenamemustbeunique
msgid "Resource name must be unique."
msgstr "Имя ресурса должно быть уникальным."
#: lazarusidestrconsts.lisresourcesaveerror
msgid "Resource save error"
msgstr "Ошибка сохранения ресурса"
#: lazarusidestrconsts.lisresourcetypeofnewfiles
msgid "Resource type of project"
msgstr "Тип ресурсов проекта"
#: lazarusidestrconsts.lisrestart
msgctxt "lazarusidestrconsts.lisrestart"
msgid "Restart"
msgstr "Перезапуск"
#: lazarusidestrconsts.lisresult2
msgid "Result:"
msgstr "Результат функции:"
#: lazarusidestrconsts.lisreturnparameterindexedword
msgid ""
"Return parameter-indexed word from the current line preceding cursor position.\n"
"\n"
"Words in a line are numbered 1,2,3,... from left to right, but the last word\n"
"which is always a macro command to be expanded has number 0, thus $PrevWord(0)\n"
"is always the current macro.\n"
"\n"
"Example line:\n"
"i 0 count-1 forb|\n"
"Here $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"In the end of your template use $PrevWord(-1) which expands to an empty string, but performs an important operation of wiping off all of the $PrevWords found. In addition here is a regexp that is used to detect words for this macro: [\\w\\-+*\\(\\)\\[\\].^@]+"
msgstr ""
"Возвратить слово, индексированное параметром, из части текущей строки перед курсором.\n"
"\n"
"Слова в строке нумеруются 1,2,3,... слева направо, но последнее слово,\n"
"всегда являющееся раскрываемым макросом, имеет номер 0, поэтому $PrevWord(0)\n"
"всегда содержит текущий макрос.\n"
"\n"
"Пример:\n"
"i 0 count-1 forb|\n"
"Здесь $PrevWord(0)=forb, $PrevWord(1)=i, $PrevWord(2)=0, $PrevWord(3)=count-1\n"
"\n"
"В конце шаблона используйте $PrevWord(-1), который раскрывается пустой строкой, но при этом производит важную операцию очистки всех найденных $PrevWord. Для справки приводим регулярное выражение, использующееся для обнаружения слов для этого макроса: [\\w\\-+*\\(\\)\\[\\].^@]+"
#: lazarusidestrconsts.lisreturnslistofallvaluesofcasevariableinfrontofvaria
msgid ""
"Return the list of all values of case variable in front of variable.\n"
"\n"
"Optional Parameters (comma separated):\n"
"WithoutExtraIndent // the case list will be generated without extra indentation"
msgstr ""
"Возвратить список всех значений оператора case перед переменной.\n"
"\n"
"Необязательные параметры (разделяются запятыми):\n"
"WithoutExtraIndent // список case будет сгенерирован без дополнительных отступов"
#: lazarusidestrconsts.lisrevertfailed
msgid "Revert failed"
msgstr "Возвращение не удалось"
#: lazarusidestrconsts.lisrevision
msgid "Revision: "
msgstr "Ревизия: "
#: lazarusidestrconsts.lisright
msgctxt "lazarusidestrconsts.lisright"
msgid "Right"
msgstr "Справа"
#: lazarusidestrconsts.lisrightanchoring
msgid "Right anchoring"
msgstr "Правая привязка"
#: lazarusidestrconsts.lisrightborderspacespinedithint
msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control."
msgstr "Правый зазор. Его значение добавляется к базовуму зазору и используется для определения пространства справа от компонента."
#: lazarusidestrconsts.lisrightgutter
msgctxt "lazarusidestrconsts.lisrightgutter"
msgid "Right"
msgstr "Справа"
#: lazarusidestrconsts.lisrightsiblingcomboboxhint
msgid "This is the sibling control to which the right side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Это сосед, к которому привязывается правая граница. Оставьте пустым для привязки к родителю в стиле Delphi (BorderSpacing и ReferenceSide не имеют значения)."
#: lazarusidestrconsts.lisrightsides
msgid "Right sides"
msgstr "Правые края"
#: lazarusidestrconsts.lisrightspaceequally
msgid "Right space equally"
msgstr "Равномерно по правым краям"
#: lazarusidestrconsts.lisrun
msgctxt "lazarusidestrconsts.lisrun"
msgid "Run"
msgstr "Запуск"
#: lazarusidestrconsts.lisrunanddesigntimepackageshavenolimitations
msgid "\"Run and Design time\" packages have no limitations."
msgstr "Пакеты времени разработки и исполнения не имеют ограничений."
#: lazarusidestrconsts.lisrunning
#, object-pascal-format
msgid "%s (running ...)"
msgstr "%s (идёт исполнение ...)"
#: lazarusidestrconsts.lisrunparamsfilenotexecutable
msgid "File not executable"
msgstr "Файл не является исполнимым"
#: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable
#, object-pascal-format
msgid "The host application \"%s\" is not executable."
msgstr "Главное приложение \"%s\" не является исполнимым файлом."
#: lazarusidestrconsts.lisrunstage
msgctxt "lazarusidestrconsts.lisrunstage"
msgid "Run"
msgstr "запуске"
#: lazarusidestrconsts.lisruntimeonlycannotbeinstalledinide
msgid "Runtime only, cannot be installed in IDE"
msgstr "Только времени исполнения, не может быть установлен в IDE"
#: lazarusidestrconsts.lisruntimeonlypackagesareonlyforprojectstheycannotbei
msgid "\"Run time only\" packages are only for projects. They cannot be installed in the IDE, not even indirectly."
msgstr "Пакеты только времени исполнения предназначены исключительно для проектов. Они не могут быть установлены в IDE, даже косвенно."
#: lazarusidestrconsts.lisruntimepackagescanbeusedbyprojectstheycannotbeinst
msgid "\"Run time\" packages can be used by projects. They cannot be installed in the IDE unless some design time package requires them."
msgstr "Пакеты времени исполнения могут использоваться проектами. Они не могут быть установлены в IDE, если не требуются каким-либо пакетам времени разработки."
#: lazarusidestrconsts.lisruntofailed
msgid "Run-to failed"
msgstr "Запуск до курсора не удался"
#: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden
msgid "Abstract Methods - not yet overridden"
msgstr "Абстрактные методы - ещё не перекрыты"
#: lazarusidestrconsts.lissamabstractmethodsof
#, object-pascal-format
msgid "Abstract methods of %s"
msgstr "Абстрактные методы %s"
#: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration
msgid "Cursor is not in a class declaration"
msgstr "Курсор не находится на объявлении класса"
#: lazarusidestrconsts.lissamideisbusy
msgid "IDE is busy"
msgstr "IDE занята"
#: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods
#, object-pascal-format
msgid "%s is an abstract class, it has %s abstract methods."
msgstr "%s - абстрактный класс, он имеет %s абстрактных методов."
#: lazarusidestrconsts.lissamnoabstractmethodsfound
msgid "No abstract methods found"
msgstr "Абстрактных методов не найдено"
#: lazarusidestrconsts.lissamoverrideallselected
msgid "Override all selected"
msgstr "Перекрыть все выделенные"
#: lazarusidestrconsts.lissamoverridefirstselected
msgid "Override first selected"
msgstr "Перекрыть первый выделенный"
#: lazarusidestrconsts.lissamselectnone
msgid "Select none"
msgstr "Снять выделение"
#: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf
#, object-pascal-format
msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:"
msgstr "Имеется %s абстрактных методов, подлежащих перекрытию.%sВыберите методы, для которых должны быть созданы заглушки:"
#: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride
msgid "There are no abstract methods left to override."
msgstr "Абстрактные методы, подлежащие перекрытию, отсутствуют."
#: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth
msgid "This method can not be overridden because it is defined in the current class"
msgstr "Этот метод не может быть перекрыт, так как он определён в текущем классе"
#: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus
msgid "Unable to show abstract methods of the current class, because"
msgstr "Невозможно показать абстрактные методы текущего класса, так как"
#: lazarusidestrconsts.lissave
msgctxt "lazarusidestrconsts.lissave"
msgid "Save"
msgstr "Сохранить"
#: lazarusidestrconsts.lissaveall
msgctxt "lazarusidestrconsts.lissaveall"
msgid "Save All"
msgstr "Сохранить все"
#: lazarusidestrconsts.lissaveallchecked
msgid "Save All Checked"
msgstr "Сохранить все отмеченные"
#: lazarusidestrconsts.lissaveallmodified
msgid "Save all modified files"
msgstr "Сохранить все изменённые файлы"
#: lazarusidestrconsts.lissavealloriginalmessagestofile
msgid "Save All/Original Messages to File ..."
msgstr "Сохранить все/исходные сообщения в файл ..."
#: lazarusidestrconsts.lissaveandexitdialog
msgid "Only Save"
msgstr "Только сохранить"
#: lazarusidestrconsts.lissaveandrebuildide
msgid "Rebuild IDE"
msgstr "Пересобрать IDE"
#: lazarusidestrconsts.lissavechangedfiles
msgid "Save changed files?"
msgstr "Сохранить изменённые файлы?"
#: lazarusidestrconsts.lissavechanges
msgid "Save changes?"
msgstr "Сохранить изменения?"
#: lazarusidestrconsts.lissavechangestoproject
#, object-pascal-format
msgid "Save changes to project %s?"
msgstr "Сохранить изменения в проект %s?"
#: lazarusidestrconsts.lissavecurrenteditorfile
msgid "Save current editor file"
msgstr "Сохранить файл в текущем редакторе"
#: lazarusidestrconsts.lissavedwithidesettings
msgid "Saved with IDE settings"
msgstr "Сохраняемые с параметрами IDE"
#: lazarusidestrconsts.lissavedwithprojectsession
msgid "Saved with project session"
msgstr "Сохраняемые в сеансе работы с проектом"
#: lazarusidestrconsts.lissavefilebeforeclosingform
#, object-pascal-format
msgid "Save file \"%s\"%sbefore closing form \"%s\"?"
msgstr "Сохранить файл \"%s\"%sперед закрытием формы \"%s\"?"
#: lazarusidestrconsts.lissavemacroas
msgid "Save macro as"
msgstr "Сохранить макрос"
#: lazarusidestrconsts.lissavemessages
msgid "Save messages"
msgstr "Сохранить сообщения"
#: lazarusidestrconsts.lissaveproject
#, object-pascal-format
msgid "Save project %s (*%s)"
msgstr "Сохранить проект %s (*%s)"
#: lazarusidestrconsts.lissavesessionchangestoproject
#, object-pascal-format
msgid "Save session changes to project %s?"
msgstr "Сохранить изменения сеанса работы с проектом %s?"
#: lazarusidestrconsts.lissavesessionfoldstate
msgctxt "lazarusidestrconsts.lissavesessionfoldstate"
msgid "Save fold info"
msgstr "Сохранять сведения о свёрнутости"
#: lazarusidestrconsts.lissavesessionfoldstatehint
msgid "Code editor supports folding (temporarily hiding) blocks of code."
msgstr "Редактор поддерживает сворачивание (временное скрытие) блоков исходного кода"
#: lazarusidestrconsts.lissavesessionjumphistory
msgctxt "lazarusidestrconsts.lissavesessionjumphistory"
msgid "Save jump history"
msgstr "Сохранять историю переходов"
#: lazarusidestrconsts.lissavesessionjumphistoryhint
msgid "Ctrl-Click on an identifier in code editor is stored in jump history."
msgstr "Щелчок при нажатой клавише Ctrl по идентификатору в редакторе исходного кода сохраняется в истории переходов"
#: lazarusidestrconsts.lissavesettings
msgid "Save Settings"
msgstr "Сохранить параметры"
#: lazarusidestrconsts.lissaveshownmessagestofile
msgid "Save Shown Messages to File ..."
msgstr "Сохранить показанные сообщения в файл ..."
#: lazarusidestrconsts.lissavespace
msgid "Save "
msgstr "Сохранить "
#: lazarusidestrconsts.lissavingfileasloosescharactersatlinecolumn
#, object-pascal-format
msgid "Saving file \"%s\" as \"%s\" looses characters at line %s, column %s."
msgstr "Сохранение файла \"%s\" в \"%s\" приведёт к потере символов (строка %s, столбец %s)."
#: lazarusidestrconsts.lisscalingfactor
msgid "Scaling factor:"
msgstr "Коэффициент масштабирования:"
#: lazarusidestrconsts.lisscanfilesinparentdir
msgid "Scan files in parent directory"
msgstr "Искать файлы в родительском каталоге"
#: lazarusidestrconsts.lisscanfilesinparentdirhint
msgid "Search for source files in sibling directories (parent directory and its children)"
msgstr "Искать файлы исходного кода в соседних каталогах (родительском и его непосредственных подкаталогах)"
#: lazarusidestrconsts.lisscanning
msgid "Scanning"
msgstr "Идёт поиск"
#: lazarusidestrconsts.lisscanning2
#, object-pascal-format
msgid "%s. Scanning ..."
msgstr "%s. Поиск ..."
#: lazarusidestrconsts.lisscanparentdir
msgid "Scanning parent directory"
msgstr "Просмотр родительского каталога"
#: lazarusidestrconsts.lissearchpaths2
msgid "Search paths"
msgstr "Пути поиска"
#: lazarusidestrconsts.lissearchunit
#, object-pascal-format
msgid "Search Unit \"%s\""
msgstr "Найти модуль \"%s\""
#: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor
#, object-pascal-format
msgid "Secondary config directory where Lazarus searches for config template files. Default is \"%s\"."
msgstr "Вторичный каталог настройки, где Lazarus ищет шаблоны файлов настройки. По умолчанию - \"%s\"."
#: lazarusidestrconsts.lissecondaryconfigpath
msgid "Secondary config path"
msgstr "Путь к вторичному каталогу настройки"
#: lazarusidestrconsts.lissecondtest
msgid "&Second test"
msgstr "&Вторая проверка"
#: lazarusidestrconsts.lisseemessages
msgid "See messages."
msgstr "Смотрите сообщения."
#: lazarusidestrconsts.lisseeprojectprojectinspector
#, object-pascal-format
msgid "%sSee Project -> Project Inspector"
msgstr "%sСмотрите Проект -> Инспектор проекта"
#: lazarusidestrconsts.lisselectahelpitem
msgid "Select a help item:"
msgstr "Искать элемент справки:"
#: lazarusidestrconsts.lisselectanode
msgid "Select a node"
msgstr "Выберите элемент"
#: lazarusidestrconsts.lisselectanotherlclwidgetset
msgid "Select another LCL widgetset (macro LCLWidgetType)"
msgstr "Выберите другую библиотеку виджетов LCL (макрос LCLWidgetType)"
#: lazarusidestrconsts.lisselectbuildmode
msgid "Select build mode"
msgstr "Выбрать режим сборки"
#: lazarusidestrconsts.lisselectdfmfiles
msgid "Select Delphi form files (*.dfm)"
msgstr "Выберите файлы форм Delphi (*.dfm)"
#: lazarusidestrconsts.lisselected
msgctxt "lazarusidestrconsts.lisselected"
msgid "Selected"
msgstr "Выбранные"
#: lazarusidestrconsts.lisselectedaddition
msgid "Selected addition:"
msgstr "Выбранное дополнение:"
#: lazarusidestrconsts.lisselectedandchildcontrols
msgid "Selected and child controls"
msgstr "Выбранные и дочерние компоненты"
#: lazarusidestrconsts.lisselectedbottomneighbour
msgid "(selected bottom neighbour)"
msgstr "(выбран сосед снизу)"
#: lazarusidestrconsts.lisselectedcommandsmapping
msgid "Selected Command's Mapping"
msgstr "Комбинация выбранной команды"
#: lazarusidestrconsts.lisselectedforinstallation
msgid "selected for installation"
msgstr "выбран для установки"
#: lazarusidestrconsts.lisselectedforuninstallation
msgid "selected for uninstallation"
msgstr "выбран для удаления"
#: lazarusidestrconsts.lisselectedleftneighbour
msgid "(selected left neighbour)"
msgstr "(выбран сосед слева)"
#: lazarusidestrconsts.lisselectedmessageinmessageswindow
msgid "Selected message in messages window:"
msgstr "Выбранное в окне сообщение:"
#: lazarusidestrconsts.lisselectedmodeswerecompiled
#, object-pascal-format
msgid "Selected %d modes were successfully compiled."
msgstr "Компиляция в выбранных режимах (%d шт.) успешно завершена."
#: lazarusidestrconsts.lisselectedrightneighbour
msgid "(selected right neighbour)"
msgstr "(выбран сосед справа)"
#: lazarusidestrconsts.lisselectedtopneighbour
msgid "(selected top neighbour)"
msgstr "(выбран сосед сверху)"
#: lazarusidestrconsts.lisselectfile
msgid "Select the file"
msgstr "Выберите файл"
#: lazarusidestrconsts.lisselectfpcpath
msgid "Select the path where FPC is installed"
msgstr "Выберите путь к установленному FPC"
#: lazarusidestrconsts.lisselectfpcsourcedirectory
msgid "Select FPC source directory"
msgstr "Выберите каталог исходного кода FPC"
#: lazarusidestrconsts.lisselectframe
msgid "Select Frame"
msgstr "Выберите фрейм"
#: lazarusidestrconsts.lisselectionexceedsstringconstant
msgid "Selection exceeds string constant"
msgstr "Выбор превышает строковую константу"
#: lazarusidestrconsts.lisselectiontool
msgid "Selection tool"
msgstr "Средство выбора"
#: lazarusidestrconsts.lisselectlazarussourcedirectory
msgid "Select Lazarus source directory"
msgstr "Выберите каталог исходного кода Lazarus"
#: lazarusidestrconsts.lisselectpathto
#, object-pascal-format
msgid "Select path to %s"
msgstr "Выберите путь к %s"
#: lazarusidestrconsts.lisselecttargetdirectory
msgid "Select target directory"
msgstr "Выберите целевой каталог"
#: lazarusidestrconsts.lissetallcolors
msgid "Set all colors:"
msgstr "Задать все цвета:"
#: lazarusidestrconsts.lissetdefault
msgid "Set default"
msgstr "Установить по умолчанию"
#: lazarusidestrconsts.lissetthistotranslatethecompilermessagestoanotherlang
msgid "Set this to translate the compiler messages to another language (i.e. not English). For example: German: $(FPCSrcDir)/compiler/msg/errordu.msg."
msgstr "Задайте это значение для перевода сообщений компилятора на язык, отличный от английского. Например, для русского: $(FPCSrcDir)/compiler/msg/errorru.msg."
#: lazarusidestrconsts.lissetupdefaultindentation
msgid "(Set up default indentation)"
msgstr "(Настроить отступ по умолчанию)"
#: lazarusidestrconsts.lisshort
msgid "Short:"
msgstr "Краткое:"
#: lazarusidestrconsts.lisshortformoftargetcpuparamtargetosparamsubtargetpar
msgid "Short form of $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Subtarget is omitted if empty."
msgstr "Краткая форма $TargetCPU(Param)-$TargetOS(Param)-$SubTarget(Param). Пустая подцель опускается."
#: lazarusidestrconsts.lisshortnopath
msgid "Short, no path"
msgstr "Короткое, без указания пути"
#: lazarusidestrconsts.lisshouldthecomponentbeautocreatedwhentheapplications
#, object-pascal-format
msgid "Should the component \"%s\" be auto created when the application starts?"
msgstr "Должен ли компонент \"%s\" автоматически создаваться при запуске приложения?"
#: lazarusidestrconsts.lisshow
msgid "Show"
msgstr "Отображать"
#: lazarusidestrconsts.lisshowabstractmethodsof
#, object-pascal-format
msgid "Show abstract methods of \"%s\""
msgstr "Показать абстрактные методы в \"%s\""
#: lazarusidestrconsts.lisshowcomponenttreeinobjectinspector
msgid "Show component tree"
msgstr "Показывать дерево компонентов"
#: lazarusidestrconsts.lisshowconsole
msgid "Show console"
msgstr "Отображать консоль"
#: lazarusidestrconsts.lisshowdeclarationhints
msgid "Show declaration hints"
msgstr "Выводить подсказки с объявлениями"
#: lazarusidestrconsts.lisshowdifferencesbetweenmodes
msgid "Show differences between modes ..."
msgstr "Показать разницу между режимами ..."
#: lazarusidestrconsts.lisshowemptyunitspackages
msgid "Show empty units/packages"
msgstr "Показывать пустые модули/пакеты"
#: lazarusidestrconsts.lisshowfpcmessagelinescompiled
msgid "Show FPC message \"lines compiled\""
msgstr "Показывать сообщение FPC со статистикой компиляции"
#: lazarusidestrconsts.lisshowglyphsfor
msgid "Show Glyphs for"
msgstr "Показывать значки для"
#: lazarusidestrconsts.lisshowgutterinobjectinspector
msgid "Show gutter"
msgstr "Показывать боковое поле"
#: lazarusidestrconsts.lisshowhelp
msgid "Show help"
msgstr "Показывать справку"
#: lazarusidestrconsts.lisshowhintsinobjectinspector
msgctxt "lazarusidestrconsts.lisshowhintsinobjectinspector"
msgid "Show hints"
msgstr "Показывать всплывающие подсказки в инспекторе объектов"
#: lazarusidestrconsts.lisshowidentifiers
msgid "Show identifiers"
msgstr "Показывать идентификаторы"
#: lazarusidestrconsts.lisshowinfoboxinobjectinspector
msgid "Show information box"
msgstr "Показывать информационную панель"
#: lazarusidestrconsts.lisshowmessagetypeid
msgid "Show Message Type ID"
msgstr "Выводить идентификатор сообщения"
#: lazarusidestrconsts.lisshowmultiplelines
msgid "Show multiple lines"
msgstr "Показывать построчно"
#: lazarusidestrconsts.lisshowonlymodified
msgid "Show only modified"
msgstr "Показывать только изменённые"
#: lazarusidestrconsts.lisshowonlyonebuttoninthetaskbarforthewholeideinstead
msgid "Show only one button in the taskbar for the whole IDE instead of one per window. Some Linux Window Managers like Cinnamon do not support this and always show one button per window."
msgstr "Показывать только одну кнопку в панели задач для всей IDE вместо одной на окно. Некоторые диспетчеры окон (например, Cinnamon) не поддерживают данную возможность и всегда показывают по одной кнопке на окно."
#: lazarusidestrconsts.lisshowoutput
msgid "Show output"
msgstr "Показывать вывод"
#: lazarusidestrconsts.lisshowoverviewgutter
msgid "Show overview gutter"
msgstr "Показывать поле обзора"
#: lazarusidestrconsts.lisshowpackages
msgid "Show packages"
msgstr "Показывать пакеты"
#: lazarusidestrconsts.lisshowpositionofsourceeditor
msgid "Show position of source editor"
msgstr "Показать положение редактора исходного кода"
#: lazarusidestrconsts.lisshowpropertyfilterinobjectinspector
msgid "Show property filter"
msgstr "Показывать фильтр свойств"
#: lazarusidestrconsts.lisshowrecentlyusedidentifiersattop
msgid "Show recently used identifiers at top"
msgstr "Выводить недавно использовавшиеся идентификаторы сверху"
#: lazarusidestrconsts.lisshowrelativepaths
msgid "Show relative paths"
msgstr "Показывать относительные пути"
#: lazarusidestrconsts.lisshowsallcontrolsintreehierarchy
msgid "Shows all controls in tree hierarchy."
msgstr "Показывает все компоненты в виде дерева"
#: lazarusidestrconsts.lisshowsdescriptionforselectedproperty
msgid "A box at the bottom shows description for the selected property."
msgstr "В панели снизу выводится описание для выбранного свойства"
#: lazarusidestrconsts.lisshowsetupdialogformostimportantsettings
msgid "Show setup dialog for most important settings."
msgstr "Показать диалог настройки наиболее важных параметров."
#: lazarusidestrconsts.lisshowspecialcharacters
msgid "Show special characters"
msgstr "Показывать специальные символы"
#: lazarusidestrconsts.lisshowstatusbarinobjectinspector
msgid "Show statusbar"
msgstr "Показывать строку состояния"
#: lazarusidestrconsts.lisshowunits
msgid "Show units"
msgstr "Показывать модули"
#: lazarusidestrconsts.lisshowunitswithinitialization
msgid "Show units with initialization/finalization sections"
msgstr "Показывать модули с секциями initialization/finalization"
#: lazarusidestrconsts.lisshowunitswithinitializationhint
msgid "These units may initialize global data used by the program/application. Remove with care."
msgstr "Эти модули могут инициализировать глобальные структуры данных в программе. Удаляйте с осторожностью."
#: lazarusidestrconsts.lisshowunusedunits
msgid "Show unused units ..."
msgstr "Показать неиспользуемые модули ..."
#: lazarusidestrconsts.lisshowvaluehintswhiledebugging
msgid "Show value hints while debugging"
msgstr "Выводить подсказки со значениями во время отладки"
#: lazarusidestrconsts.lisshowversionandexit
msgid "Show version and exit."
msgstr "Показать версию и выйти."
#: lazarusidestrconsts.lisshrinktosmal
msgid "Shrink to smallest"
msgstr "Сжать до наименьшего"
#: lazarusidestrconsts.lissibling
msgid "Sibling"
msgstr "Сосед"
#: lazarusidestrconsts.lissimpleprogram
msgid "Simple Program"
msgstr "Простая программа"
#: lazarusidestrconsts.lissimpleprogramprogramdescriptor
msgid "A most simple Free Pascal command line program."
msgstr "Простейшая консольная программа на Free Pascal."
#: lazarusidestrconsts.lissimplesyntax
msgid "Simple syntax"
msgstr "Простой синтаксис"
#: lazarusidestrconsts.lisskiperrors
msgid "Skip errors"
msgstr "Пропустить ошибки"
#: lazarusidestrconsts.lisskipfile
msgid "Skip file"
msgstr "Пропустить файл"
#: lazarusidestrconsts.lisskipfileandcontinueloading
msgid "Skip file and continue loading"
msgstr "Пропустить файл и продолжить загрузку"
#: lazarusidestrconsts.lisskiploadinglastproject
msgid "Skip loading last project."
msgstr "Пропустить загрузку предыдущего проекта."
#: lazarusidestrconsts.lisskipstartupchecks
msgid "Skip selected checks at startup. Valid options are:"
msgstr "Пропустить выбранные проверки при запуске. Возможные параметры:"
#: lazarusidestrconsts.lisslowerbutmoreaccurate
msgid "Slower but more accurate."
msgstr "Медленный, но более точный метод"
#: lazarusidestrconsts.lissmallerratherthanfaster
msgid "Smaller rather than faster"
msgstr "Приоритет размера над скоростью"
#: lazarusidestrconsts.lissmatches
msgid "Matches"
msgstr "Совпадения"
#: lazarusidestrconsts.lissorrythistypeisnotyetimplemented
msgid "Sorry, this type is not yet implemented"
msgstr "Извините, этот тип ещё не реализован"
#: lazarusidestrconsts.lissorthistorylimit
msgid "History items limit"
msgstr "Максимальное количество элементов истории"
#: lazarusidestrconsts.lissorting
msgid "Sorting"
msgstr "Сортировка"
#: lazarusidestrconsts.lissortorderalphabetic
msgid "Alphabetic"
msgstr "По алфавиту"
#: lazarusidestrconsts.lissortorderdefinition
msgid "Definition (Scoped)"
msgstr "По объявлению (в области действия)"
#: lazarusidestrconsts.lissortorderscopedalphabetic
msgctxt "lazarusidestrconsts.lissortorderscopedalphabetic"
msgid "Alphabetic (Scoped)"
msgstr "По алфавиту (в области действия)"
#: lazarusidestrconsts.lissortordertitle
msgid "Order by"
msgstr "Упорядочивать"
#: lazarusidestrconsts.lissortselascending
msgid "Ascending"
msgstr "По возрастанию"
#: lazarusidestrconsts.lissortselcasesensitive
msgctxt "lazarusidestrconsts.lissortselcasesensitive"
msgid "&Case Sensitive"
msgstr "&Учитывать регистр"
#: lazarusidestrconsts.lissortseldescending
msgid "Descending"
msgstr "По убыванию"
#: lazarusidestrconsts.lissortseldomain
msgid "Domain"
msgstr "Сортируемые объекты"
#: lazarusidestrconsts.lissortselignorespace
msgid "Ignore Space"
msgstr "Игнорировать пробелы"
#: lazarusidestrconsts.lissortsellines
msgid "Lines"
msgstr "Строки"
#: lazarusidestrconsts.lissortseloptions
msgctxt "lazarusidestrconsts.lissortseloptions"
msgid "Options"
msgstr "Параметры"
#: lazarusidestrconsts.lissortselparagraphs
msgid "Paragraphs"
msgstr "Абзацы"
#: lazarusidestrconsts.lissortselpreview
msgctxt "lazarusidestrconsts.lissortselpreview"
msgid "Preview"
msgstr "Предпросмотр"
#: lazarusidestrconsts.lissortselsort
msgid "Accept"
msgstr "Принять"
#: lazarusidestrconsts.lissortselsortselection
msgid "Sort selection"
msgstr "Сортировать выделенное"
#: lazarusidestrconsts.lissortselwords
msgctxt "lazarusidestrconsts.lissortselwords"
msgid "Words"
msgstr "Слова"
#: lazarusidestrconsts.lissourceanddestinationaresame
#, object-pascal-format
msgid "Source \"%s\"%sand Destination \"%s\"%sdirectories are the same. Please select another directory."
msgstr "Исходный каталог \"%s\"%sи каталог назначения \"%s\"%sсовпадают. Выберите другой."
#: lazarusidestrconsts.lissourcedirectorydoesnotexist
#, object-pascal-format
msgid "Source directory \"%s\" does not exist."
msgstr "Каталог исходного кода \"%s\" не существует."
#: lazarusidestrconsts.lissourceeditorwindowmanager
msgid "Source Editor Window Manager"
msgstr "Управление редакторами исходного кода"
#: lazarusidestrconsts.lissourcemodified
msgid "Source modified"
msgstr "Исходный код изменён"
#: lazarusidestrconsts.lissourceofpagehaschangedsave
#, object-pascal-format
msgid "Source of page \"%s\" has changed. Save?"
msgstr "Исходный код во вкладке редактора \"%s\" был изменён. Сохранить?"
#: lazarusidestrconsts.lissourceofpagehaschangedsaveex
#, object-pascal-format
msgid "Sources of pages have changed. Save page \"%s\"? (%d more)"
msgstr "Исходный код был изменён в нескольких вкладках. Сохранить содержимое вкладки \"%s\"? (осталось %d)"
#: lazarusidestrconsts.lissourcepaths
msgid "Source paths"
msgstr "Пути к исходному коду"
#: lazarusidestrconsts.lisspaceequally
msgid "Space equally"
msgstr "Равномерно"
#: lazarusidestrconsts.lissrcos
msgid "Src OS"
msgstr "Исходная ОС"
#: lazarusidestrconsts.lisssearching
msgid "Searching"
msgstr "Поиск"
#: lazarusidestrconsts.lisssearchtext
msgid "Search text"
msgstr "Поиск текста"
#: lazarusidestrconsts.lisstartconversion
msgid "Start Conversion"
msgstr "Начать преобразование"
#: lazarusidestrconsts.lisstartide
msgid "Start IDE"
msgstr "Запустить IDE"
#: lazarusidestrconsts.lisstartwithanewproject
msgid "Start with a new project"
msgstr "Начать новый проект"
#: lazarusidestrconsts.lisstatusbarshowspropertysnameandclass
msgid "Statusbar shows the property's name and the class where it is published."
msgstr "В строке состояния выводятся имя свойства и класс, в котором оно опубликовано"
#: lazarusidestrconsts.lisstop
msgctxt "lazarusidestrconsts.lisstop"
msgid "Stop"
msgstr "Остановить"
#: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject
msgid "Stop current debugging and rebuild project?"
msgstr "Остановить текущую отладку и пересобрать проект?"
#: lazarusidestrconsts.lisstopdebugging
msgid "Stop Debugging?"
msgstr "Остановить отладку?"
#: lazarusidestrconsts.lisstopdebugging2
msgid "Stop debugging?"
msgstr "Остановить отладку?"
#: lazarusidestrconsts.lisstoponexception
msgid "Stop on exception"
msgstr "Останов при исключении"
#: lazarusidestrconsts.lisstopthedebugging
msgid "Stop the debugging?"
msgstr "Остановить отладку?"
#: lazarusidestrconsts.lisstorepathdelimitersandas
msgid "Store path delimiters \\ and / as"
msgstr "Сохранение разделителей пути \\ и /:"
#: lazarusidestrconsts.lisstreamingerror
msgid "Streaming error"
msgstr "Ошибка потоков"
#: lazarusidestrconsts.lissubprocedure
msgid "Sub Procedure"
msgstr "Подпроцедура"
#: lazarusidestrconsts.lissubprocedureonsamelevel
msgid "Sub Procedure on same level"
msgstr "Подпроцедура того же уровня"
#: lazarusidestrconsts.lissubtarget
msgid "Subtarget"
msgstr "Подцель"
#: lazarusidestrconsts.lissuccess
msgid "Success"
msgstr "Успешно"
#: lazarusidestrconsts.lissuccessfullyexported
#, object-pascal-format
msgid "Successfully exported to \"%s\"."
msgstr "Экспорт в \"%s\" успешно завершён."
#: lazarusidestrconsts.lissuccessfullyexportedbuildmodes
#, object-pascal-format
msgid "Successfully exported %d BuildModes to \"%s\"."
msgstr "Экспорт режимов сборки (%d шт.) в \"%s\" успешно завершён."
#: lazarusidestrconsts.lissuccessfullyexportedcompileroptions
#, object-pascal-format
msgid "Successfully exported compiler options to \"%s\"."
msgstr "Экспорт параметров компилятора в \"%s\" успешно завершён."
#: lazarusidestrconsts.lissuccessfullyimported
#, object-pascal-format
msgid "Successfully imported from \"%s\"."
msgstr "Импорт из \"%s\" успешно завершён."
#: lazarusidestrconsts.lissuccessfullyimportedbuildmodes
#, object-pascal-format
msgid "Successfully imported %d BuildModes from \"%s\"."
msgstr "Импорт режимов сборки (%d шт.) из \"%s\" успешно завершён."
#: lazarusidestrconsts.lissuccessfullyimportedcompileroptions
#, object-pascal-format
msgid "Successfully imported compiler options from \"%s\"."
msgstr "Импорт параметров компилятора из \"%s\" успешно завершён."
#: lazarusidestrconsts.lissuggestdefaultnameofnewfileinlowercase
msgid "Suggest default name of new file in lowercase"
msgstr "Предлагать имя нового файла по умолчанию в нижнем регистре"
#: lazarusidestrconsts.lissuspiciousincludepath
msgid "Suspicious include path"
msgstr "Подозрительный путь поиска включаемых файлов"
#: lazarusidestrconsts.lissuspiciousunitpath
msgid "Suspicious unit path"
msgstr "Подозрительный путь поиска модулей"
#: lazarusidestrconsts.lissvuoinvalidvariablename
msgid "Invalid variable name"
msgstr "Неверное имя переменной"
#: lazarusidestrconsts.lissvuoisnotavalididentifier
#, object-pascal-format
msgid "\"%s\" is not a valid identifier."
msgstr "\"%s\" не является корректным идентификатором."
#: lazarusidestrconsts.lissvuooverridesystemvariable
msgid "Override system variable"
msgstr "Перекрыть системную переменную"
#: lazarusidestrconsts.lisswitchfiltersettings
msgid "Switch Filter Settings"
msgstr "Настроить переключение фильтров"
#: lazarusidestrconsts.lisswitchtofavoritestabafterasking
msgid "Switch to Favorites tab after asking for component name."
msgstr "Переключаться на вкладку 'Избранное' инспектора объектов после запроса имени компонента"
#: lazarusidestrconsts.lissyntaxmode
msgid "Syntax mode"
msgstr "Режим синтаксиса"
#: lazarusidestrconsts.lissystemppunotfoundcheckyourfpccfg
msgid "system.ppu not found. Check your fpc.cfg."
msgstr "не найден system.ppu. Проверьте, что файл fpc.cfg корректен."
#: lazarusidestrconsts.listab
msgid "Tab"
msgstr "Таб"
#: lazarusidestrconsts.listaborderconfirmsort
#, object-pascal-format
msgid "Sort tab orders of all child controls of \"%s\" by their positions?"
msgstr "Изменить порядок перехода по всем дочерним компонентам \"%s\" в соответствии с их расположением?"
#: lazarusidestrconsts.listaborderdownhint
msgid "Move the selected control down in tab order"
msgstr "Переместить выбранный компонент вниз в порядке перехода"
#: lazarusidestrconsts.listaborderof
#, object-pascal-format
msgid "Tab Order of %s"
msgstr "Порядок перехода для %s"
#: lazarusidestrconsts.listaborderrecursionhint
msgid "Calculate tab order recursively for child controls"
msgstr "Вычислить порядок перехода рекурсивно для дочерних компонентов"
#: lazarusidestrconsts.listaborderrecursively
msgid "recursively"
msgstr "рекурсивно"
#: lazarusidestrconsts.listabordersorthint
msgid "Calculate tab order for controls by their X- and Y- positions"
msgstr "Вычислить порядок перехода по координатам X и Y компонентов"
#: lazarusidestrconsts.listaborderuphint
msgid "Move the selected control up in tab order"
msgstr "Переместить выбранный компонент вверх в порядке перехода"
#: lazarusidestrconsts.listabsfor
#, object-pascal-format
msgid "Tabs for %s"
msgstr "Вкладки %s"
#: lazarusidestrconsts.listarget
msgid "Target:"
msgstr "Цель:"
#: lazarusidestrconsts.listarget2
#, object-pascal-format
msgid ", Target: %s"
msgstr ", цель: %s"
#: lazarusidestrconsts.listargetcpu
msgid "Target CPU"
msgstr "Семейство процессоров"
#: lazarusidestrconsts.listargetfilenameemptyuseunitoutputdirectory
msgid "Target file name: (-o, empty = use unit output directory)"
msgstr "Имя исполнимого файла: (-o, пустое = использовать каталог вывода модулей)"
#: lazarusidestrconsts.listargetfilenameo
msgid "Target file name (-o):"
msgstr "Имя исполнимого файла (-o):"
#: lazarusidestrconsts.listargetfilenameofproject
msgid "Target filename of project"
msgstr "Имя исполнимого файла проекта"
#: lazarusidestrconsts.listargetfilenameplusparams
msgid "Target filename + params"
msgstr "Имя исполнимого файла с параметрами"
#: lazarusidestrconsts.listargetisreadonly
msgid "Target is read only"
msgstr "Цель доступна только для чтения"
#: lazarusidestrconsts.listargetos
msgctxt "lazarusidestrconsts.listargetos"
msgid "Target OS"
msgstr "Целевая ОС"
#: lazarusidestrconsts.listemplateeditparamcell
msgid "Editable Cell"
msgstr "Редактируемое поле"
#: lazarusidestrconsts.listemplateeditparamcellhelp
#, object-pascal-format
msgid "Insert an editable Cell. Cells can be navigated using the tab key.%0:sThe \"param\" macro takes a list of comma separated arguments.%0:sThe first argument is the default value.%0:sThe 2nd argument (optional) can be used to link the cell to another cell (syncro edit).%0:s%0:s while param(\"foo\") do param(foo);%0:sInserts 2 independent cells, both with the default text \"foo\".%0:sThe quotes are optional.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sInserts 2 linked cells, editing either one, will change the other one too.%0:sThe value \"1\" refers to the position of the other \"param()\", so if there are more params:%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sThe 2nd and third are linked (the 3rd refers to \"2\").%0:s%0:s\"Sync\" can be shortened to \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sThe 2nd and third are linked.%0:sNote: \"Sync\" has no position and no \"=\", so it syncs to the previous cell with the same default (in this case \"foo\")."
msgstr "Вставить редактируемое поле. По полям можно перемещаться при помощи клавиши ТАБ.%0:sВходные параметры макроса \"Param\" представляют собой список аргументов, разделённых запятыми.%0:sПервый аргумент - значение по умолчанию.%0:sВторой аргумент (необязательный) может использоваться для связи редактируемых полей (синхронное редактирование).%0:s%0:s while param(\"foo\") do param(foo);%0:sвставляет два независимых поля, каждое с текстом по умолчанию \"foo\".%0:sКавычки необязательны.%0:s%0:s if param(\"foo\") > 0 and param(\"foo\",sync=1) < 99 then%0:sвставляет два связанных поля. Редактирование любого из них меняет другое.%0:sЗначение \"1\" содержит позицию другого \"param()\", поэтому выражение (полей больше двух):%0:s if param(\"bar\") and param(foo) > 0 and param(foo,sync=2) < 99 then%0:sсвязывает второе и третье поле (третье поле ссылается на \"2\").%0:s%0:s\"Sync\" может быть сокращено до \"s\":%0:s if param(\"foo\") > 0 and param(\"foo\",s=1) < 99 then%0:s%0:s if param(\"bar\") and param(\"foo\") > 0 and param(\"foo\",sync) < 99 then%0:sсвязывает второе и третье поле.%0:sПримечание: параметру \"Sync\" не присвоена позиция другого поля, поэтому синхронизация производится с предыдущим полем с тем же значением по умолчанию (в данном случае \"foo\")."
#: lazarusidestrconsts.listemplatefile
msgid "Template file"
msgstr "Файл шаблонов"
#: lazarusidestrconsts.listestdirectory
msgid "Test directory"
msgstr "Каталог для сборки пробных проектов"
#: lazarusidestrconsts.listesturl
msgid "Test URL"
msgstr "Проверить адрес"
#: lazarusidestrconsts.listheapplicationbundlewascreatedfor
#, object-pascal-format
msgid "The Application Bundle was created for \"%s\""
msgstr "Application Bundle для \"%s\" успешно создан"
#: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro
#, object-pascal-format
msgid "The class \"%s\" is a TControl and cannot be pasted onto a non control.%sUnable to paste."
msgstr "Класс \"%s\" имеет тип TControl и может быть вставлен только в управляющий элемент.%sНевозможно вставить."
#: lazarusidestrconsts.listhecompilerfiledoesnotlookcorrect
#, object-pascal-format
msgid "The compiler file \"%s\" does not look correct:%s%s"
msgstr "Файл компилятора \"%s\", вероятно, некорректен:%s%s"
#: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby
#, object-pascal-format
msgid "The component %s can not be deleted because it is not owned by %s."
msgstr "Компонент %s не может быть удалён, так как %s им не владеет."
#: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror
#, object-pascal-format
msgid "The component editor of class \"%s\" has created the error:%s\"%s\""
msgstr "Редактор компонента для класса \"%s\" вызвал ошибку:%s\"%s\""
#: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated
#, object-pascal-format
msgid "The component editor of class \"%s\"%sinvoked with verb #%s \"%s\"%shas created the error:%s\"%s\""
msgstr "Редактор компонента для класса \"%s\",%sсвязанный с командой #%s \"%s\",%sвызвал ошибку:%s\"%s\""
#: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there."
msgstr "Компонент %s унаследован от %s.%sДля удаления унаследованного компонента следует открыть объект-предок и удалить его там."
#: lazarusidestrconsts.listhecomponentisinheritedfromtorenameaninheritedcomp
#, object-pascal-format
msgid "The component %s is inherited from %s.%sTo rename an inherited component open the ancestor and rename it there."
msgstr "Компонент %s унаследован от %s.%sДля переименования унаследованного компонента откройте его родителя и выполните переименование там."
#: lazarusidestrconsts.listhecomponentnamemustbeuniqueinallcomponentsonthefo
msgid "The component name must be unique in all components on the form/datamodule.The name is compared case insensitive like a normal Pascal identifier."
msgstr "Имена компонентов должны быть уникальными в пределах формы/модуля данных. Сравнение имён, как и для обычных идентификаторов Паскаля, происходит без учёта регистра."
#: lazarusidestrconsts.listheconfigurationwillbedowngradedconverted
msgid "The configuration will be downgraded/converted."
msgstr "Каталог настройки будет преобразован с понижением версии."
#: lazarusidestrconsts.listhecontainsanotexistingdirectory
#, object-pascal-format
msgid "The %s contains a nonexistent directory:%s%s"
msgstr "%s содержит несуществующий каталог:%s%s"
#: lazarusidestrconsts.listhecontainsastarcharacterlazarususesthisasnormalch
#, object-pascal-format
msgid "The %s contains a star * character.%sLazarus uses this as normal character and does not expand this as file mask."
msgstr "%s содержит символ звёздочки *.%sLazarus интерпретирует его как обычный символ, не раскрывая в качестве файловой маски."
#: lazarusidestrconsts.listhecurrentfpchasnoconfigfileitwillprobablymisssome
msgid "The current FPC has no config file. It will probably miss some units. Check your installation of fpc."
msgstr "Для используемого компилятора FPC отсутствует файл настройки. Вероятно, компилятор не сможет найти ряд модулей. Проверьте, что FPC установлен правильно."
#: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro
#, object-pascal-format
msgid "The debugger \"%s\"%sdoes not exist or is not executable.%sSee Tools -> Options -> Debugger options"
msgstr "Отладчик \"%s\"%sне существует или не является исполнимым файлом.%sПроверьте Сервис -> Параметры -> Отладчик"
#: lazarusidestrconsts.listhedefaultmodemustbestoredinproject
msgid "The default mode must be stored in project, not in session."
msgstr "Режим по умолчанию должен храниться в файле проекта, а не сеанса работы."
#: lazarusidestrconsts.listhedestinationdirectorydoesnotexist
#, object-pascal-format
msgid "The destination directory%s\"%s\" does not exist."
msgstr "Каталог назначения%s\"%s\" не существует."
#: lazarusidestrconsts.listhedirectorycontainsnoprojectincludefilesanymorere
#, object-pascal-format
msgid "The directory \"%s\" contains no project include files any more. Remove this directory from the project's include search path?"
msgstr "Каталог \"%s\" больше не содержит включаемых файлов проекта. Удалить его из списка путей к включаемым файлам проекта?"
#: lazarusidestrconsts.listhedirectorycontainsnoprojectunitsanymoreremovethi
#, object-pascal-format
msgid "The directory \"%s\" contains no project units any more. Remove this directory from the project's unit search path?"
msgstr "Каталог \"%s\" больше не содержит модулей проекта. Удалить его из списка путей к модулям проекта?"
#: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit
#, object-pascal-format
msgid "The directory \"%s\" is no longer needed in the unit path.%sRemove it?"
msgstr "Присутствие каталога \"%s\" в списке путей к модулям больше не требуется.%sУдалить его?"
#: lazarusidestrconsts.listhefile
#, object-pascal-format
msgid "The file \"%s\""
msgstr "Файл \"%s\""
#: lazarusidestrconsts.listhefileindexisneededforfunctionslikefinddeclaratio
msgid "The file index is needed for functions like find declaration. While scanning you can edit sources and compile, but functions like find declaration will show unit-not-found errors. This can take a minute."
msgstr "Индекс файлов требуется для обеспечения работы функции поиска и ей подобных. Во время просмотра можно редактировать исходный код и компилировать, но функция поиска и ей подобные будут сообщать, что требуемые модули не найдены. Процесс может занять некоторое время."
#: lazarusidestrconsts.listhefileisnotalazarusprojectcreateanewprojectforthi
#, object-pascal-format
msgid "The file \"%s\" is not a Lazarus project.%sCreate a new project for this \"%s\"?"
msgstr "Файл \"%s\" не является проектом Lazarus.%sСоздать новый проект для \"%s\"?"
#: lazarusidestrconsts.listhefilemaskisinvalid
#, object-pascal-format
msgid "The file mask \"%s\" is invalid."
msgstr "Файловая маска \"%s\" некорректна."
#: lazarusidestrconsts.listhefilemaskisnotavalidregularexpression
#, object-pascal-format
msgid "The file mask \"%s\" is not a valid regular expression."
msgstr "Файловая маска \"%s\" не является корректным регулярным выражением."
#: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject
#, object-pascal-format
msgid "The file \"%s\" seems to be a program.%sClose current project and create a new Lazarus project for this program?%s\"No\" will load the file as normal source."
msgstr "Файл \"%s\" выглядит как программа.%sЗакрыть текущий проект и создать новый проект Lazarus для этой программы?%s\"Нет\" откроет файл как обычный исходный код."
#: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp
#, object-pascal-format
msgid "The file %s seems to be the program file of an existing Lazarus Project."
msgstr "Файл %s, вероятно, является файлом программы уже существующего проекта Lazarus."
#: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself
#, object-pascal-format
msgid "The file \"%s\" was not found.%sDo you want to locate it yourself?"
msgstr "Файл \"%s\" не найден.%sВы хотите найти его самостоятельно?"
#: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject
#, object-pascal-format
msgid "The file \"%s\" was not found.%sIgnore will go on loading the project,%sAbort will stop the loading."
msgstr "Файл \"%s\" не найден.%sПропустить- продолжить загрузку проекта,%sПрервать - остановить загрузку."
#: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth
#, object-pascal-format
msgid "The following methods used by %s are not in the source%s%s%s%s%sRemove the dangling references?"
msgstr "Следующие методы, используемые %s, отсутствуют в исходном коде%s%s%s%s%sУдалить некорректные ссылки?"
#: lazarusidestrconsts.listhefpcsourcedirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The FPC source directory \"%s\" does not look correct:%s%s"
msgstr "Каталог исходного кода FPC \"%s\", вероятно, некорректен:%s%s"
#: lazarusidestrconsts.listhefppkgconfigurationfiledoesnotlookcorrect
#, object-pascal-format
msgid "The Fppkg configuration file \"%s\" does not look correct:%s%s"
msgstr "Файл настройки Fppkg \"%s\", вероятно, некорректен:%s%s"
#: lazarusidestrconsts.listhefreepascalcompilerexecutabletypicallyhasthename
#, object-pascal-format
msgid "The Free Pascal compiler executable typically has the name \"%s\". You can also use the target specific compiler like \"%s\". Please give the full file path."
msgstr "Исполнимый файл компилятора Free Pascal обычно имеет имя \"%s\". Вы также можете использовать компилятор для определённой платформы, например, \"%s\". Задайте полный путь к файлу."
#: lazarusidestrconsts.listheideisstillbuilding
msgid "The IDE is still building."
msgstr "IDE всё ещё ведёт сборку."
#: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction
msgid "The identifier is a unit. Please use the File - Save as function to rename a unit."
msgstr "Идентификатор является модулем. Для его переименования используйте функцию Файл -> Сохранить как."
#: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand
#, object-pascal-format
msgid "The key %s is already assigned to %s%s.%s%sRemove the old assignment and assign the key to the new function %s?"
msgstr "Клавиша %s уже назначена для %s%s.%s%sУдалить старую ассоциацию и назначить клавишу для новой функции %s?"
#: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists
#, object-pascal-format
msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%sSee Project -> Project Options -> Application for settings."
msgstr "Требуемый для исполнения Application Bundle %s%sне существует либо не является исполнимым файлом.%sВы хотите создать его?%sДля настройки смотрите Проект -> Параметры проекта -> Приложение."
#: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta
#, object-pascal-format
msgid "The launching application \"%s\"%sdoes not exist or is not executable.%sSee Run -> Run parameters -> Local"
msgstr "Запускающее приложение \"%s\"%sне существует или не является исполнимым файлом.%sСмотрите Запуск -> Параметры запуска -> Локальные"
#: lazarusidestrconsts.listhelazarusdirectorycontainsthesourcesoftheideandth
#, object-pascal-format
msgid "The Lazarus directory contains the sources of the IDE and the package files of LCL and many standard packages. For example it contains the file \"ide%slazarus.lpi\". The translation files are located there too."
msgstr "Каталог Lazarus содержит исходный код IDE, а также файлы LCL и многих стандартных пакетов. Например, он содержит файл \"ide%slazarus.lpi\". Также в нём располагаются файлы переводов."
#: lazarusidestrconsts.listhelazarusdirectorydoesnotlookcorrect
#, object-pascal-format
msgid "The Lazarus directory \"%s\" does not look correct:%s%s"
msgstr "Каталог Lazarus \"%s\", вероятно, некорректен:%s%s"
#: lazarusidestrconsts.listhelazarussourcesuse
#, object-pascal-format
msgid "The Lazarus sources use a different list of base packages.%sIt is recommended to compile the IDE clean using lazbuild."
msgstr "Исходный код Lazarus использует отличающийся набор базовых пакетов.%sРекомендуется собрать IDE с помощью lazbuild, проведя перед этим очистку."
#: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis
msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the Pascal code manually."
msgstr "Файл LFM (форма Lazarus) содержит некорректные свойства. Это значит, например, что он содержит некоторые свойства/классы, которых нет в текущей версии LCL. Обычно следует убрать эти свойства из LFM и исправить код Паскаля вручную."
#: lazarusidestrconsts.listhemacrodoesnotbeginwith
#, object-pascal-format
msgid "The macro \"%s\" does not begin with \"%s\"."
msgstr "Макрос \"%s\" не начинается с \"%s\"."
#: lazarusidestrconsts.listhemakeexecutabletypicallyhasthename
#, object-pascal-format
msgid "The \"make\" executable typically has the name \"%s\". It is needed for building the IDE. Please give the full file path."
msgstr "Исполнимый файл \"make\" обычно называется \"%s\". Он необходим для сборки IDE. Укажите полный путь к нему."
#: lazarusidestrconsts.listhenewincludefileisnotyetintheincludesearchpathadd
#, object-pascal-format
msgid "The new include file is not yet in the include search path.%sAdd directory %s?"
msgstr "Путь к новому включаемому файлу отсутствует в списке путей их поиска.%sДобавить каталог %s?"
#: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory
#, object-pascal-format
msgid "The new unit is not yet in the unit search path.%sAdd directory %s?"
msgstr "Путь к новому модулю отсутствует в списке путей их поиска.%sДобавить каталог %s?"
#: lazarusidestrconsts.listheoldconfigurationwillbeupgraded
msgid "The old configuration will be upgraded."
msgstr "Старый каталог настройки будет обновлён."
#: lazarusidestrconsts.listheothersourcescontainsadirectorywhichisalreadyint
#, object-pascal-format
msgid "The \"Other sources\" contains a directory which is already in the \"Other unit files\".%s%s"
msgstr "Список путей \"Прочие файлы исходного кода\" содержит путь, уже имеющийся в списке \"Другие модули\".%s%s"
#: lazarusidestrconsts.listheoutputdirectoryismissing
#, object-pascal-format
msgid "The output directory \"%s\" is missing."
msgstr "Каталог вывода \"%s\" отсутствует."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath
#, object-pascal-format
msgid "The output directory of %s is listed in the include search path of %s."
msgstr "Каталог вывода %s присутствует в списке путей поиска включаемых файлов %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited include search path of %s."
msgstr "Каталог вывода %s присутствует в унаследованном списке путей поиска включаемых файлов %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear
#, object-pascal-format
msgid "The output directory of %s is listed in the inherited unit search path of %s."
msgstr "Каталог вывода %s присутствует в унаследованном списке путей поиска модулей %s."
#: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof
#, object-pascal-format
msgid "The output directory of %s is listed in the unit search path of %s."
msgstr "Каталог вывода %s присутствует в списке путей поиска модулей %s."
#: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot
msgid " The output directory should be a separate directory and not contain any source files."
msgstr " Каталог вывода должен быть отдельным и не содержать файлов исходного кода."
#: lazarusidestrconsts.listheownerclasshasthisname
msgid "The owner class has this name"
msgstr "Это имя уже имеет класс-владелец"
#: lazarusidestrconsts.listheownerhasthisname
msgid "The owner has this name"
msgstr "Это имя уже имеет владелец"
#: lazarusidestrconsts.listhepackageaddsthepathtotheincludepathoftheidethisi
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the include path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Пакет %s добавляет путь \"%s\" к списку путей к включаемым файлам IDE.%sВероятно, это ошибка настройки пакета."
#: lazarusidestrconsts.listhepackageaddsthepathtotheunitpathoftheidethisispr
#, object-pascal-format
msgid "The package %s adds the path \"%s\" to the unit path of the IDE.%sThis is probably a misconfiguration of the package."
msgstr "Пакет %s добавляет путь \"%s\" к списку путей к модулям IDE.%sВероятно, это ошибка настройки пакета."
#: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname
msgid "The package already contains a unit with this name."
msgstr "Пакет уже содержит модуль с таким именем."
#: lazarusidestrconsts.listhepackagecannotbeinstalledbecauseitrequireswhichi
#, object-pascal-format
msgid "The package %s cannot be installed because it requires the package \"%s\" which is a runtime only package."
msgstr "Пакет %s не может быть установлен, так как он зависит от пакета только времени исполнения \"%s\"."
#: lazarusidestrconsts.listhepackagecannotbeuninstalledbecauseitisneededbyth
#, object-pascal-format
msgid "The package %s can not be uninstalled because it is needed by the IDE itself."
msgstr "Пакет %s не может быть удалён, так как требуется самой IDE."
#: lazarusidestrconsts.listhepackagedoesnothaveanyregisterprocedurewhichtypi
#, object-pascal-format
msgid "The package %s does not have any \"Register\" procedure which typically means it does not provide any IDE addon. Installing it will probably only increase the size of the IDE and may even make it unstable.%sHint: If you want to use a package in your project, use the \"Add to project\" menu item."
msgstr "Пакет %s не имеет процедуры \"Register\". Обычно это означает, что он не предоставляет расширений IDE. Его установка, вероятно, только увеличит размер IDE, и даже может вызвать её нестабильную работу.%sПодсказка: если вы хотите использовать пакет в вашем проекте, используйте пункт меню \"Добавить к проекту\"."
#: lazarusidestrconsts.listhepackageisalreadyinthelist
#, object-pascal-format
msgid "The package %s is already in the list"
msgstr "Пакет %s уже имеется в списке"
#: lazarusidestrconsts.listhepackageisnotadesigntimepackageitcannotbeinstall
#, object-pascal-format
msgid "The package %s is not a design time package. It cannot be installed in the IDE."
msgstr "Пакет %s не является пакетом времени разработки. Он не может быть установлен в IDE."
#: lazarusidestrconsts.listhepackageisusedby
#, object-pascal-format
msgid "The package \"%s\" is used by"
msgstr "Пакет \"%s\" используется в"
#: lazarusidestrconsts.listhepathofmakeisnotcorrect
#, object-pascal-format
msgid "The path of \"make\" is not correct: \"%s\""
msgstr "Путь к \"Make\" некорректен: \"%s\""
#: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla
#, object-pascal-format
msgid "The program \"make\" was not found.%sThis tool is needed to build Lazarus."
msgstr "Программа \"make\" не найдена.%sОна требуется для сборки Lazarus."
#: lazarusidestrconsts.listheprojectcompileroptionsandthedirectivesinthemain
msgid "The project compiler options and the directives in the main source differ. For the new unit the mode and string type of the project options are used:"
msgstr "Параметры компилятора для проекта не соответствуют директивам в главном файле исходного кода. В новом модуле будут использованы режим синтаксиса и тип строк в соответствии с параметрами проекта:"
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_caption
msgid "Running your application with debugger"
msgstr "Запуск приложения в отладчике"
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_footer
msgid "This choice can be later changed in Project -> Project Options -> Compiler Options -> Debugging."
msgstr "Выбор можно будет изменить позднее в диалоге Проект -> Параметры проекта -> Параметры компилятора -> Отладка."
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_nodebugbtn_caption
msgid "Run with no debugger"
msgstr "Запустить без отладчика"
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_textexplain
#, object-pascal-format
msgid "\"%s\" can only run your application when it was compiled with a suitable Debug Information enabled."
msgstr "Отладчик \"%s\" сможет запустить ваше приложение только если оно было собрано с подходящей отладочной информацией."
#: lazarusidestrconsts.listheprojectdoesnotusedwarf_taskdlg_title
msgid "Choose Debug Information format"
msgstr "Выберите формат отладочной информации"
#: lazarusidestrconsts.listheprojectdoesnotusethelclunitinterfacesbutitseems
#, object-pascal-format
msgid "The project does not use the LCL unit interfaces, which is required by LCLBase.%sYou will get strange linker errors if you use the LCL without interfaces."
msgstr "Проект не использует модуль LCL Interfaces, требующийся LCLBase.%sКомпоновщик будет выдавать непонятные ошибки, если LCL будет использоваться без модуля Interfaces."
#: lazarusidestrconsts.listheprojecthasnocompilecommandseepr
#, object-pascal-format
msgid "The project has no compile command.%sSee Project -> Project Options -> Compiler Options -> Compiler Commands"
msgstr "Проект не имеет команды компиляции.%sСмотрите Проект -> Параметры проекта -> Параметры компилятора -> Команды компилятора"
#: lazarusidestrconsts.listheprojecthasnomainsourcefile
msgid "The project has no main source file."
msgstr "Проект не имеет главного файла исходного кода."
#: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource
#, object-pascal-format
msgid "The project info file \"%s\"%sis equal to the project main source file!"
msgstr "Файл сведений о проекте \"%s\"%sсовпадает с главным файлом исходного кода проекта!"
#: lazarusidestrconsts.listheprojectinformationfilehaschangedondisk
#, object-pascal-format
msgid "The project information file \"%s\"%shas changed on disk."
msgstr "Файл сведений о проекте \"%s\"%sбыл изменён на диске."
#: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest
#, object-pascal-format
msgid "The project must be saved before building%sIf you set the Test Directory in the IDE options,%syou can create new projects and build them at once.%sSave project?"
msgstr "Проект требуется сохранить перед компиляцией%sВыбор каталога для сборки пробных проектов в параметрах IDE%sпозволит создавать новые проекты и сразу собирать их.%sСохранить проект?"
#: lazarusidestrconsts.listheprojectusesfpcresourceswhichrequireatleast
msgid "The project uses FPC resources which require at least FPC 2.4"
msgstr "Проект использует ресурсы FPC, требующие компилятор версии не ниже 2.4"
#: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar
#, object-pascal-format
msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories.%sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories."
msgstr "Проект использует целевую ОС %s и процессор %s.%sSystem.ppu для этой цели не был найден в каталогах двоичных файлов FPC.%sУбедитесь в том, что FPC установлен корректно для данной цели, и что файл fpc.cfg содержит верные каталоги."
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstoanexternalfilethe
#, object-pascal-format
msgid "The project writes the debug symbols to an external file. The \"%s\" supports only symbols within the executable."
msgstr "Проект записывает отладочные символы во внешний файл. \"%s\" поддерживает только отладочные символы, размещённые непосредственно в исполнимом файле."
#: lazarusidestrconsts.listheprojectwritesthedebugsymbolstotheexexcutable
#, object-pascal-format
msgid "The project writes the debug symbols into the executable rather than to an external file. The \"%s\" supports only symbols in an external file."
msgstr "Проект записывает отладочные символы непосредственно в исполнимый, а не во внешний файл. \"%s\" поддерживает только отладочные символы, размещённые во внешнем файле."
#: lazarusidestrconsts.listhereareadditionalnotesforthismessageon
#, object-pascal-format
msgid "%sThere are additional notes for this message on%s"
msgstr "%sДля данного сообщения найдены дополнительные сведения по адресу%s"
#: lazarusidestrconsts.listherearenoconflictingkeys
msgid "There are no conflicting keys."
msgstr "Конфликтующие комбинации клавиш отсутствуют."
#: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename
#, object-pascal-format
msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?"
msgstr "В каталоге есть и другие файлы с таким же именем,%sотличающиеся только регистром:%s%s%sУдалить их?"
#: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension
#, object-pascal-format
msgid "There is a file with the same name and a similar extension on disk%sFile: %s%sAmbiguous File: %s%sDelete ambiguous file?"
msgstr "На диске есть файл с таким же именем и похожим расширением%sФайл: %s%sФайл с дублирующимся именем: %s%sУдалить второй файл?"
#: lazarusidestrconsts.listhereisalreadyabuildmodewiththisname
msgid "There is already a build mode with this name."
msgstr "Режим сборки с таким именем уже имеется."
#: lazarusidestrconsts.listhereisalreadyacomponentclasswiththename
#, object-pascal-format
msgid "There is already a component class with the name %s."
msgstr "Класс компонента с именем %s уже имеется."
#: lazarusidestrconsts.listhereisalreadyacomponentwiththisname
msgid "There is already a component with this name"
msgstr "Компонент с таким именем уже имеется"
#: lazarusidestrconsts.listhereisalreadyafilein
#, object-pascal-format
msgid "There is already a file%s%s%sin %s"
msgstr "Файл с именем%s%s%sуже имеется в сущности \"%s\""
#: lazarusidestrconsts.listhereisalreadyafileinoldnewcontinue
#, object-pascal-format
msgid "There is already a file \"%s\" in %s%sOld: %s%sNew: %s%s%sContinue?"
msgstr "Файл \"%s\" уже имеется в сущности \"%s\"%sСтарый: %s%sНовый: %s%s%sПродолжить?"
#: lazarusidestrconsts.listhereisalreadyaformwiththename
#, object-pascal-format
msgid "There is already a form with the name \"%s\""
msgstr "Форма с именем \"%s\" уже имеется"
#: lazarusidestrconsts.listhereisalreadyamacrowiththename
#, object-pascal-format
msgid "There is already a macro with the name \"%s\"."
msgstr "Макрос с именем \"%s\" уже имеется."
#: lazarusidestrconsts.listhereisalreadyanidemacrowiththename
#, object-pascal-format
msgid "There is already an IDE macro with the name \"%s\""
msgstr "Макрос IDE с именем \"%s\" уже имеется"
#: lazarusidestrconsts.listhereisalreadyapackageinthelist
#, object-pascal-format
msgid "There is already a package %s in the list"
msgstr "Пакет с именем %s уже имеется в списке"
#: lazarusidestrconsts.listhereisalreadyaunitinoldnewyouhavetomakesur
#, object-pascal-format
msgid "There is already a unit \"%s\" in %s%sOld: %s%sNew: %s%sYou have to make sure that the unit search path contains only one of them.%s%sContinue?"
msgstr "Модуль \"%s\" уже имеется в сущности \"%s\"%sСтарый: %s%sНовый: %s%sУбедитесь, что в каталогах поиска модулей содержится только один из них.%s%sПродолжить?"
#: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus
#, object-pascal-format
msgid "There is already a unit with the name \"%s\". Pascal identifiers must be unique."
msgstr "Модуль с именем \"%s\" уже имеется. Идентификаторы Паскаля должны быть уникальны."
#: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose
#, object-pascal-format
msgid "There is a unit with the name \"%s\" in the project.%sPlease choose a different name"
msgstr "Модуль с именем \"%s\" уже имеется в проекте.%sВыберите другое имя"
#: lazarusidestrconsts.listhereisnofpcexeinthedirectoryofusuallythemakeexecu
#, object-pascal-format
msgid "There is no fpc.exe in the directory of %s. Usually the make executable is installed together with the FPC compiler."
msgstr "В каталоге с %s отсутствует fpc.exe. Обычно исполнимый файл make установлен вместе с компилятором FPC."
#: lazarusidestrconsts.listhereisnofreepascalcompileregfpcorppccpuconfigured
#, object-pascal-format
msgid "There is no Free Pascal Compiler (e. g. fpc%0:s or ppc<cpu>%0:s) configured in the project options. CodeTools will not work properly.%1:s%1:sError message:%1:s%2:s"
msgstr "В параметрах проекта не настроен компилятор Free Pascal (например, fpc%0:s либо ppc<cpu>%0:s). Подсистема CodeTools не будет правильно работать.%1:s%1:sСообщение об ошибке:%1:s%2:s"
#: lazarusidestrconsts.listheremustbeatleastonebuildmode
msgid "There must be at least one build mode."
msgstr "Должен иметься хотя бы один режим сборки."
#: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor
#, object-pascal-format
msgid "The resource class \"%s\" descends from \"%s\". Probably this is a typo for TForm."
msgstr "Ресурсный класс \"%s\" унаследован от \"%s\". Возможно, это опечатка в \"TForm\"."
#: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent
#, object-pascal-format
msgid "There was an error during writing the selected component %s:%s:%s%s"
msgstr "Произошла ошибка при записи выбранных компонентов %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe
#, object-pascal-format
msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s"
msgstr "Произошла ошибка при преобразовании двоичного потока выбранного компонента %s:%s:%s%s"
#: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli
#, object-pascal-format
msgid "There was an error while copying the component stream to clipboard:%s%s"
msgstr "Произошла ошибка при копировании потока компонента в буфер:%s%s"
#: lazarusidestrconsts.listherootcomponentcannotbedeleted
msgid "The root component cannot be deleted."
msgstr "Компонент верхнего уровня не может быть удалён."
#: lazarusidestrconsts.listhesefileswillbedeleted
msgid "These files will be deleted"
msgstr "Следующие файлы будут удалены"
#: lazarusidestrconsts.listhesesettingsarestoredwiththeproject
msgid "These settings are stored with the project."
msgstr "Эти параметры хранятся в проекте."
#: lazarusidestrconsts.listheseunitswerenotfound
msgid "These units were not found:"
msgstr "Эти модули не были найдены:"
#: lazarusidestrconsts.listhesourcesofthefreepascalpackagesarerequiredforbro
#, object-pascal-format
msgid "The sources of the Free Pascal packages are required for browsing and code completion. For example it has the file \"%s\"."
msgstr "Исходный код пакетов Free Pascal требуется для обеспечения работы функций навигации по коду и его завершения. Каталог с исходным кодом FPC содержит, например, файл \"%s\"."
#: lazarusidestrconsts.listhetargetdirectoryisafile
#, object-pascal-format
msgid "The target directory is a file:%s"
msgstr "Целевой каталог является файлом:%s"
#: lazarusidestrconsts.listhetargetfilenameisadirectory
msgid "The target file name is a directory."
msgstr "Целевой файл является каталогом."
#: lazarusidestrconsts.listhetargetisnotwritable
#, object-pascal-format
msgid "The target %s is not writable."
msgstr "Цель \"%s\" недоступна для записи."
#: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeideopt
#, object-pascal-format
msgid "The Test Directory could not be found:%s\"%s\"%s(see IDE options)"
msgstr "Каталог для сборки пробных проектов не найден:%s\"%s\"%s(проверьте параметры IDE)"
#: lazarusidestrconsts.listheunitalreadyexists
#, object-pascal-format
msgid "The unit \"%s\" already exists."
msgstr "Модуль \"%s\" уже существует."
#: lazarusidestrconsts.listheunitbelongstopackage
#, object-pascal-format
msgid "The unit belongs to package %s."
msgstr "Модуль принадлежит пакету %s."
#: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe
#, object-pascal-format
msgid "The unit %s exists twice in the unit path of the %s:"
msgstr "Модуль %s дублируется в путях к модулям %s:"
#: lazarusidestrconsts.listheunithasthisname
msgid "The unit has this name"
msgstr "Это имя уже имеет модуль"
#: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler
#, object-pascal-format
msgid "The unit filename \"%s\" is not lowercase.%sThe Free Pascal compiler does not search for all cases. It is recommended to use lowercase filename.%sRename file lowercase?"
msgstr "Имя файла \"%s\" модуля не в нижнем регистре.%sКомпилятор Free Pascal не проводит поиск для всех вариантов. Рекомендуется использовать имя в нижнем регистре.%sПереименовать файл?"
#: lazarusidestrconsts.listheunitispartofthefpcsourcesbutthecorrespondingfpd
#, object-pascal-format
msgid "The unit %s is part of the FPC sources but the corresponding fpdoc xml file was not found.%sEither you have not yet added the fpcdocs directory to the search path or the unit is not yet documented.%sThe fpdoc files for the FPC sources can be downloaded from: %s%sPlease add the directory in the fpdoc editor options.%sIn order to create a new file the directory must be writable."
msgstr "Модуль %s является частью исходного кода FPC, но соответствующий файл XML FPDoc не был найден.%sВероятно, вы не добавили каталог fpcdocs в список путей поиска, либо документация для модуля ещё не была написана.%sФайлы FPDoc для исходного кода FPC могут быть загружены по адресу: %s%sДобавьте каталог в диалоге параметров редактора FPDoc.%sДля создания нового файла каталог должен быть доступен для записи."
#: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic
#, object-pascal-format
msgid "The unit %s is used by other files.%sUpdate references automatically?"
msgstr "Модуль %s используется другими файлами.%sОбновить ссылки автоматически?"
#: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus
#, object-pascal-format
msgid "The unit itself has already the name \"%s\". Pascal identifiers must be unique."
msgstr "Сам модуль уже называется \"%s\". Идентификаторы Паскаля должны быть уникальны."
#: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac
#, object-pascal-format
msgid "The unit search path of \"%s\" contains the source directory \"%s\" of package %s"
msgstr "Путь поиска модулей \"%s\" содержит каталог исходного кода \"%s\" пакета %s"
#: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki
#, object-pascal-format
msgid "The working directory \"%s\" does not exist.%sPlease check the working directory in Menu > Run > Run parameters."
msgstr "Рабочий каталог \"%s\" не существует.%sПроверьте его в меню Запуск -> Параметры запуска."
#: lazarusidestrconsts.listhiscomponentalreadycontainsaclasswiththename
#, object-pascal-format
msgid "This component already contains a class with the name %s."
msgstr "Этот компонент уже содержит класс с именем %s."
#: lazarusidestrconsts.listhisfunctionneedsanopenlfmfileinthesourceeditor
msgid "This function needs an open .lfm file in the source editor."
msgstr "Эта функция требует наличия открытого файла .lfm в редакторе исходного кода."
#: lazarusidestrconsts.listhishelpmessage
msgid "This help message."
msgstr "Это справочное сообщение."
#: lazarusidestrconsts.listhisistestprojectfordesigntimepackage
msgid "This is a test project for a design time package, testing it outside the IDE."
msgstr "Тестовый проект для проверки пакета времени разработки вне IDE"
#: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc
#, object-pascal-format
msgid "This looks like a Pascal file.%sIt is recommended to use lower case filenames to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?"
msgstr "Содержимое этого файла похоже на исходный код на Паскале.%sРекомендуется использовать имена файлов в нижнем регистре во избежание различных проблем на некоторых файловых системах и с разными компиляторами.%sПереименовать в нижний регистр?"
#: lazarusidestrconsts.listhisprojecthasnomainsourcefile
msgid "This project has no main source file"
msgstr "Этот проект не имеет главного файла исходного хода"
#: lazarusidestrconsts.listhisprojecthasonlythedefaultbuildmode
msgid "This project has only the default build mode."
msgstr "Этот проект имеет только режим сборки по умолчанию."
#: lazarusidestrconsts.listhissetofoptionstobuildlazarusisnotsupportedbythis
#, object-pascal-format
msgid "This set of options to build Lazarus is not supported by this installation.%sThe directory \"%s\" is not writable.%sSee the Lazarus website for other ways to install Lazarus."
msgstr "Этот набор параметров сборки Lazarus не поддерживается установленным экземпляром.%sКаталог \"%s\" недоступен для записи.%sДругие методы установки смотрите на сайте Lazarus."
#: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode
#, object-pascal-format
msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method."
msgstr "Это выражение не может быть извлечено.%sВыберите какой-то код, чтобы извлечь новую процедуру/метод."
#: lazarusidestrconsts.listhiswillallowchangingallbuildmodesatoncenotimpleme
msgid "This will allow changing all build modes at once. Not implemented yet."
msgstr "Действие позволит вносить изменения во все режимы сборки сразу. Ещё не реализовано."
#: lazarusidestrconsts.listhiswillcreateacirculardependency
msgid "This will create a circular dependency."
msgstr "Это действие создаст порочный круг зависимостей."
#: lazarusidestrconsts.listhiswillputalotoftextontheclipboardproceed
#, object-pascal-format
msgid "This will put a lot of text (%s) on the clipboard.%sProceed?"
msgstr "Это действие поместит большое количество текста (%s) в буфер обмена.%sПродолжить?"
#: lazarusidestrconsts.listitle
msgid "&Title"
msgstr "&Заголовок"
#: lazarusidestrconsts.listitleintaskbarshowsforexampleproject1lpilazarus
msgid "Show the custom IDE title before the IDE's name and other info in the title. Example: project1 - Lazarus."
msgstr "Показывать пользовательский заголовок перед именем IDE и иными сведениями. Пример: project1 - Lazarus."
#: lazarusidestrconsts.listitleleaveemptyfordefault
msgid "Title (leave empty for default)"
msgstr "Название (оставьте пустым для значения по умолчанию)"
#: lazarusidestrconsts.listofpcpath
msgid "Path:"
msgstr "Путь:"
#: lazarusidestrconsts.listoolbarconfiguration
msgid "Toolbar Configuration"
msgstr "Настройка инструментальной панели"
#: lazarusidestrconsts.listoolhasnoexecutable
#, object-pascal-format
msgid "tool \"%s\" has no executable"
msgstr "средство \"%s\" не имеет исполнимого файла"
#: lazarusidestrconsts.listoolheaderfailed
msgid "Tool Header: Failed"
msgstr "Заголовок средства: завершение с ошибкой"
#: lazarusidestrconsts.listoolheaderrunning
msgid "Tool Header: Running"
msgstr "Заголовок средства: исполнение"
#: lazarusidestrconsts.listoolheaderscrolledup
msgid "Tool Header: Scrolled up"
msgstr "Заголовок средства: прокрученный вывод"
#: lazarusidestrconsts.listoolheadersuccess
msgid "Tool Header: Success"
msgstr "Заголовок средства: успешное завершение"
#: lazarusidestrconsts.listoolstoppedwithexitcodeusecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with exit code %s. Use context menu to get more information."
msgstr "средство завершило работу с кодом %s. Для получения дополнительных сведений воспользуйтесь контекстным меню."
#: lazarusidestrconsts.listoolstoppedwithexitstatususecontextmenutogetmoreinfo
#, object-pascal-format
msgid "tool stopped with ExitCode 0 and ExitStatus %s. Use context menu to get more information."
msgstr "средство завершило работу с кодом 0 и состоянием %s. Для получения дополнительных сведений воспользуйтесь контекстным меню."
#: lazarusidestrconsts.listop
msgctxt "lazarusidestrconsts.listop"
msgid "Top"
msgstr "Сверху"
#: lazarusidestrconsts.listopanchoring
msgid "Top anchoring"
msgstr "Верхняя привязка"
#: lazarusidestrconsts.listopborderspacespinedithint
msgid "Top borderspace. This value is added to base borderspace and used for the space above the control."
msgstr "Верхний зазор. Его значение добавляется к базовуму зазору и используется для определения пространства над компонентом."
#: lazarusidestrconsts.listopinfoview
msgid "Show Class/Procedure hint"
msgstr "Показывать текущие класс/процедуру"
#: lazarusidestrconsts.listops
msgid "Tops"
msgstr "Верхние края"
#: lazarusidestrconsts.listopsiblingcomboboxhint
msgid "This is the sibling control to which the top side is anchored. Leave empty for anchoring to parent in Delphi style (BorderSpacing and ReferenceSide do not matter)."
msgstr "Это сосед, к которому привязывается верхняя граница. Оставьте пустым для привязки к родителю в стиле Delphi (BorderSpacing и ReferenceSide не имеют значения)."
#: lazarusidestrconsts.listopspaceequally
msgid "Top space equally"
msgstr "Равномерно по верхним краям"
#: lazarusidestrconsts.listotalpages
#, object-pascal-format
msgid "Total Pages: %s"
msgstr "Всего вкладок: %s"
#: lazarusidestrconsts.listranslatetheenglishmessages
msgid "Translate the English Messages"
msgstr "Переводить сообщения с английского"
#: lazarusidestrconsts.listreeneedsrefresh
msgid "Tree needs refresh"
msgstr "Дерево требует обновления"
#: lazarusidestrconsts.listwomovedfileswillhavethesamefilenamein
#, object-pascal-format
msgid "Two moved files will have the same file name:%s%s%s%s%sin %s"
msgstr "Два перемещённых файла будут иметь одно и то же имя:%s%s%s%s%sв сущности \"%s\""
#: lazarusidestrconsts.listypes
msgid "Types (not removed if no replacement)"
msgstr "Типы (не удаляются, если нет замены)"
#: lazarusidestrconsts.lisudadditionaldirectories
msgid "Additional directories:"
msgstr "Дополнительные каталоги:"
#: lazarusidestrconsts.lisudallpackageunits
msgid "All package units"
msgstr "Все модули пакета"
#: lazarusidestrconsts.lisudallsourceeditorunits
msgid "All source editor units"
msgstr "Все модули в редакторе исходного кода"
#: lazarusidestrconsts.lisudallunits
msgid "All units"
msgstr "Все модули"
#: lazarusidestrconsts.lisudbydefaultonlytheprojectunitsandthesourceeditorunit
msgid "By default only the project units and the source editor units are searched. Add here a list of directories separated by semicolon to search as well."
msgstr "По умолчанию поиск происходит только в модулях проекта, а также в модулях, открытых в редакторе исходного кода. Добавьте здесь список каталогов, разделённых точками с запятой, чтобы искать также в них."
#: lazarusidestrconsts.lisudcollapseallnodes
msgid "Collapse all nodes"
msgstr "Свернуть все элементы"
#: lazarusidestrconsts.lisudexpandallnodes
msgid "Expand all nodes"
msgstr "Развернуть все элементы"
#: lazarusidestrconsts.lisudfile
#, object-pascal-format
msgid "File: %s"
msgstr "Файл: %s"
#: lazarusidestrconsts.lisudfilter
msgid "(Filter)"
msgstr "(Фильтр)"
#: lazarusidestrconsts.lisudimplementationuses
#, object-pascal-format
msgid "Implementation Uses: %s"
msgstr "Выражение Uses секции Implementation: %s"
#: lazarusidestrconsts.lisudimplementationuses2
#, object-pascal-format
msgid "implementation uses: %s"
msgstr "выражение Uses секции Implementation: %s"
#: lazarusidestrconsts.lisudinterfaceuses
#, object-pascal-format
msgid "Interface Uses: %s"
msgstr "Выражение Uses секции Interface: %s"
#: lazarusidestrconsts.lisudinterfaceuses2
#, object-pascal-format
msgid "interface uses: %s"
msgstr "выражение Uses секции Interface: %s"
#: lazarusidestrconsts.lisudprojectsandpackages
msgid "Projects and packages"
msgstr "Проекты и пакеты"
#: lazarusidestrconsts.lisudscanning
msgid "Scanning ..."
msgstr "Идёт поиск ..."
#: lazarusidestrconsts.lisudscanningunits
#, object-pascal-format
msgid "Scanning: %s units ..."
msgstr "Идёт поиск: %s модулей ..."
#: lazarusidestrconsts.lisudsearch
msgid "(Search)"
msgstr "(Поиск)"
#: lazarusidestrconsts.lisudsearchnextoccurrenceofthisphrase
msgid "Find next occurrence of this phrase"
msgstr "Найти следующий экземпляр фразы"
#: lazarusidestrconsts.lisudsearchnextunitofthisphrase
msgid "Find next unit with this phrase"
msgstr "Найти следующий модуль с этой фразой"
#: lazarusidestrconsts.lisudsearchpreviousoccurrenceofthisphrase
msgid "Find previous occurrence of this phrase"
msgstr "Найти предыдущий экземпляр фразы"
#: lazarusidestrconsts.lisudsearchpreviousunitofthisphrase
msgid "Find previous unit with this phrase"
msgstr "Найти предыдущий модуль с этой фразой"
#: lazarusidestrconsts.lisudselectedunits
msgid "Selected units"
msgstr "Выбранные модули"
#: lazarusidestrconsts.lisudshownodesfordirectories
msgid "Show nodes for directories"
msgstr "Показывать элементы каталогов"
#: lazarusidestrconsts.lisudshownodesforprojectandpackages
msgid "Show nodes for project and packages"
msgstr "Показывать элементы проектов и пакетов"
#: lazarusidestrconsts.lisudunits
msgid "Units"
msgstr "Модули"
#: lazarusidestrconsts.lisudunits2
#, object-pascal-format
msgid "Units: %s"
msgstr "Модулей: %s"
#: lazarusidestrconsts.lisudusedbyimplementations
#, object-pascal-format
msgid "Used by Implementations: %s"
msgstr "Используется секциями Implementation: %s"
#: lazarusidestrconsts.lisudusedbyimplementations2
#, object-pascal-format
msgid "used by implementations: %s"
msgstr "используется секциями Implementation: %s"
#: lazarusidestrconsts.lisudusedbyinterfaces
#, object-pascal-format
msgid "Used by Interfaces: %s"
msgstr "Используется секциями Interface: %s"
#: lazarusidestrconsts.lisudusedbyinterfaces2
#, object-pascal-format
msgid "used by interfaces: %s"
msgstr "используется секциями Interface: %s"
#: lazarusidestrconsts.lisuedonotsho
msgid "Do not show this message again."
msgstr "Не показывать это сообщение снова."
#: lazarusidestrconsts.lisueerrorinregularexpression
msgid "Error in regular expression"
msgstr "Ошибка в регулярном выражении"
#: lazarusidestrconsts.lisuefontwith
msgid "Font without UTF-8"
msgstr "Шрифт без UTF-8"
#: lazarusidestrconsts.lisuegotoline
msgid "Goto line:"
msgstr "Перейти к строке:"
#: lazarusidestrconsts.lisuemodeseparator
msgid "/"
msgstr "/"
#: lazarusidestrconsts.lisuenotfound
msgid "Not found"
msgstr "Не найден"
#: lazarusidestrconsts.lisuereplacethisoccurrenceofwith
#, object-pascal-format
msgid "Replace this occurrence of \"%s\"%s with \"%s\"?"
msgstr "Заменить \"%s\"%s на \"%s\" в этом месте?"
#: lazarusidestrconsts.lisuesearching
#, object-pascal-format
msgid "Searching: %s"
msgstr "Поиск: %s"
#: lazarusidestrconsts.lisuesearchstringcontinuebeg
msgid "Continue search from the beginning?"
msgstr "Продолжить поиск с начала?"
#: lazarusidestrconsts.lisuesearchstringcontinueend
msgid "Continue search from the end?"
msgstr "Продолжить поиск с конца?"
#: lazarusidestrconsts.lisuesearchstringnotfound
#, object-pascal-format
msgid "Search string '%s' not found!"
msgstr "Искомая строка '%s' не найдена!"
#: lazarusidestrconsts.lisuethecurre
#, object-pascal-format
msgid "The current editor font does not support UTF-8 but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrectly.%sYou can select another font in the editor options."
msgstr "Текущий шрифт редактора не поддерживает UTF-8, но ваша система, вероятно, её использует.%sЭто означает, что символы, не входящие в ASCII, могут отображаться неверно.%sВы можете выбрать другой шрифт в параметрах редактора."
#: lazarusidestrconsts.lisuiclearincludedbyreference
msgid "Clear include cache"
msgstr "Очистить кэш включаемых файлов"
#: lazarusidestrconsts.lisuidbytes
#, object-pascal-format
msgid "%s bytes"
msgstr "%s байт"
#: lazarusidestrconsts.lisuidincludedby
msgid "Included by:"
msgstr "Включён:"
#: lazarusidestrconsts.lisuidinproject
msgid "In project:"
msgstr "В проекте:"
#: lazarusidestrconsts.lisuidlines
msgctxt "lazarusidestrconsts.lisuidlines"
msgid "Lines:"
msgstr "Строк:"
#: lazarusidestrconsts.lisuidname
msgctxt "lazarusidestrconsts.lisuidname"
msgid "Name:"
msgstr "Имя:"
#: lazarusidestrconsts.lisuidno
msgid "no"
msgstr "нет"
#: lazarusidestrconsts.lisuidsize
msgid "Size:"
msgstr "Размер:"
#: lazarusidestrconsts.lisuidtype
msgid "Type:"
msgstr "Тип:"
#: lazarusidestrconsts.lisuidyes
msgid "yes"
msgstr "да"
#: lazarusidestrconsts.lisuishowcodetoolsvalues
msgid "Show CodeTools Values"
msgstr "Показать значения CodeTools"
#: lazarusidestrconsts.lisunableconvertbinarystreamtotext
msgid "Unable convert binary stream to text"
msgstr "Невозможно преобразовать двоичный поток в текст"
#: lazarusidestrconsts.lisunablecopycomponentstoclipboard
msgid "Unable copy components to clipboard"
msgstr "Невозможно скопировать компоненты в буфер обмена"
#: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile
#, object-pascal-format
msgid "Unable to add resource header comment to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Невозможно добавить комментарий заголовка ресурса в файл ресурсов %s\"%s\".%sВозможно, синтаксическая ошибка."
#: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably
#, object-pascal-format
msgid "Unable to add resource T%s:FORMDATA to resource file %s\"%s\".%sProbably a syntax error."
msgstr "Невозможно добавить ресурс T%s:FORMDATA в файл ресурсов %s\"%s\".%sВозможно, синтаксическая ошибка."
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethepackagehasalread
#, object-pascal-format
msgid "Unable to add the dependency %s because the package %s has already a dependency %s"
msgstr "Невозможно добавить зависимость %s, так как пакет %s уже имеет зависимость %s"
#: lazarusidestrconsts.lisunabletoaddthedependencybecausethiswouldcreatea
#, object-pascal-format
msgid "Unable to add the dependency %s because this would create a circular dependency. Dependency %s"
msgstr "Невозможно добавить зависимость %s, так как это создаст порочный круг. Зависимость %s"
#: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith
#, object-pascal-format
msgid "Unable to add %s to project because there is already a unit with the same name in the Project."
msgstr "Невозможно добавить %s к проекту, так как в проекте уже есть модуль с таким именем."
#: lazarusidestrconsts.lisunabletobackupfileto
#, object-pascal-format
msgid "Unable to backup file \"%s\" to \"%s\"!"
msgstr "Для файла \"%s\" невозможно создать резервную копию \"%s\"!"
#: lazarusidestrconsts.lisunabletochangeclassofto
#, object-pascal-format
msgid "%s%sUnable to change class of %s to %s"
msgstr "%s%sНевозможно изменить класс %s на %s"
#: lazarusidestrconsts.lisunabletochangeprojectscaledinsource
#, object-pascal-format
msgid "Unable to change project scaled in source.%s%s"
msgstr "Невозможно изменить свойство Scaled проекта в исходном коде.%s%s"
#: lazarusidestrconsts.lisunabletochangeprojecttitleinsource
#, object-pascal-format
msgid "Unable to change project title in source.%s%s"
msgstr "Невозможно изменить заголовок проекта в исходном коде.%s%s"
#: lazarusidestrconsts.lisunabletocleanupdestinationdirectory
msgid "Unable to clean up destination directory"
msgstr "Невозможно очистить каталог назначения"
#: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions
#, object-pascal-format
msgid "Unable to clean up \"%s\".%sPlease check permissions."
msgstr "Невозможно очистить \"%s\".%sПроверьте права доступа."
#: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat
#, object-pascal-format
msgid "Unable to convert component text into binary format:%s%s"
msgstr "Невозможно преобразовать текст компонента в двоичный формат:%s%s"
#: lazarusidestrconsts.lisunabletoconvertfileerror
#, object-pascal-format
msgid "Unable to convert file \"%s\"%sError: %s"
msgstr "Невозможно преобразовать файл \"%s\"%sОшибка: %s"
#: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream
#, object-pascal-format
msgid "Unable to convert text form data of file %s\"%s\"%sinto binary stream. (%s)"
msgstr "Невозможно преобразовать текстовые данные формы файла %s\"%s\"%sв двоичный поток. (%s)"
#: lazarusidestrconsts.lisunabletoconverttoencoding
#, object-pascal-format
msgid "Unable to convert to encoding \"%s\""
msgstr "Невозможно провести преобразование в кодировку \"%s\""
#: lazarusidestrconsts.lisunabletocreatenewfilebecausethereisalreadyadirecto
msgid "Unable to create new file because there is already a directory with this name."
msgstr "Невозможно создать новый файл, так как уже имеется каталог с таким именем."
#: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer
msgid "Unable to create temporary lfm buffer."
msgstr "Невозможно создать временный буфер LFM"
#: lazarusidestrconsts.lisunabletodeleteambiguousfile
#, object-pascal-format
msgid "Unable to delete ambiguous file \"%s\""
msgstr "Невозможно удалить файл с дублирующимся именем \"%s\""
#: lazarusidestrconsts.lisunabletoexecute
#, object-pascal-format
msgid "unable to execute: %s"
msgstr "ошибка процесса исполнения: %s"
#: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe
msgid "Unable to find a ResourceString section in this or any of the used units."
msgstr "Невозможно найти секцию ResourceString в этом или любом другом используемом модуле."
#: lazarusidestrconsts.lisunabletofindavalidclassnamein
#, object-pascal-format
msgid "Unable to find a valid classname in \"%s\""
msgstr "Невозможно найти правильное имя класса в \"%s\""
#: lazarusidestrconsts.lisunabletofindfile
#, object-pascal-format
msgid "Unable to find file \"%s\"."
msgstr "Невозможно найти файл \"%s\"."
#: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption
#, object-pascal-format
msgid "Unable to find file \"%s\".%sIf it belongs to your project, check search path in%sProject -> Compiler Options -> Search Paths -> Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to Lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions -> Test"
msgstr "Невозможно найти файл \"%s\".%sЕсли он принадлежит вашему проекту, проверьте пути поиска в%sПроект -> Параметры компилятора -> Пути -> Другие модули. Если он принадлежит пакету, проверьте соответствующие параметры компиляции пакета. Если этот файл принадлежит Lazarus, удостоверьтесь, что компилируете его после очистки. Если файл принадлежит FPC, проверьте fpc.cfg. Если не уверены, вызовите Проект -> Параметры компилятора -> Тест"
#: lazarusidestrconsts.lisunabletofindinlfmstream
#, object-pascal-format
msgid "Unable to find %s in LFM Stream."
msgstr "Невозможно найти %s в потоке LFM"
#: lazarusidestrconsts.lisunabletofindmethod
msgid "Unable to find method."
msgstr "Невозможно найти метод."
#: lazarusidestrconsts.lisunabletofindpascalunitpasppforlfmfile
#, object-pascal-format
msgid "Unable to find Pascal unit (.pas, .pp) for .lfm file%s\"%s\""
msgstr "Невозможно найти модуль Паскаля (.pas, .pp) для файла .lfm%s\"%s\""
#: lazarusidestrconsts.lisunabletofindthecomponentclassitisnotregisteredviar
#, object-pascal-format
msgid "Unable to find the component class \"%s\".%sIt is not registered via RegisterClass and no lfm was found.%sIt is needed by unit:%s%s"
msgstr "Невозможно найти класс компонента \"%s\".%sОн не зарегистрирован посредством RegisterClass, а соответствующий файл LFM отсутствует.%sТребуется для модуля:%s%s"
#: lazarusidestrconsts.lisunabletogathereditorchanges
msgid "Unable to gather editor changes."
msgstr "Невозможно определить изменения в редакторе."
#: lazarusidestrconsts.lisunabletogetsourcefordesigner
msgid "Unable to get source for designer."
msgstr "Невозможно получить исходный код для редактора форм."
#: lazarusidestrconsts.lisunabletoloadfile2
#, object-pascal-format
msgid "unable to load file %s: %s"
msgstr "невозможно загрузить файл %s: %s"
#: lazarusidestrconsts.lisunabletoloadpackage
#, object-pascal-format
msgid "Unable to load package \"%s\""
msgstr "Невозможно загрузить пакет \"%s\""
#: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits
#, object-pascal-format
msgid "Unable to load the component class \"%s\" because it depends on itself."
msgstr "Невозможно загрузить класс компонента \"%s\", так как он зависит сам от себя."
#: lazarusidestrconsts.lisunabletoopen
#, object-pascal-format
msgid "Unable to open \"%s\""
msgstr "Невозможно открыть \"%s\""
#: lazarusidestrconsts.lisunabletoopenancestorcomponent
msgid "Unable to open ancestor component"
msgstr "Невозможно открыть компонент-предок"
#: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades
#, object-pascal-format
msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule."
msgstr "Невозможно открыть редактор форм. %sКласс %s не унаследован от класса, подобного TForm или TDataModule."
#: lazarusidestrconsts.lisunabletoread
#, object-pascal-format
msgid "Unable to read %s"
msgstr "Невозможно прочитать %s"
#: lazarusidestrconsts.lisunabletoreadprocessexitstatus
msgid "unable to read process ExitStatus"
msgstr "невозможно прочитать код завершения процесса"
#: lazarusidestrconsts.lisunabletoremoveoldbackupfile
#, object-pascal-format
msgid "Unable to remove old backup file \"%s\"!"
msgstr "Невозможно удалить старый файл резервной копии \"%s\"!"
#: lazarusidestrconsts.lisunabletoremoveprojectscaledfromsource
#, object-pascal-format
msgid "Unable to remove project scaled from source.%s%s"
msgstr "Невозможно удалить свойство Scaled проекта из исходного кода.%s%s"
#: lazarusidestrconsts.lisunabletoremoveprojecttitlefromsource
#, object-pascal-format
msgid "Unable to remove project title from source.%s%s"
msgstr "Невозможно удалить заголовок проекта из исходного кода.%s%s"
#: lazarusidestrconsts.lisunabletorenameambiguousfileto
#, object-pascal-format
msgid "Unable to rename ambiguous file \"%s\"%sto \"%s\""
msgstr "Невозможно переименовать файл с дублирующимся именем \"%s\"%sв \"%s\""
#: lazarusidestrconsts.lisunabletorenameforminsource
msgid "Unable to rename form in source."
msgstr "Невозможно переименовать форму в исходном коде."
#: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag
msgid "Unable to rename method. Please fix the error shown in the message window."
msgstr "Невозможно переименовать метод. Исправьте ошибку в окне сообщений."
#: lazarusidestrconsts.lisunabletorenamevariableinsource
msgid "Unable to rename variable in source."
msgstr "Невозможно переименовать переменную в исходном коде."
#: lazarusidestrconsts.lisunabletorun
msgid "Unable to run"
msgstr "Запуск невозможен"
#: lazarusidestrconsts.lisunabletorun2
#, object-pascal-format
msgid "Unable to run \"%s\""
msgstr "Невозможно запустить \"%s\""
#: lazarusidestrconsts.lisunabletosetanchorsidecontrol
msgid "Unable to set AnchorSide Control"
msgstr "Невозможно установить привязку к компоненту"
#: lazarusidestrconsts.lisunabletoshowmethod
msgid "Unable to show method."
msgstr "Невозможно отобразить метод."
#: lazarusidestrconsts.lisunabletostreamselectedcomponents
msgid "Unable to stream selected components"
msgstr "Невозможно вывести выбранные компоненты в поток"
#: lazarusidestrconsts.lisunabletostreamselectedcomponents2
msgid "Unable to stream selected components."
msgstr "Невозможно вывести выбранные компоненты в поток."
#: lazarusidestrconsts.lisunabletostreamt
#, object-pascal-format
msgid "Unable to stream %s:T%s."
msgstr "Невозможно вывести в поток %s:T%s."
#: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext
#, object-pascal-format
msgid "Unable to transform binary component stream of %s:T%s into text."
msgstr "Невозможно преобразовать двоичный поток компонентов %s:T%s в текст."
#: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource
msgid "Unable to update CreateForm statement in project source"
msgstr "Невозможно обновить выражение CreateForm в исходном коде проекта"
#: lazarusidestrconsts.lisuncheckall
msgid "Uncheck All"
msgstr "Снять отметку со всех"
#: lazarusidestrconsts.lisundo
msgctxt "lazarusidestrconsts.lisundo"
msgid "Undo"
msgstr "Отменить"
#: lazarusidestrconsts.lisuninstall
#, object-pascal-format
msgid "Uninstall %s"
msgstr "Удалить %s"
#: lazarusidestrconsts.lisuninstallfail
msgid "Uninstall failed"
msgstr "Ошибка при удалении"
#: lazarusidestrconsts.lisuninstallimpossible
msgid "Uninstall impossible"
msgstr "Удаление невозможно"
#: lazarusidestrconsts.lisuninstallselection
msgid "Uninstall selection"
msgstr "Удалить выбранное"
#: lazarusidestrconsts.lisuninstallthemtoo
msgid "Uninstall them too"
msgstr "Удалить их тоже"
#: lazarusidestrconsts.lisunithaschangedsave
#, object-pascal-format
msgid "Unit \"%s\" has changed. Save?"
msgstr "Модуль \"%s\" был изменён. Сохранить?"
#: lazarusidestrconsts.lisunitidentifierexists
msgid "Unit identifier exists"
msgstr "Идентификатор модуля существует"
#: lazarusidestrconsts.lisunitinpackage
#, object-pascal-format
msgid "%s unit %s in package %s"
msgstr "%s Модуль %s в пакете %s"
#: lazarusidestrconsts.lisunitmustsavebeforeinherit
#, object-pascal-format
msgid "Unit \"%s\" must be saved before it can be inherited from. Save now?"
msgstr "Перед наследованием от модуля \"%s\" его требуется сохранить. Сделать это сейчас?"
#: lazarusidestrconsts.lisunitnamealreadyexistscap
msgid "Unitname already in project"
msgstr "Модуль с таким именем уже имеется в проекте"
#: lazarusidestrconsts.lisunitnamebeginswith
msgid "Unit name begins with ..."
msgstr "Имя модуля начинается с ..."
#: lazarusidestrconsts.lisunitnamecontains
msgid "Unit name contains ..."
msgstr "Имя модуля содержит ..."
#: lazarusidestrconsts.lisunitnotfound
#, object-pascal-format
msgid "unit %s not found"
msgstr "модуль %s не найден"
#: lazarusidestrconsts.lisunitnotfoundatnewposition
#, object-pascal-format
msgid "unit %s not found at new position \"%s\""
msgstr "модуль %s не найден по новому местонахождению \"%s\""
#: lazarusidestrconsts.lisunitnotfoundinfile
#, object-pascal-format
msgid "A unit not found in file %s"
msgstr "Не найден модуль в файле %s"
#: lazarusidestrconsts.lisunitoutputdirectory
msgid "Unit Output directory"
msgstr "Каталог вывода модулей"
#: lazarusidestrconsts.lisunitpath
msgid "unit path"
msgstr "пути к модулям"
#: lazarusidestrconsts.lisunitpaths
msgid "Unit paths"
msgstr "Пути к модулям"
#: lazarusidestrconsts.lisunitrequirespackage
#, object-pascal-format
msgid "unit %s requires package %s"
msgstr "модуль %s требует пакет %s"
#: lazarusidestrconsts.lisunitsnotfoundinfile
#, object-pascal-format
msgid "Units not found in file %s"
msgstr "Не найдены модули в файле %s"
#: lazarusidestrconsts.lisunusedunitsof
#, object-pascal-format
msgid "Unused units of %s"
msgstr "Неиспользуемые модули в %s"
#: lazarusidestrconsts.lisunusualcompilerfilenameusuallyitstartswithfpcppcor
msgid "Unusual compiler file name. Usually it starts with fpc, ppc or ppcross."
msgstr "Необычное имя файла компилятора. Как правило, оно начинается с fpc, ppc либо ppcross."
#: lazarusidestrconsts.lisunusualpas2jscompilerfilenameusuallyitstartswithpa
msgid "Unusual pas2js compiler file name. Usually it starts with pas2js."
msgstr "Необычное имя файла компилятора pas2js. Как правило, оно начинается с pas2js."
#: lazarusidestrconsts.lisup
msgctxt "lazarusidestrconsts.lisup"
msgid "Up"
msgstr "Вверх"
#: lazarusidestrconsts.lisupdateapplicationcreateform
msgid "Update Application.CreateForm statements in main unit"
msgstr "Обновлять выражения Application.CreateForm в главном модуле"
#: lazarusidestrconsts.lisupdateapplicationscaledstatement
msgid "Update Application.Scaled statement in main unit"
msgstr "Обновлять выражение Application.Scaled в главном модуле"
#: lazarusidestrconsts.lisupdateapplicationtitlestatement
msgid "Update Application.Title statement in main unit"
msgstr "Обновлять выражение Application.Title в главном модуле"
#: lazarusidestrconsts.lisupdateinfo
msgid "Update info"
msgstr "Обновить данные"
#: lazarusidestrconsts.lisupdateotherproceduresignatureswhenonlylettercaseha
msgid "Update other procedure signatures when only letter case has changed"
msgstr "Обновлять остальные сигнатуры процедур даже при изменении регистра"
#: lazarusidestrconsts.lisupdatereferences
msgid "Update references?"
msgstr "Обновить ссылки?"
#: lazarusidestrconsts.lisupgrade
msgid "Upgrade"
msgstr "Обновить"
#: lazarusidestrconsts.lisupgradeconfiguration
msgid "Upgrade configuration"
msgstr "Обновление каталога настройки"
#: lazarusidestrconsts.lisuppercasestring
msgid "uppercase string"
msgstr "Преобразовать регистр строки в верхний"
#: lazarusidestrconsts.lisuppercasestringgivenasparameter
msgid "Uppercase string given as parameter."
msgstr "Преобразовать регистр строки, переданной в качестве параметра, в верхний."
#: lazarusidestrconsts.lisurlonwikithebaseurlis
#, object-pascal-format
msgid "URL on wiki (the base url is %s)"
msgstr "Адрес страницы Wiki (базовый - %s)"
#: lazarusidestrconsts.lisusagemessagehoption
msgid "Usage message (-h option)"
msgstr "Сообщение со справкой (параметр -h)"
#: lazarusidestrconsts.lisuse
msgid "Use"
msgstr "Использовать"
#: lazarusidestrconsts.lisuseansistrings
msgctxt "lazarusidestrconsts.lisuseansistrings"
msgid "Use Ansistrings"
msgstr "Использовать строки Ansistring"
#: lazarusidestrconsts.lisusecheckboxforbooleanvalues
msgid "Use CheckBox for Boolean values"
msgstr "Отображать флажок для логических значений"
#: lazarusidestrconsts.lisusecommentsincustomoptions
msgid "Use comments in custom options"
msgstr "Комментарии в параметрах пользователя"
#: lazarusidestrconsts.lisusedby
#, object-pascal-format
msgid " used by %s"
msgstr ", используемый в %s"
#: lazarusidestrconsts.lisusedesigntimepackages
msgid "Use design time packages"
msgstr "Использовать пакеты времени разработки"
#: lazarusidestrconsts.lisusedforautocreatedforms
msgid "Used for auto-created forms."
msgstr "Используется для автоматически создаваемых форм"
#: lazarusidestrconsts.lisusefilterforextrafiles
msgid "Use filter to include extra files"
msgstr "Использовать фильтр для добавления дополнительных файлов"
#: lazarusidestrconsts.lisuseidentifier
msgid "Use identifier"
msgstr "Использовать идентификатор"
#: lazarusidestrconsts.lisuseidentifierinat
#, object-pascal-format
msgid "Use identifier %s in %s at %s"
msgstr "Использовать идентификатор %s в %s (%s)"
#: lazarusidestrconsts.lisuselaunchingapplicationgroupbox
msgid "Launching application"
msgstr "Запускающее приложение"
#: lazarusidestrconsts.lisusepackageinpackage
#, object-pascal-format
msgid "Use package %s in package %s"
msgstr "Использовать пакет %s в пакете %s"
#: lazarusidestrconsts.lisusepackageinpackage2
msgid "Use package in package"
msgstr "Использовать пакет в пакете"
#: lazarusidestrconsts.lisusepackageinproject
#, object-pascal-format
msgid "Use package %s in project"
msgstr "Использовать пакет %s в проекте"
#: lazarusidestrconsts.lisusepackageinproject2
msgid "Use package in project"
msgstr "Использовать пакет в проекте"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyadd
#, object-pascal-format
msgid "Add to list \"%s\""
msgstr "Добавить в список \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeygroup
msgctxt "lazarusidestrconsts.lisuserdefinedmarkupkeygroup"
msgid "User defined text markup"
msgstr "Пользовательская разметка текста"
#: lazarusidestrconsts.lisuserdefinedmarkupkeyremove
#, object-pascal-format
msgid "Remove from list \"%s\""
msgstr "Удалить из списка \"%s\""
#: lazarusidestrconsts.lisuserdefinedmarkupkeytoggle
#, object-pascal-format
msgid "Toggle on list \"%s\""
msgstr "Переключить для списка \"%s\""
#: lazarusidestrconsts.lisusershomedirectory
msgid "User's home directory"
msgstr "Домашний каталог пользователя"
#: lazarusidestrconsts.lisuseunit
msgctxt "lazarusidestrconsts.lisuseunit"
msgid "Add Unit to Uses Section"
msgstr "Добавить модуль в выражение Uses"
#: lazarusidestrconsts.lisuseunitinunit
#, object-pascal-format
msgid "Use unit %s in unit %s"
msgstr "Использовать модуль %s в модуле %s"
#: lazarusidestrconsts.lisutf8withbom
msgid "UTF-8 with BOM"
msgstr "UTF-8 с BOM"
#: lazarusidestrconsts.lisvalue
msgctxt "lazarusidestrconsts.lisvalue"
msgid "Value"
msgstr "Значение"
#: lazarusidestrconsts.lisvalue2
#, object-pascal-format
msgid "Value%s"
msgstr "Значение%s"
#: lazarusidestrconsts.lisvalue3
msgid "Value: "
msgstr "Значение: "
#: lazarusidestrconsts.lisvalues
msgid "Values"
msgstr "Значения"
#: lazarusidestrconsts.lisvaluesthatarechangedfromdefault
msgid "Values that are changed from the default are stored in .lfm file and are shown differently in Object Inspector."
msgstr "Значения свойств, не равные их значениям по умолчанию, сохраняются в файле .lfm и выделяются в инспекторе объектов"
#: lazarusidestrconsts.lisvariable
msgctxt "lazarusidestrconsts.lisvariable"
msgid "Variable"
msgstr "Переменная"
#: lazarusidestrconsts.lisverbose
msgctxt "lazarusidestrconsts.lisverbose"
msgid "Verbose"
msgstr "Подробное"
#: lazarusidestrconsts.lisverifymethodcalls
msgid "Verify method calls"
msgstr "Вызовов методов"
#: lazarusidestrconsts.lisversion
msgid "Version"
msgstr "Версия"
#: lazarusidestrconsts.lisversionmismatch
msgid "Version mismatch"
msgstr "Версии не соответствуют"
#: lazarusidestrconsts.lisvertical
msgid "Vertical"
msgstr "По вертикали"
#: lazarusidestrconsts.lisvertoclipboard
msgid "Copy version information to clipboard"
msgstr "Копировать сведения о версии в буфер обмена"
#: lazarusidestrconsts.lisveryverbose
msgid "Very Verbose"
msgstr "Очень подробное"
#: lazarusidestrconsts.lisviewsourcelfm
msgid "View Source (.lfm)"
msgstr "Показать исходный текст (.lfm)"
#: lazarusidestrconsts.liswarning
msgid "Warning: "
msgstr "Предупреждение: "
#: lazarusidestrconsts.liswarnings
#, object-pascal-format
msgid ", Warnings: %s"
msgstr ", предупреждений: %s"
#: lazarusidestrconsts.liswarningthisisthemainunitthenewmainunitwillbepas
#, object-pascal-format
msgid "%sWarning: This is the main unit. The new main unit will be %s.pas."
msgstr "%sВнимание: этот модуль является главным. Новым главным модулем будет %s.pas."
#: lazarusidestrconsts.liswelcometolazaruside
#, object-pascal-format
msgid "Welcome to Lazarus IDE %s"
msgstr "Добро пожаловать в Lazarus версии %s"
#: lazarusidestrconsts.liswelcometolazarusthereisalreadyaconfigurationfromve
#, object-pascal-format
msgid "Welcome to Lazarus %s%sThere is already a configuration from version %s in%s%s"
msgstr "Добро пожаловать в Lazarus %s%sОбнаружен каталог настройки версии %s в%s%s"
#: lazarusidestrconsts.liswhatneedsbuilding
msgid "What needs building"
msgstr "Что требует сборки"
#: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences
msgid "When a unit is renamed, update references"
msgstr "Обновление ссылок на модуль при его переименовании"
#: lazarusidestrconsts.liswhenenabledthecurrentoptionsaresavedtothetemplatew
msgid "When enabled the current options are saved to the template which is used when creating new projects"
msgstr "Если включено, текущие параметры сохраняются в шаблон, используемый при создании новых проектов"
#: lazarusidestrconsts.liswhenthereisonlyonepossiblecompletionitemuseitimmed
msgid "When there is only one possible completion item use it immediately, without showing the completion box"
msgstr "Использовать единственный вариант завершения сразу, не выводя окно со списком вариантов"
#: lazarusidestrconsts.liswhenthesourceeditorcursormovesshowthecurrentnodein
msgid "When the source editor cursor moves, show the current node in the code explorer"
msgstr "При перемещении курсора в редакторе исходного кода показывать текущий элемент в обозревателе кода"
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedform
msgid "Window menu shows designed form's name instead of caption"
msgstr "Отображать в меню \"Окно\" имя разрабатываемой формы вместо её заголовка"
#: lazarusidestrconsts.liswindowmenuwithnamefordesignedformhint
msgid "Useful especially if the caption is left empty."
msgstr "Параметр особенно полезен при пустом заголовке формы."
#: lazarusidestrconsts.liswindowstaysontop
msgid "Window stays on top"
msgstr "Располагать поверх других окон"
#: lazarusidestrconsts.liswithincludes2
msgid ", with includes "
msgstr ", с включаемыми файлами "
#: lazarusidestrconsts.liswithoutapropercompilerthecodebrowsingandcompilingw
msgid "Without a proper compiler the code browsing and compiling will be disappointing."
msgstr "Без указания корректного компилятора навигация по коду и компиляция не будут работать должным образом."
#: lazarusidestrconsts.liswithoutaproperdebuggerdebuggingwillbedisappointing
msgid "Without a proper debugger, debugging will be disappointing."
msgstr "Отладка не будет работать, если не указан корректный отладчик."
#: lazarusidestrconsts.liswithoutaproperlazarusdirectoryyouwillgetalotofwarn
msgid "Without a proper Lazarus directory you will get a lot of warnings."
msgstr "Не указав соответствующий каталог Lazarus, вы получите множество предупреждений."
#: lazarusidestrconsts.liswithoutapropermakeexecutablethecompilingoftheideis
msgid "Without a proper \"make\" executable the compiling of the IDE is not possible."
msgstr "Сборка IDE невозможна без указания корректного исполнимого файла \"make\"."
#: lazarusidestrconsts.liswithouttheproperfpcsourcescodebrowsingandcompletio
msgid "Without the proper FPC sources code browsing and completion will be very limited."
msgstr "Без указания корректного каталога исходного кода FPC навигация по коду и его завершение будут работать в очень ограниченном объёме."
#: lazarusidestrconsts.liswithrequiredpackages
msgid "With required packages"
msgstr "С требуемыми пакетами"
#: lazarusidestrconsts.liswordatcursorincurrenteditor
msgid "Word at cursor in current editor"
msgstr "Слово под курсором в текущем редакторе"
#: lazarusidestrconsts.lisworkingdirectoryforbuilding
msgid "Working directory for building"
msgstr "Рабочий каталог для сборки"
#: lazarusidestrconsts.lisworkingdirectoryforrun
msgid "Working directory for run"
msgstr "Рабочий каталог для запуска"
#: lazarusidestrconsts.liswriteconfiginsteadofcommandlineparameters
msgid "Write config instead of command line parameters"
msgstr "Записывать файл настройки вместо параметров командной строки"
#: lazarusidestrconsts.liswritepackageinfofailed
msgid "Writing the package info file failed."
msgstr "Не удалось записать файл сведений о пакете."
#: lazarusidestrconsts.liswriteprojectinfofailed
msgid "Writing the project info file failed."
msgstr "Не удалось записать файл сведений о проекте."
#: lazarusidestrconsts.liswritewhatpackagefilesares
msgid "Write what package files are searched and found."
msgstr "Вывести ищущиеся и найденные файлы пакетов."
#: lazarusidestrconsts.liswrongversionin
#, object-pascal-format
msgid "wrong version in %s: %s"
msgstr "некорректная версия в %s: %s"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepackageed
msgid "You can disable this for individual forms via the package editor"
msgstr "Это поведение можно отключить для отдельных форм через редактор пакета"
#: lazarusidestrconsts.lisyoucandisablethisforindividualformsviathepopupmenu
msgid "You can disable this for individual forms via the popup menu in the project inspector"
msgstr "Вы можете отключить это поведение для отдельных форм через всплывающее меню инспектора проекта"
#: lazarusidestrconsts.lisyoucandownloadfpcandthefpcsourcesfromhttpsourcefor
msgid "You can download FPC and the FPC sources from http://sourceforge.net/projects/lazarus/?source=directory"
msgstr "FPC и его исходный код можно загрузить с http://sourceforge.net/projects/lazarus/?source=directory"
#: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling
msgid "You cannot build Lazarus while debugging or compiling."
msgstr "Вы не можете пересобрать Lazarus в процессе отладки или компиляции."
#: lazarusidestrconsts.lisyoucannotchangethebuildmodewhilecompiling
msgid "You cannot change the build mode while compiling."
msgstr "Вы не можете сменить режим сборки в процессе компиляции."
#: lazarusidestrconsts.lisyoucanselectitemsbysimplypressingunderscoredletter
msgid "You can select items by simply pressing underscored letters"
msgstr "Элементы можно выбрать простыми нажатиями подчёркнутых букв"
#: lazarusidestrconsts.lis_all_
msgctxt "lazarusidestrconsts.lis_all_"
msgid "<All>"
msgstr "<Все>"
#: lazarusidestrconsts.locwndsrceditor
msgctxt "lazarusidestrconsts.locwndsrceditor"
msgid "Source Editor"
msgstr "Редактор исходного кода"
#: lazarusidestrconsts.lrsplddeleteselected
msgid "Delete selected"
msgstr "Удалить выделенные"
#: lazarusidestrconsts.lrspldinvalid
msgid "invalid"
msgstr "некорректен"
#: lazarusidestrconsts.lrspldlpkfileinvalid
#, object-pascal-format
msgid "lpk file invalid (%s)"
msgstr "некорректные файлы LPK (%s)"
#: lazarusidestrconsts.lrspldlpkfilevalid
#, object-pascal-format
msgid "lpk file valid (%s)"
msgstr "корректные файлы LPK (%s)"
#: lazarusidestrconsts.lrspldunabletodeletefile
#, object-pascal-format
msgid "Unable to delete file \"%s\""
msgstr "Невозможно удалить файл \"%s\""
#: lazarusidestrconsts.lrspldvalid
msgid "valid"
msgstr "корректен"
#: lazarusidestrconsts.lrsrescanlplfiles
msgid "Rescan lpl files"
msgstr "Пересмотреть файлы LPL"
#: lazarusidestrconsts.lvlgraphaddhorizontalspacing
msgid "Add horizontal spacing between columns"
msgstr "Добавлять отступ между столбцами по горизонтали"
#: lazarusidestrconsts.lvlgraphaddverticalspacingar
msgid "Add vertical spacing around nodes"
msgstr "Добавлять отступ между узлами по вертикали"
#: lazarusidestrconsts.lvlgraphextraspacing
msgid "Extra spacing (x/y)"
msgstr "Дополнительный отступ (x/y)"
#: lazarusidestrconsts.lvlgraphnamesabovenode
msgid "Names above node"
msgstr "Имена над узлами"
#: lazarusidestrconsts.lvlgraphoptabsolutelimi
msgid "Absolute limit for height of levels"
msgstr "Абсолютный предел высоты уровней"
#: lazarusidestrconsts.lvlgraphoptcrossings
msgid "Crossings"
msgstr "Пересечения"
#: lazarusidestrconsts.lvlgraphoptedgelen
msgid "Edge len"
msgstr "Длина связей"
#: lazarusidestrconsts.lvlgraphoptedges
msgid "Edges"
msgstr "Связи"
#: lazarusidestrconsts.lvlgraphoptinfo
msgid "Info"
msgstr "Сведения"
#: lazarusidestrconsts.lvlgraphoptlevels
msgctxt "lazarusidestrconsts.lvlgraphoptlevels"
msgid "Levels"
msgstr "Уровни"
#: lazarusidestrconsts.lvlgraphoptlimitheightoflvl
msgid "Limit height of Levels"
msgstr "Ограничивать высоту уровней"
#: lazarusidestrconsts.lvlgraphoptlimitrelativ
#, object-pascal-format
msgid "Limit relative to node-count for height of levels.%0sLimit = min(3, val*sqrt(NodeCount))"
msgstr "Предел высоты уровней относительно количества узлов.%0sПредел = min(3, val*sqrt(NodeCount))"
#: lazarusidestrconsts.lvlgraphoptsplitpoints
msgid "Splitpoints"
msgstr "Точки разделения"
#: lazarusidestrconsts.lvlgraphreducebackedges
msgid "Reduce backedges"
msgstr "Уменьшать обратные связи"
#: lazarusidestrconsts.lvlgraphshapecalculatelay
msgid "Calculate layout from high-edge"
msgstr "Размещать с высокого уровня"
#: lazarusidestrconsts.lvlgraphshapecurved
msgid "Curved"
msgstr "Изогнутая"
#: lazarusidestrconsts.lvlgraphshapeedgesshape
msgid "Edges shape"
msgstr "Форма связей"
#: lazarusidestrconsts.lvlgraphshapeedgessplitmo
msgid "Edges split mode"
msgstr "Режим разделения связей"
#: lazarusidestrconsts.lvlgraphshapeminimizeedge
msgid "Minimize edges len"
msgstr "Уменьшать длину связей"
#: lazarusidestrconsts.lvlgraphshapenodes
msgid "Nodes"
msgstr "Узлы"
#: lazarusidestrconsts.lvlgraphshapestraight
msgid "Straight"
msgstr "Прямая"
#: lazarusidestrconsts.lvlgraphsplitmergeathighe
msgid "Merge at highest"
msgstr "Объединять в наивысшем"
#: lazarusidestrconsts.lvlgraphsplitmergeatsourc
msgid "Merge at source"
msgstr "Объединять в начале"
#: lazarusidestrconsts.lvlgraphsplitmergeattarge
msgid "Merge at target"
msgstr "Объединять в конце"
#: lazarusidestrconsts.lvlgraphsplitnone
msgctxt "lazarusidestrconsts.lvlgraphsplitnone"
msgid "None"
msgstr "Нет"
#: lazarusidestrconsts.lvlgraphsplitseparate
msgid "Separate"
msgstr "Отдельные"
#: lazarusidestrconsts.lvlgraphstraightengraph
msgid "Straighten graph"
msgstr "Расправлять диаграмму"
#: lazarusidestrconsts.optdispgutterchanges
msgid "Changes"
msgstr "Изменения"
#: lazarusidestrconsts.optdispgutterfolding
msgid "Folding"
msgstr "Сворачивание"
#: lazarusidestrconsts.optdispguttermarks
msgid "Marks"
msgstr "Отметки"
#: lazarusidestrconsts.optdispgutternocurrentlinecolor
msgid "No current line color"
msgstr "Не использовать цвет текущей строки"
#: lazarusidestrconsts.optdispgutterseparator
msgid "Separator"
msgstr "Разделитель"
#: lazarusidestrconsts.optdispgutterusecurrentlinecolor
msgid "Use current line color"
msgstr "Использовать цвет текущей строки"
#: lazarusidestrconsts.optdispgutterusecurrentlinenumbercolor
msgid "Use current line number color"
msgstr "Использовать цвет номера текущей строки"
#: lazarusidestrconsts.podaddpackageunittousessection
msgid "Add package unit to uses section"
msgstr "Добавлять модуль пакета в выражение uses"
#: lazarusidestrconsts.rsaddinverse
msgid "Add Inverse"
msgstr "Добавить инверсию"
#: lazarusidestrconsts.rsaddnewterm
msgid "Add new term"
msgstr "Добавить новый терм"
#: lazarusidestrconsts.rsattributes
msgid "Attributes"
msgstr "Атрибуты"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumber
msgid "Automatically increase build number"
msgstr "Автоматически наращивать номер сборки"
#: lazarusidestrconsts.rsautomaticallyincreasebuildnumberhint
msgid "Increased every time the project is compiled."
msgstr "Увеличивать при каждой компиляции проекта"
#: lazarusidestrconsts.rsbuild
msgid "&Build:"
msgstr "С&борка:"
#: lazarusidestrconsts.rscharacterset
msgid "Character set:"
msgstr "Набор символов:"
#: lazarusidestrconsts.rscloseall
msgid "Close all pages"
msgstr "Закрыть все вкладки"
#: lazarusidestrconsts.rsclosecurrentpage
msgid "Close current page (Ctrl+F4)∥(Ctrl+W)"
msgstr "Закрыть текущую вкладку (Ctrl+F4)∥(Ctrl+W)"
#: lazarusidestrconsts.rscloseleft
msgid "Close page(s) on the left"
msgstr "Закрыть вкладки слева"
#: lazarusidestrconsts.rscloseothers
msgid "Close other page(s)"
msgstr "Закрыть прочие вкладки"
#: lazarusidestrconsts.rscloseright
msgid "Close page(s) on the right"
msgstr "Закрыть вкладки справа"
#: lazarusidestrconsts.rsconditionaldefines
msgid "Conditional defines"
msgstr "Условные определения"
#: lazarusidestrconsts.rscreatenewdefine
msgid "Create new define"
msgstr "Создать новое определение"
#: lazarusidestrconsts.rsenablei18n
msgid "Enable i18n"
msgstr "Включить i18n"
#: lazarusidestrconsts.rsfilterthelistwithstring
msgid "Filter the lines in list with a string (Ctrl+F)"
msgstr "Отфильтровать значения списка при помощи строки (Ctrl+F)"
#: lazarusidestrconsts.rsfoundbutnotlistedhere
msgid "Found but not listed here: "
msgstr "Найденных, но не отображаемых здесь: "
#: lazarusidestrconsts.rsi18nexcluded
msgid "Excluded"
msgstr "Исключённые"
#: lazarusidestrconsts.rsi18nforceupdatepofilesonnextbuild
msgid "Force update PO files on next build"
msgstr "Принудительно обновить файлы PO при следующей сборке"
#: lazarusidestrconsts.rsi18nidentifiers
msgid "Identifiers:"
msgstr "Идентификаторы:"
#: lazarusidestrconsts.rsi18noptions
msgid "i18n Options"
msgstr "Параметры i18n"
#: lazarusidestrconsts.rsi18noriginals
msgid "Originals:"
msgstr "Исходные строки:"
#: lazarusidestrconsts.rsincludeversioninfohint
msgid "Version info is stored if the executable format supports it."
msgstr "Сведения о версии сохраняются только при условии их поддержки форматом исполнимого файла"
#: lazarusidestrconsts.rsincludeversioninfoinexecutable
msgid "Include version info in executable"
msgstr "Добавлять сведения о версии в исполнимый файл"
#: lazarusidestrconsts.rslanguageoptions
msgid "Language options"
msgstr "Параметры языка"
#: lazarusidestrconsts.rslanguageselection
msgid "Language selection:"
msgstr "Выбор языка:"
#: lazarusidestrconsts.rsmajorversion
msgid "&Major version:"
msgstr "&Старшая:"
#: lazarusidestrconsts.rsminorversion
msgid "Mi&nor version:"
msgstr "&Младшая:"
#: lazarusidestrconsts.rsnewsearchwithsamecriteria
msgid "New search with same criteria (Ctrl+N)"
msgstr "Новый поиск по тем же условиям (Ctrl+N)"
#: lazarusidestrconsts.rsotherinfo
msgid "Other info"
msgstr "Прочие сведения"
#: lazarusidestrconsts.rspooutputdirectory
msgid "PO Output Directory:"
msgstr "Каталог вывода файлов PO:"
#: lazarusidestrconsts.rsrefreshthesearch
msgid "Refresh the search (F5)"
msgstr "Обновить результаты поиска (F5)"
#: lazarusidestrconsts.rsresource
msgid "Resource"
msgstr "Ресурс"
#: lazarusidestrconsts.rsresourceclear
msgid "Delete all resources?"
msgstr "Удалить все ресурсы?"
#: lazarusidestrconsts.rsresourcefilename
msgctxt "lazarusidestrconsts.rsresourcefilename"
msgid "File name"
msgstr "Имя файла"
#: lazarusidestrconsts.rsresourcetype
msgctxt "lazarusidestrconsts.rsresourcetype"
msgid "Type"
msgstr "Тип"
#: lazarusidestrconsts.rsrevision
msgid "&Revision:"
msgstr "&Ревизия:"
#: lazarusidestrconsts.rsselectaninheritedentry
msgid "Select an inherited entry"
msgstr "Выбрать унаследованный элемент"
#: lazarusidestrconsts.rsshowabspath
msgid "Absolute path"
msgstr "Абсолютный путь"
#: lazarusidestrconsts.rsshowfilename
msgctxt "lazarusidestrconsts.rsshowfilename"
msgid "File name"
msgstr "Имя файла"
#: lazarusidestrconsts.rsshowpathmode
msgid "Path display mode (Ctrl+P)"
msgstr "Режим отображения пути (Ctrl+P)"
#: lazarusidestrconsts.rsshowrelpath
msgid "Relative path"
msgstr "Относительный путь"
#: lazarusidestrconsts.rsversionnumbering
msgid "Version numbering"
msgstr "Номера версий"
#: lazarusidestrconsts.showoptions
msgid "Show options"
msgstr "Показать параметры"
#: lazarusidestrconsts.srkmcarhelpmenu
msgid "Help menu commands"
msgstr "Команды меню Справка"
#: lazarusidestrconsts.srkmcatcmdcmd
msgid "Command commands"
msgstr "Управляющие команды"
#: lazarusidestrconsts.srkmcatcodetools
msgid "CodeTools commands"
msgstr "Команды CodeTools"
#: lazarusidestrconsts.srkmcatcolselection
msgid "Text column selection commands"
msgstr "Команды выделения столбцов текста"
#: lazarusidestrconsts.srkmcatcursormoving
msgid "Cursor moving commands"
msgstr "Команды перемещения курсора"
#: lazarusidestrconsts.srkmcatediting
msgid "Text editing commands"
msgstr "Команды редактирования текста"
#: lazarusidestrconsts.srkmcatfilemenu
msgid "File menu commands"
msgstr "Команды меню Файл"
#: lazarusidestrconsts.srkmcatfold
msgid "Text folding commands"
msgstr "Команды сворачивания текста"
#: lazarusidestrconsts.srkmcatmacrorecording
msgctxt "lazarusidestrconsts.srkmcatmacrorecording"
msgid "Macros"
msgstr "Макросы"
#: lazarusidestrconsts.srkmcatmarker
msgid "Text bookmark commands"
msgstr "Команды управления закладками исходного кода"
#: lazarusidestrconsts.srkmcatmulticaret
msgid "Multi caret commands"
msgstr "Команды управления несколькими курсорами"
#: lazarusidestrconsts.srkmcatpackagemenu
msgid "Package menu commands"
msgstr "Команды меню Пакет"
#: lazarusidestrconsts.srkmcatprojectmenu
msgid "Project menu commands"
msgstr "Команды меню Проект"
#: lazarusidestrconsts.srkmcatrunmenu
msgid "Run menu commands"
msgstr "Команды меню Запуск"
#: lazarusidestrconsts.srkmcatsearchreplace
msgid "Text search and replace commands"
msgstr "Команды поиска и замены текста"
#: lazarusidestrconsts.srkmcatselection
msgid "Text selection commands"
msgstr "Команды выделения текста"
#: lazarusidestrconsts.srkmcatsrcnotebook
msgid "Source Notebook commands"
msgstr "Команды управления редакторами исходного кода"
#: lazarusidestrconsts.srkmcatsyncroedit
msgid "Syncron Editing"
msgstr "Синхронное редактирование"
#: lazarusidestrconsts.srkmcatsyncroeditoff
msgid "Syncron Editing (not in Cell)"
msgstr "Синхронное редактирование (не в поле)"
#: lazarusidestrconsts.srkmcatsyncroeditsel
msgid "Syncron Editing (while selecting)"
msgstr "Синхронное редактирование (при выделении)"
#: lazarusidestrconsts.srkmcattemplateedit
msgid "Template Editing"
msgstr "Команды редактирования шаблонов"
#: lazarusidestrconsts.srkmcattemplateeditoff
msgid "Template Editing (not in Cell)"
msgstr "Команды редактирования шаблонов (не в полях)"
#: lazarusidestrconsts.srkmcattoolmenu
msgid "Tools menu commands"
msgstr "Команды меню Сервис"
#: lazarusidestrconsts.srkmcatviewmenu
msgid "View menu commands"
msgstr "Команды меню Вид"
#: lazarusidestrconsts.srkmcommand
msgctxt "lazarusidestrconsts.srkmcommand"
msgid "Command:"
msgstr "Команда:"
#: lazarusidestrconsts.srkmconflic
msgid "Conflict "
msgstr "Конфликт "
#: lazarusidestrconsts.srkmecabortbuild
msgid "abort build"
msgstr "Прервать сборку"
#: lazarusidestrconsts.srkmecabstractmethods
msgid "Abstract Methods ..."
msgstr "Абстрактные методы ..."
#: lazarusidestrconsts.srkmecaddbpaddress
msgid "add address breakpoint"
msgstr "добавить точку останова по адресу"
#: lazarusidestrconsts.srkmecaddbpsource
msgid "add source breakpoint"
msgstr "добавить точку останова в исходном коде"
#: lazarusidestrconsts.srkmecaddbpwatchpoint
msgid "add data/watchpoint"
msgstr "добавить точку останова с наблюдением"
#: lazarusidestrconsts.srkmecaddjumppoint
msgid "Add Jump Point"
msgstr "Добавить точку перехода"
#: lazarusidestrconsts.srkmecaddwatch
msgid "add watch"
msgstr "Добавить наблюдение"
#: lazarusidestrconsts.srkmecattach
msgid "Attach to program"
msgstr "Присоединиться к программе"
#: lazarusidestrconsts.srkmecautocompletion
msgid "Code template completion"
msgstr "Завершить шаблон кода"
#: lazarusidestrconsts.srkmecblockcopy
msgid "Copy Block"
msgstr "Копировать выделенное"
#: lazarusidestrconsts.srkmecblockdelete
msgid "Delete Block"
msgstr "Удалить выделенное"
#: lazarusidestrconsts.srkmecblockgotobegin
msgid "Goto Block begin"
msgstr "Перейти к началу выделенного"
#: lazarusidestrconsts.srkmecblockgotoend
msgid "Goto Block end"
msgstr "Перейти к концу выделенного"
#: lazarusidestrconsts.srkmecblockhide
msgid "Hide Block"
msgstr "Скрыть выделенное"
#: lazarusidestrconsts.srkmecblockindent
msgid "Indent line/block"
msgstr "Увеличить отступ строки/блока"
#: lazarusidestrconsts.srkmecblockindentmove
msgid "Indent line/block (move columns)"
msgstr "Увеличить отступ строки/блока (сдвинуть столбцы)"
#: lazarusidestrconsts.srkmecblockmove
msgid "Move Block"
msgstr "Переместить выделенное"
#: lazarusidestrconsts.srkmecblocksetbegin
msgid "Set block begin"
msgstr "Установить начало выделения"
#: lazarusidestrconsts.srkmecblocksetend
msgid "Set block end"
msgstr "Установить конец выделения"
#: lazarusidestrconsts.srkmecblockshow
msgid "Show Block"
msgstr "Показать выделенное"
#: lazarusidestrconsts.srkmecblocktogglehide
msgid "Toggle block"
msgstr "Переключить видимость выделенного"
#: lazarusidestrconsts.srkmecblockunindent
msgid "Unindent line/block"
msgstr "Уменьшить отступ строки/блока"
#: lazarusidestrconsts.srkmecblockunindentmove
msgid "Unindent line/block (move columns)"
msgstr "Уменьшить отступ строки/блока (сдвинуть столбцы)"
#: lazarusidestrconsts.srkmecbreakpointproperties
msgid "show breakpoint properties"
msgstr "Показать параметры точки останова"
#: lazarusidestrconsts.srkmecbuild
msgid "build program/project"
msgstr "Собрать программу/проект"
#: lazarusidestrconsts.srkmecbuildfile
msgid "build file"
msgstr "Собрать файл"
#: lazarusidestrconsts.srkmecbuildlazarus
msgid "Build Lazarus"
msgstr "Собрать Lazarus"
#: lazarusidestrconsts.srkmecbuildmanymodes
msgid "build many modes"
msgstr "собрать в нескольких режимах"
#: lazarusidestrconsts.srkmecchar
msgid "Char"
msgstr "Символ"
#: lazarusidestrconsts.srkmeccleanupandbuild
msgid "clean up and build"
msgstr "очистить и собрать"
#: lazarusidestrconsts.srkmecclearall
msgid "Delete whole text"
msgstr "Удалить весь текст"
#: lazarusidestrconsts.srkmecclearallbookmark
msgid "Clear all Bookmarks"
msgstr "Очистить все закладки"
#: lazarusidestrconsts.srkmecclearbookmarkforfile
msgid "Clear Bookmarks for current file"
msgstr "Очистить закладки в текущем файле"
#: lazarusidestrconsts.srkmeccolseldown
msgid "Column Select Down"
msgstr "Выделить снизу"
#: lazarusidestrconsts.srkmeccolseleditorbottom
msgid "Column Select to absolute end"
msgstr "Выделить до самого конца"
#: lazarusidestrconsts.srkmeccolseleditortop
msgid "Column Select to absolute beginning"
msgstr "Выделить до самого начала"
#: lazarusidestrconsts.srkmeccolselleft
msgid "Column Select Left"
msgstr "Выделить слева"
#: lazarusidestrconsts.srkmeccolsellineend
msgid "Column Select Line End"
msgstr "Выделить до конца строки"
#: lazarusidestrconsts.srkmeccolsellinestart
msgid "Column Select Line Start"
msgstr "Выделить до начала строки"
#: lazarusidestrconsts.srkmeccolsellinetextstart
msgid "Column Select to text start in line"
msgstr "Выделить до начала текста в строке"
#: lazarusidestrconsts.srkmeccolselpagebottom
msgid "Column Select Page Bottom"
msgstr "Выделить всю страницу снизу"
#: lazarusidestrconsts.srkmeccolselpagedown
msgid "Column Select Page Down"
msgstr "Выделить страницу снизу"
#: lazarusidestrconsts.srkmeccolselpagetop
msgid "Column Select Page Top"
msgstr "Выделить всю страницу сверху"
#: lazarusidestrconsts.srkmeccolselpageup
msgid "Column Select Page Up"
msgstr "Выделить страницу сверху"
#: lazarusidestrconsts.srkmeccolselright
msgid "Column Select Right"
msgstr "Выделить справа"
#: lazarusidestrconsts.srkmeccolselup
msgid "Column Select Up"
msgstr "Выделить сверху"
#: lazarusidestrconsts.srkmeccolselwordleft
msgid "Column Select Word Left"
msgstr "Добавить в выделение слово слева"
#: lazarusidestrconsts.srkmeccolselwordright
msgid "Column Select Word Right"
msgstr "Добавить в выделение слово справа"
#: lazarusidestrconsts.srkmeccolumnselect
msgid "Column selection mode"
msgstr "Режим выбора столбца"
#: lazarusidestrconsts.srkmeccompile
msgid "compile program/project"
msgstr "Компилировать программу/проект"
#: lazarusidestrconsts.srkmecconfigbuildfile
msgid "config build file"
msgstr "файл параметров сборки"
#: lazarusidestrconsts.srkmeccopy
msgctxt "lazarusidestrconsts.srkmeccopy"
msgid "Copy"
msgstr "Копировать"
#: lazarusidestrconsts.srkmeccopyadd
msgid "Copy (Add to Clipboard)"
msgstr "Копировать (добавить к буферу обмена)"
#: lazarusidestrconsts.srkmeccopyaddcurrentline
msgid "Copy current line (Add to Clipboard)"
msgstr "Копировать текущую строку (добавить к буферу обмена)"
#: lazarusidestrconsts.srkmeccopycurrentline
msgid "Copy current line"
msgstr "Копировать текущую строку"
#: lazarusidestrconsts.srkmeccopyeditornewwindow
msgid "Copy editor to new window"
msgstr "Копировать редактор в новое окно"
#: lazarusidestrconsts.srkmeccopyeditornextwindow
msgid "Copy editor to next free window"
msgstr "Копировать редактор в следующее свободное окно"
#: lazarusidestrconsts.srkmeccopyeditorprevwindow
msgid "Copy editor to prior free window"
msgstr "Копировать редактор в предыдущее свободное окно"
#: lazarusidestrconsts.srkmeccut
msgctxt "lazarusidestrconsts.srkmeccut"
msgid "Cut"
msgstr "Вырезать"
#: lazarusidestrconsts.srkmeccutadd
msgid "Cut (Add to Clipboard)"
msgstr "Вырезать (добавить к буферу обмена)"
#: lazarusidestrconsts.srkmeccutaddcurrentline
msgid "Cut current line (Add to Clipboard)"
msgstr "Вырезать текущую строку (добавить к буферу обмена)"
#: lazarusidestrconsts.srkmeccutcurrentline
msgid "Cut current line"
msgstr "Вырезать текущую строку"
#: lazarusidestrconsts.srkmecdeletebol
msgid "Delete to beginning of line"
msgstr "Удалить до начала строки"
#: lazarusidestrconsts.srkmecdeletechar
msgid "Delete char at cursor"
msgstr "Удалить символ у курсора"
#: lazarusidestrconsts.srkmecdeleteeol
msgid "Delete to end of line"
msgstr "Удалить до конца строки"
#: lazarusidestrconsts.srkmecdeletelastchar
msgid "Delete Last Char"
msgstr "Удалить последний символ"
#: lazarusidestrconsts.srkmecdeletelastword
msgid "Delete to start of word"
msgstr "Удалить до начала слова"
#: lazarusidestrconsts.srkmecdeleteline
msgid "Delete current line"
msgstr "Удалить текущую строку"
#: lazarusidestrconsts.srkmecdeleteword
msgid "Delete to end of word"
msgstr "Удалить до конца слова"
#: lazarusidestrconsts.srkmecdetach
msgid "Detach from program"
msgstr "Отсоединиться от программы"
#: lazarusidestrconsts.srkmecdiff
msgctxt "lazarusidestrconsts.srkmecdiff"
msgid "Diff"
msgstr "Разница Diff"
#: lazarusidestrconsts.srkmecdown
msgid "Move cursor down"
msgstr "Переместить курсор вниз"
#: lazarusidestrconsts.srkmecduplicateline
msgid "Duplicate line (or lines in selection)"
msgstr "Дублировать строку (или выделенные строки)"
#: lazarusidestrconsts.srkmecduplicateselection
msgid "Duplicate selection"
msgstr "Дублировать выделенное"
#: lazarusidestrconsts.srkmeceditorbottom
msgid "Move cursor to absolute end"
msgstr "Переместить курсор в самый конец"
#: lazarusidestrconsts.srkmeceditortop
msgid "Move cursor to absolute beginning"
msgstr "Переместить курсор в самое начало"
#: lazarusidestrconsts.srkmecemptymethods
msgid "Empty Methods ..."
msgstr "Пустые методы ..."
#: lazarusidestrconsts.srkmecenvironmentoptions
msgid "IDE options"
msgstr "Параметры IDE"
#: lazarusidestrconsts.srkmecevaluate
msgid "evaluate/modify"
msgstr "рассчитать/изменить"
#: lazarusidestrconsts.srkmecextractproc
msgctxt "lazarusidestrconsts.srkmecextractproc"
msgid "Extract Procedure"
msgstr "Извлечь в процедуру"
#: lazarusidestrconsts.srkmecexttool
#, object-pascal-format
msgid "External tool %d"
msgstr "Внешнее средство %d"
#: lazarusidestrconsts.srkmecexttoolsettings
msgid "External tools settings"
msgstr "Параметры внешних средств"
#: lazarusidestrconsts.srkmecfind
msgid "Find Text"
msgstr "Найти текст"
#: lazarusidestrconsts.srkmecfindblockotherend
msgid "Find block other end"
msgstr "Найти другой конец блока"
#: lazarusidestrconsts.srkmecfindblockstart
msgid "Find block start"
msgstr "Найти начало блока"
#: lazarusidestrconsts.srkmecfinddeclaration
msgid "Find Declaration"
msgstr "Найти объявление"
#: lazarusidestrconsts.srkmecfindidentifierrefs
msgid "Find Identifier References"
msgstr "Найти ссылки на идентификатор"
#: lazarusidestrconsts.srkmecfindinfiles
msgid "Find in Files"
msgstr "Найти в файлах"
#: lazarusidestrconsts.srkmecfindnext
msgctxt "lazarusidestrconsts.srkmecfindnext"
msgid "Find Next"
msgstr "Найти далее"
#: lazarusidestrconsts.srkmecfindnextwordoccurrence
msgid "Find Next Word Occurrence"
msgstr "Найти следующий экземпляр слова"
#: lazarusidestrconsts.srkmecfindoverloads
msgid "Find Overloads"
msgstr "Найти перегруженные"
#: lazarusidestrconsts.srkmecfindoverloadscapt
msgid "Find Overloads ..."
msgstr "Найти перегруженные ..."
#: lazarusidestrconsts.srkmecfindprevious
msgid "Find Previous"
msgstr "Найти предыдущее"
#: lazarusidestrconsts.srkmecfindprevwordoccurrence
msgid "Find Previous Word Occurrence"
msgstr "Найти предыдущий экземпляр слова"
#: lazarusidestrconsts.srkmecfindproceduredefinition
msgid "Find Procedure Definiton"
msgstr "Найти объявление процедуры"
#: lazarusidestrconsts.srkmecfindproceduremethod
msgid "Find Procedure Method"
msgstr "Найти тело процедуры"
#: lazarusidestrconsts.srkmecfoldcurrent
msgid "Fold at Cursor"
msgstr "Свернуть текст под курсором"
#: lazarusidestrconsts.srkmecfoldlevel
#, object-pascal-format
msgid "Fold to Level %d"
msgstr "Свернуть до уровня %d"
#: lazarusidestrconsts.srkmecgotoeditor
#, object-pascal-format
msgid "Go to editor %d"
msgstr "Перейти к редактору %d"
#: lazarusidestrconsts.srkmecgotoincludedirective
msgid "Go to include directive of current include file"
msgstr "Перейти по директиве include текущего включаемого файла"
#: lazarusidestrconsts.srkmecgotolinenumber
msgid "Go to Line Number"
msgstr "Перейти к строке с заданным номером"
#: lazarusidestrconsts.srkmecgotomarker
#, object-pascal-format
msgid "Go to bookmark %d"
msgstr "Перейти к закладке %d"
#: lazarusidestrconsts.srkmecgotoxy
msgid "Goto XY"
msgstr "Перейти по координате"
#: lazarusidestrconsts.srkmecguessmisplacedifdef
msgid "Guess Misplaced $IFDEF"
msgstr "Исправить отсутствие $IFDEF"
#: lazarusidestrconsts.srkmechalfwordleft
msgid "Move cursor part-word left (e.g. CamelCase)"
msgstr "Переместить курсор влево на часть слова (например, смешанный регистр)"
#: lazarusidestrconsts.srkmechalfwordright
msgid "Move cursor part-word right (e.g. CamelCase)"
msgstr "Переместить курсор вправо на часть слова (например, смешанный регистр)"
#: lazarusidestrconsts.srkmecimestr
msgid "Ime Str"
msgstr "Ime Str"
#: lazarusidestrconsts.srkmecinsertchangelogentry
msgid "Insert ChangeLog entry"
msgstr "Вставить элемент ChangeLog"
#: lazarusidestrconsts.srkmecinsertcharacter
msgid "Insert from Charactermap"
msgstr "Вставить из таблицы символов"
#: lazarusidestrconsts.srkmecinsertcvsauthor
msgid "Insert CVS keyword Author"
msgstr "Вставить ключевое слово CVS Author"
#: lazarusidestrconsts.srkmecinsertcvsdate
msgid "Insert CVS keyword Date"
msgstr "Вставить ключевое слово CVS Date"
#: lazarusidestrconsts.srkmecinsertcvsheader
msgid "Insert CVS keyword Header"
msgstr "Вставить ключевое слово CVS Header"
#: lazarusidestrconsts.srkmecinsertcvsid
msgid "Insert CVS keyword ID"
msgstr "Вставить ключевое слово CVS ID"
#: lazarusidestrconsts.srkmecinsertcvslog
msgid "Insert CVS keyword Log"
msgstr "Вставить ключевое слово CVS Log"
#: lazarusidestrconsts.srkmecinsertcvsname
msgid "Insert CVS keyword Name"
msgstr "Вставить ключевое слово CVS Name"
#: lazarusidestrconsts.srkmecinsertcvsrevision
msgid "Insert CVS keyword Revision"
msgstr "Вставить ключевое слово CVS Revision"
#: lazarusidestrconsts.srkmecinsertcvssource
msgid "Insert CVS keyword Source"
msgstr "Вставить ключевое слово CVS Source"
#: lazarusidestrconsts.srkmecinsertdatetime
msgid "Insert current date and time"
msgstr "Вставить текущие дату и время"
#: lazarusidestrconsts.srkmecinsertfilename
msgid "Insert Full Filename"
msgstr "Вставить полное имя файла"
#: lazarusidestrconsts.srkmecinsertgplnotice
msgid "Insert GPL notice"
msgstr "Вставить заметку о GPL"
#: lazarusidestrconsts.srkmecinsertgplnoticetranslated
msgid "Insert GPL notice (translated)"
msgstr "Вставить заметку о GPL (перевод)"
#: lazarusidestrconsts.srkmecinsertguid
msgid "Insert a GUID"
msgstr "GUID"
#: lazarusidestrconsts.srkmecinsertlgplnotice
msgid "Insert LGPL notice"
msgstr "Вставить заметку об LGPL"
#: lazarusidestrconsts.srkmecinsertlgplnoticetranlated
msgid "Insert LGPL notice (translated)"
msgstr "Вставить заметку об LGPL (перевод)"
#: lazarusidestrconsts.srkmecinsertline
msgid "Break line, leave cursor"
msgstr "Разорвать строку, оставить курсор"
#: lazarusidestrconsts.srkmecinsertmitnotice
msgid "Insert MIT notice"
msgstr "Вставить заметку о MIT"
#: lazarusidestrconsts.srkmecinsertmitnoticetranslated
msgid "Insert MIT notice (translated)"
msgstr "Вставить заметку о MIT (перевод)"
#: lazarusidestrconsts.srkmecinsertmode
msgid "Insert Mode"
msgstr "Режим вставки"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice
msgid "Insert modified LGPL notice"
msgstr "Вставить заметку о модифицированной LGPL"
#: lazarusidestrconsts.srkmecinsertmodifiedlgplnoticetranslated
msgid "Insert modified LGPL notice (translated)"
msgstr "Вставить заметку о модифицированной LGPL (перевод)"
#: lazarusidestrconsts.srkmecinsertusername
msgid "Insert current username"
msgstr "Вставить текущее имя пользователя"
#: lazarusidestrconsts.srkmecinspect
msgid "inspect"
msgstr "просмотреть"
#: lazarusidestrconsts.srkmecinvertassignment
msgctxt "lazarusidestrconsts.srkmecinvertassignment"
msgid "Invert Assignment"
msgstr "Обратить присваивание"
#: lazarusidestrconsts.srkmeckeymapleft
msgctxt "lazarusidestrconsts.srkmeckeymapleft"
msgid "Left"
msgstr "Влево"
#: lazarusidestrconsts.srkmeckeymapright
msgctxt "lazarusidestrconsts.srkmeckeymapright"
msgid "Right"
msgstr "Вправо"
#: lazarusidestrconsts.srkmecleft
msgid "Move cursor left"
msgstr "Переместить курсор влево"
#: lazarusidestrconsts.srkmeclinebreak
msgid "Break line and move cursor"
msgstr "Разорвать строку, сдвинуть курсор"
#: lazarusidestrconsts.srkmeclineend
msgid "Move cursor to line end"
msgstr "Переместить курсор в конец строки"
#: lazarusidestrconsts.srkmeclineselect
msgid "Line selection mode"
msgstr "Режим выбора строк"
#: lazarusidestrconsts.srkmeclinestart
msgid "Move cursor to line start"
msgstr "Переместить курсор в начало строки"
#: lazarusidestrconsts.srkmeclinetextstart
msgid "Move cursor to text start in line"
msgstr "Переместить курсор на начало текста в строке"
#: lazarusidestrconsts.srkmeclockeditor
msgid "Lock Editor"
msgstr "Зафиксировать положение в редакторе"
#: lazarusidestrconsts.srkmecmakeresourcestring
msgid "Make Resource String"
msgstr "Создать строку ресурсов"
#: lazarusidestrconsts.srkmecmatchbracket
msgid "Go to matching bracket"
msgstr "Перейти к парной скобке"
#: lazarusidestrconsts.srkmecmoveeditorleft
msgid "Move editor left"
msgstr "Сместить редактор влево"
#: lazarusidestrconsts.srkmecmoveeditorleftmost
msgid "Move editor leftmost"
msgstr "Поместить редактор слева"
#: lazarusidestrconsts.srkmecmoveeditornewwindow
msgid "Move editor to new window"
msgstr "Переместить редактор в новое окно"
#: lazarusidestrconsts.srkmecmoveeditornextwindow
msgid "Move editor to next free window"
msgstr "Переместить редактор в следующее свободное окно"
#: lazarusidestrconsts.srkmecmoveeditorprevwindow
msgid "Move editor to prior free window"
msgstr "Переместить редактор в предыдущее свободное окно"
#: lazarusidestrconsts.srkmecmoveeditorright
msgid "Move editor right"
msgstr "Сместить редактор вправо"
#: lazarusidestrconsts.srkmecmoveeditorrightmost
msgid "Move editor rightmost"
msgstr "Поместить редактор справа"
#: lazarusidestrconsts.srkmecmovelinedown
msgid "Move line down"
msgstr "Переместить на строку вниз"
#: lazarusidestrconsts.srkmecmovelineup
msgid "Move line up"
msgstr "Переместить на строку вверх"
#: lazarusidestrconsts.srkmecmoveselectdown
msgid "Move selection down"
msgstr "Переместить выделенное вниз"
#: lazarusidestrconsts.srkmecmoveselectleft
msgid "Move selection left"
msgstr "Переместить выделенное влево"
#: lazarusidestrconsts.srkmecmoveselectright
msgid "Move selection right"
msgstr "Переместить выделенное вправо"
#: lazarusidestrconsts.srkmecmoveselectup
msgid "Move selection up"
msgstr "Переместить выделенное вверх"
#: lazarusidestrconsts.srkmecmultipaste
msgctxt "lazarusidestrconsts.srkmecmultipaste"
msgid "MultiPaste"
msgstr "Вставить с форматированием"
#: lazarusidestrconsts.srkmecnextbookmark
msgid "Next Bookmark"
msgstr "Следующая закладка"
#: lazarusidestrconsts.srkmecnexteditor
msgid "Go to next editor"
msgstr "Перейти к следующему редактору"
#: lazarusidestrconsts.srkmecnexteditorinhistory
msgid "Go to next editor in history"
msgstr "Перейти к следующему редактору в истории"
#: lazarusidestrconsts.srkmecnextsharededitor
msgid "Go to next editor with same Source"
msgstr "Перейти к следующему редактору с тем же файлом исходного кода"
#: lazarusidestrconsts.srkmecnextwindow
msgid "Go to next window"
msgstr "Перейти к следующему окну"
#: lazarusidestrconsts.srkmecnormalselect
msgid "Normal selection mode"
msgstr "Нормальный режим выбора"
#: lazarusidestrconsts.srkmecopenfileatcursor
msgid "Open File at Cursor"
msgstr "Открыть файл у курсора"
#: lazarusidestrconsts.srkmecoverwritemode
msgid "Overwrite Mode"
msgstr "Режим замены"
#: lazarusidestrconsts.srkmecpagebottom
msgid "Move cursor to bottom of page"
msgstr "Переместить курсор в конец страницы"
#: lazarusidestrconsts.srkmecpagedown
msgid "Move cursor down one page"
msgstr "Переместить курсор вниз на одну страницу"
#: lazarusidestrconsts.srkmecpageleft
msgid "Move cursor left one page"
msgstr "Переместить курсор влево на одну страницу"
#: lazarusidestrconsts.srkmecpageright
msgid "Move cursor right one page"
msgstr "Переместить курсор вправо на одну страницу"
#: lazarusidestrconsts.srkmecpagetop
msgid "Move cursor to top of page"
msgstr "Переместить курсор в начало страницы"
#: lazarusidestrconsts.srkmecpageup
msgid "Move cursor up one page"
msgstr "Переместить курсор вверх на одну страницу"
#: lazarusidestrconsts.srkmecpaste
msgctxt "lazarusidestrconsts.srkmecpaste"
msgid "Paste"
msgstr "Вставить"
#: lazarusidestrconsts.srkmecpasteascolumns
msgid "Paste (as Columns)"
msgstr "Вставить (как столбцы)"
#: lazarusidestrconsts.srkmecpause
msgid "pause program"
msgstr "приостановить программу"
#: lazarusidestrconsts.srkmecpluginmulticaretclearall
msgid "Clear all extra carets"
msgstr "Удалить все дополнительные курсоры"
#: lazarusidestrconsts.srkmecpluginmulticaretmodecancelonmove
msgid "Cursor keys clear all extra carets"
msgstr "Удалять все дополнительные курсоры клавишами управления"
#: lazarusidestrconsts.srkmecpluginmulticaretmodemoveall
msgid "Cursor keys move all extra carets"
msgstr "Перемещать все курсоры клавишами управления"
#: lazarusidestrconsts.srkmecpluginmulticaretsetcaret
msgid "Add extra caret"
msgstr "Добавить дополнительный курсор"
#: lazarusidestrconsts.srkmecpluginmulticarettogglecaret
msgid "Toggle extra caret"
msgstr "Включить или выключить дополнительный курсор"
#: lazarusidestrconsts.srkmecpluginmulticaretunsetcaret
msgid "Remove extra caret"
msgstr "Удалить дополнительный курсор"
#: lazarusidestrconsts.srkmecprevbookmark
msgid "Previous Bookmark"
msgstr "Предыдущая закладка"
#: lazarusidestrconsts.srkmecpreveditor
msgid "Go to prior editor"
msgstr "Перейти к предыдущему редактору"
#: lazarusidestrconsts.srkmecpreveditorinhistory
msgid "Go to previous editor in history"
msgstr "Перейти к предыдущему редактору в истории"
#: lazarusidestrconsts.srkmecprevsharededitor
msgid "Go to prior editor with same Source"
msgstr "Перейти к предыдущему редактору с тем же файлом исходного кода"
#: lazarusidestrconsts.srkmecprevwindow
msgid "Go to prior window"
msgstr "Перейти к предыдущему окну"
#: lazarusidestrconsts.srkmecquickcompile
msgid "quick compile, no linking"
msgstr "Быстрая компиляция, без компоновки"
#: lazarusidestrconsts.srkmecremovebreakpoint
msgid "remove breakpoint"
msgstr "Удалить точку останова"
#: lazarusidestrconsts.srkmecremoveemptymethods
msgid "Remove Empty Methods"
msgstr "Удалить пустые методы"
#: lazarusidestrconsts.srkmecremoveunusedunits
msgid "Remove Unused Units"
msgstr "Удалить неиспользуемые модули"
#: lazarusidestrconsts.srkmecrenameidentifier
msgid "Rename Identifier"
msgstr "Переименовать идентификатор"
#: lazarusidestrconsts.srkmecreplace
msgid "Replace Text"
msgstr "Заменить текст"
#: lazarusidestrconsts.srkmecreportingbug
msgctxt "lazarusidestrconsts.srkmecreportingbug"
msgid "Reporting a bug"
msgstr "Сообщить об ошибке"
#: lazarusidestrconsts.srkmecresetdebugger
msgid "reset debugger"
msgstr "Сбросить отладчик"
#: lazarusidestrconsts.srkmecright
msgid "Move cursor right"
msgstr "Переместить курсор вправо"
#: lazarusidestrconsts.srkmecrun
msgid "run program"
msgstr "Запустить программу"
#: lazarusidestrconsts.srkmecrunfile
msgid "run file"
msgstr "Запустить файл"
#: lazarusidestrconsts.srkmecrunparameters
msgid "run parameters"
msgstr "Параметры запуска"
#: lazarusidestrconsts.srkmecrunwithdebugging
msgid "run with debugging"
msgstr "Запустить с отладкой"
#: lazarusidestrconsts.srkmecrunwithoutdebugging
msgid "run without debugging"
msgstr "Запустить без отладки"
#: lazarusidestrconsts.srkmecscrolldown
msgid "Scroll down one line"
msgstr "Прокрутить вниз на одну строку"
#: lazarusidestrconsts.srkmecscrollleft
msgid "Scroll left one char"
msgstr "Прокрутить влево на один символ"
#: lazarusidestrconsts.srkmecscrollright
msgid "Scroll right one char"
msgstr "Прокрутить вправо на один символ"
#: lazarusidestrconsts.srkmecscrollup
msgid "Scroll up one line"
msgstr "Прокрутить вверх на одну строку"
#: lazarusidestrconsts.srkmecseldown
msgid "Select Down"
msgstr "Выделить снизу"
#: lazarusidestrconsts.srkmecselectall
msgctxt "lazarusidestrconsts.srkmecselectall"
msgid "Select All"
msgstr "Выделить все"
#: lazarusidestrconsts.srkmecselectiontabs2spaces
msgid "Convert tabs to spaces in selection"
msgstr "Преобразовать ТАБ в пробелы в выделенном"
#: lazarusidestrconsts.srkmecseleditorbottom
msgid "Select to absolute end"
msgstr "Выделить до самого конца"
#: lazarusidestrconsts.srkmecseleditortop
msgid "Select to absolute beginning"
msgstr "Выделить до самого начала"
#: lazarusidestrconsts.srkmecselgotoxy
msgid "Select Goto XY"
msgstr "Выделить до координаты XY"
#: lazarusidestrconsts.srkmecselhalfwordleft
msgid "Select part-word left (e.g. CamelCase)"
msgstr "Выделить часть слова слева (например, смешанный регистр)"
#: lazarusidestrconsts.srkmecselhalfwordright
msgid "Select part-word right (e.g. CamelCase)"
msgstr "Выделить часть слова справа (например, смешанный регистр)"
#: lazarusidestrconsts.srkmecselleft
msgid "Select Left"
msgstr "Выделить слева"
#: lazarusidestrconsts.srkmecsellineend
msgctxt "lazarusidestrconsts.srkmecsellineend"
msgid "Select Line End"
msgstr "Выделить конец строки"
#: lazarusidestrconsts.srkmecsellinestart
msgctxt "lazarusidestrconsts.srkmecsellinestart"
msgid "Select Line Start"
msgstr "Выделить начало строки"
#: lazarusidestrconsts.srkmecsellinetextstart
msgid "Select to text start in line"
msgstr "Выделить до начала текста в строке"
#: lazarusidestrconsts.srkmecselpagebottom
msgctxt "lazarusidestrconsts.srkmecselpagebottom"
msgid "Select Page Bottom"
msgstr "Выделить низ страницы"
#: lazarusidestrconsts.srkmecselpagedown
msgid "Select Page Down"
msgstr "Выделить страницу снизу"
#: lazarusidestrconsts.srkmecselpageleft
msgid "Select Page Left"
msgstr "Выделить страницу слева"
#: lazarusidestrconsts.srkmecselpageright
msgid "Select Page Right"
msgstr "Выделить страницу справа"
#: lazarusidestrconsts.srkmecselpagetop
msgctxt "lazarusidestrconsts.srkmecselpagetop"
msgid "Select Page Top"
msgstr "Выделить верх страницы"
#: lazarusidestrconsts.srkmecselpageup
msgid "Select Page Up"
msgstr "Выделить страницу сверху"
#: lazarusidestrconsts.srkmecselright
msgid "Select Right"
msgstr "Выделить справа"
#: lazarusidestrconsts.srkmecselsmartwordleft
msgid "Smart select word left (start/end of word)"
msgstr "Умно выделить слово слева (начало/конец слова)"
#: lazarusidestrconsts.srkmecselsmartwordright
msgid "Smart select word right (start/end of word)"
msgstr "Умно выделить слово справа (начало/конец слова)"
#: lazarusidestrconsts.srkmecselsticky
msgid "Start sticky selecting"
msgstr "Начать выделение с привязкой"
#: lazarusidestrconsts.srkmecselstickycol
msgid "Start sticky selecting (Columns)"
msgstr "Начать выделение с привязкой (столбцы)"
#: lazarusidestrconsts.srkmecselstickyline
msgid "Start sticky selecting (Line)"
msgstr "Начать выделение с привязкой (строки)"
#: lazarusidestrconsts.srkmecselstickystop
msgid "Stop sticky selecting"
msgstr "Окончить выделение с привязкой"
#: lazarusidestrconsts.srkmecselup
msgid "Select Up"
msgstr "Выделить сверху"
#: lazarusidestrconsts.srkmecselwordendleft
msgid "Select word-end left"
msgstr "Выделить до конца слова слева"
#: lazarusidestrconsts.srkmecselwordendright
msgid "Select word-end right"
msgstr "Выделить до конца слова справа"
#: lazarusidestrconsts.srkmecselwordleft
msgctxt "lazarusidestrconsts.srkmecselwordleft"
msgid "Select Word Left"
msgstr "Выделить слово слева"
#: lazarusidestrconsts.srkmecselwordright
msgctxt "lazarusidestrconsts.srkmecselwordright"
msgid "Select Word Right"
msgstr "Выделить слово справа"
#: lazarusidestrconsts.srkmecsetfreebookmark
msgctxt "lazarusidestrconsts.srkmecsetfreebookmark"
msgid "Set a free Bookmark"
msgstr "Установить свободную закладку"
#: lazarusidestrconsts.srkmecsetmarker
#, object-pascal-format
msgid "Set bookmark %d"
msgstr "Установить закладку %d"
#: lazarusidestrconsts.srkmecshifttab
msgid "Shift Tab"
msgstr "Сдвинуть ТАБ"
#: lazarusidestrconsts.srkmecshowabstractmethods
msgid "Show Abstract Methods"
msgstr "Показать абстрактные методы"
#: lazarusidestrconsts.srkmecshowcodecontext
msgid "Show Code Context"
msgstr "Показать контекст кода"
#: lazarusidestrconsts.srkmecshowexecutionpoint
msgid "show execution point"
msgstr "показать точку исполнения"
#: lazarusidestrconsts.srkmecsmartwordleft
msgid "Smart move cursor left (start/end of word)"
msgstr "Умно переместить курсор влево (начало/конец слова)"
#: lazarusidestrconsts.srkmecsmartwordright
msgid "Smart move cursor right (start/end of word)"
msgstr "Умно переместить курсор вправо (начало/конец слова)"
#: lazarusidestrconsts.srkmecstopprogram
msgid "stop program"
msgstr "остановить программу"
#: lazarusidestrconsts.srkmecsynmacroplay
msgid "Play Macro"
msgstr "Воспроизвести макрос"
#: lazarusidestrconsts.srkmecsynmacrorecord
msgid "Record Macro"
msgstr "Записать макрос"
#: lazarusidestrconsts.srkmecsynpsyncroedaddcell
msgid "Add Cell"
msgstr "Добавить поле"
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellcase
msgid "Add Cell (case-sensitive)"
msgstr "Добавить поле (с учётом регистра)"
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctx
msgid "Add Cell (context-sensitive)"
msgstr "Добавить поле (с учётом контекста)"
#: lazarusidestrconsts.srkmecsynpsyncroedaddcellctxcase
msgid "Add Cell (context & case-sensitive)"
msgstr "Добавить поле (с учётом контекста и регистра)"
#: lazarusidestrconsts.srkmecsynpsyncroedcellend
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellend"
msgid "Goto last pos in cell"
msgstr "Перейти к концу поля"
#: lazarusidestrconsts.srkmecsynpsyncroedcellhome
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedcellhome"
msgid "Goto first pos in cell"
msgstr "Перейти к началу поля"
#: lazarusidestrconsts.srkmecsynpsyncroedcellselect
msgid "Select Cell"
msgstr "Выбрать поле"
#: lazarusidestrconsts.srkmecsynpsyncroeddelcell
msgid "Remove current Cell"
msgstr "Удалить текущее поле"
#: lazarusidestrconsts.srkmecsynpsyncroedescape
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedescape"
msgid "Escape"
msgstr "Отменить"
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellleft
msgid "Grow cell on the left"
msgstr "Удлинить поле по левому краю"
#: lazarusidestrconsts.srkmecsynpsyncroedgrowcellright
msgid "Grow cell on the right"
msgstr "Удлинить поле по правому краю"
#: lazarusidestrconsts.srkmecsynpsyncroednextcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcell"
msgid "Next Cell"
msgstr "Следующее поле"
#: lazarusidestrconsts.srkmecsynpsyncroednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Следующее поле (все выбранные)"
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Следующее поле (первое вхождение)"
#: lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Следующее поле (все выбранные / первое вхождение)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcell"
msgid "Previous Cell"
msgstr "Предыдущее поле"
#: lazarusidestrconsts.srkmecsynpsyncroedprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Предыдущее поле (все выбранные)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Предыдущее поле (первое вхождение)"
#: lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynpsyncroedprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Предыдущее поле (все выбранные / первое вхождение)"
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellleft
msgid "Shrink cell on the left"
msgstr "Укоротить поле по левому краю"
#: lazarusidestrconsts.srkmecsynpsyncroedshrinkcellright
msgid "Shrink cell on the right"
msgstr "Укоротить поле по правому краю"
#: lazarusidestrconsts.srkmecsynpsyncroedstart
msgid "Start Syncro edit"
msgstr "Начать синхронное редактирование"
#: lazarusidestrconsts.srkmecsynpsyncroedstartcase
msgid "Start Syncro edit (case-sensitive)"
msgstr "Начать синхронное редактирование (с учётом регистра)"
#: lazarusidestrconsts.srkmecsynpsyncroedstartctx
msgid "Start Syncro edit (context-sensitive)"
msgstr "Начать синхронное редактирование (с учётом контекста)"
#: lazarusidestrconsts.srkmecsynpsyncroedstartctxcase
msgid "Start Syncro edit (context & case-sensitive)"
msgstr "Начать синхронное редактирование (с учётом контекста и регистра)"
#: lazarusidestrconsts.srkmecsynptmpledcellend
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellend"
msgid "Goto last pos in cell"
msgstr "Перейти к концу поля"
#: lazarusidestrconsts.srkmecsynptmpledcellhome
msgctxt "lazarusidestrconsts.srkmecsynptmpledcellhome"
msgid "Goto first pos in cell"
msgstr "Перейти к началу поля"
#: lazarusidestrconsts.srkmecsynptmpledcellselect
msgid "Select cell"
msgstr "Выбрать поле"
#: lazarusidestrconsts.srkmecsynptmpledescape
msgctxt "lazarusidestrconsts.srkmecsynptmpledescape"
msgid "Escape"
msgstr "Отменить"
#: lazarusidestrconsts.srkmecsynptmpledfinish
msgid "Finish"
msgstr "Завершить"
#: lazarusidestrconsts.srkmecsynptmplednextcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcell"
msgid "Next Cell"
msgstr "Следующее поле"
#: lazarusidestrconsts.srkmecsynptmplednextcellrotate
msgid "Next Cell (rotate)"
msgstr "Следующее поле (по кругу)"
#: lazarusidestrconsts.srkmecsynptmplednextcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextcellsel"
msgid "Next Cell (all selected)"
msgstr "Следующее поле (все выбранные)"
#: lazarusidestrconsts.srkmecsynptmplednextcellselrotate
msgid "Next Cell (rotate / all selected)"
msgstr "Следующее поле (по кругу / все выбранные)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcell"
msgid "Next Cell (firsts only)"
msgstr "Следующее поле (первое вхождение)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellrotate
msgid "Next Cell (rotate / firsts only)"
msgstr "Следующее поле (по кругу / первое вхождение)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmplednextfirstcellsel"
msgid "Next Cell (all selected / firsts only)"
msgstr "Следующее поле (все выбранные / первое вхождение)"
#: lazarusidestrconsts.srkmecsynptmplednextfirstcellselrotate
msgid "Next Cell (rotate / all selected / firsts only)"
msgstr "Следующее поле (по кругу / все выбранные / первое вхождение)"
#: lazarusidestrconsts.srkmecsynptmpledprevcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcell"
msgid "Previous Cell"
msgstr "Предыдущее поле"
#: lazarusidestrconsts.srkmecsynptmpledprevcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevcellsel"
msgid "Previous Cell (all selected)"
msgstr "Предыдущее поле (все выбранные)"
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcell
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcell"
msgid "Previous Cell (firsts only)"
msgstr "Предыдущее поле (первое вхождение)"
#: lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel
msgctxt "lazarusidestrconsts.srkmecsynptmpledprevfirstcellsel"
msgid "Previous Cell (all selected / firsts only)"
msgstr "Предыдущее поле (все выбранные / первое вхождение)"
#: lazarusidestrconsts.srkmecsyntaxcheck
msgid "Syntax Check"
msgstr "Проверить синтаксис"
#: lazarusidestrconsts.srkmectoggleassembler
msgid "View assembler"
msgstr "Просмотр кода ассемблера"
#: lazarusidestrconsts.srkmectogglebreakpoint
msgid "toggle breakpoint"
msgstr "Переключить точку останова"
#: lazarusidestrconsts.srkmectogglebreakpointenabled
msgid "enable/disable breakpoint"
msgstr "Включить/выключить точку останова"
#: lazarusidestrconsts.srkmectogglebreakpoints
msgid "View breakpoints"
msgstr "Просмотр точек останова"
#: lazarusidestrconsts.srkmectogglecallstack
msgid "View call stack"
msgstr "Просмотр стека вызовов"
#: lazarusidestrconsts.srkmectogglecodebrowser
msgid "View code browser"
msgstr "Показать браузер кода"
#: lazarusidestrconsts.srkmectogglecodeexpl
msgid "View Code Explorer"
msgstr "Показать обозреватель кода"
#: lazarusidestrconsts.srkmectogglecomppalette
msgid "View component palette"
msgstr "Показать палитру компонентов"
#: lazarusidestrconsts.srkmectoggledebuggerout
msgid "View debugger output"
msgstr "Просмотр вывода отладчика"
#: lazarusidestrconsts.srkmectoggleformunit
msgid "Switch between form and unit"
msgstr "Переключить модуль/форму"
#: lazarusidestrconsts.srkmectogglefpdoceditor
msgid "View Documentation Editor"
msgstr "Показать редактор документации"
#: lazarusidestrconsts.srkmectoggleidespeedbtns
msgctxt "lazarusidestrconsts.srkmectoggleidespeedbtns"
msgid "View IDE speed buttons"
msgstr "Показывать кнопки быстрого доступа IDE"
#: lazarusidestrconsts.srkmectogglelocals
msgid "View local variables"
msgstr "Просмотр локальных переменных"
#: lazarusidestrconsts.srkmectogglemarker
#, object-pascal-format
msgid "Toggle bookmark %d"
msgstr "Переключить закладку %d"
#: lazarusidestrconsts.srkmectogglemarkupword
msgid "Toggle Current-Word highlight"
msgstr "Переключение режима подсветки текущего слова"
#: lazarusidestrconsts.srkmectogglememviewer
msgctxt "lazarusidestrconsts.srkmectogglememviewer"
msgid "View Mem viewer"
msgstr "Показать средство просмотра памяти"
#: lazarusidestrconsts.srkmectogglemessages
msgid "View messages"
msgstr "Просмотр сообщений"
#: lazarusidestrconsts.srkmectogglemode
msgid "Toggle Mode"
msgstr "Переключить режим"
#: lazarusidestrconsts.srkmectoggleobjectinsp
msgid "View Object Inspector"
msgstr "Показать инспектор объектов"
#: lazarusidestrconsts.srkmectoggleregisters
msgid "View registers"
msgstr "Просмотр значений регистров"
#: lazarusidestrconsts.srkmectogglerestrictionbrowser
msgid "View restriction browser"
msgstr "Показать браузер ограничений"
#: lazarusidestrconsts.srkmectogglesearchresults
msgid "View Search Results"
msgstr "Показать результаты поиска"
#: lazarusidestrconsts.srkmectogglesourceeditor
msgid "View Source Editor"
msgstr "Показать редактор исходного кода"
#: lazarusidestrconsts.srkmectogglewatches
msgid "View watches"
msgstr "Показать наблюдения"
#: lazarusidestrconsts.srkmecunfoldall
msgctxt "lazarusidestrconsts.srkmecunfoldall"
msgid "Unfold all"
msgstr "Развернуть всё"
#: lazarusidestrconsts.srkmecunfoldcurrent
msgid "Unfold at Cursor"
msgstr "Развернуть текст под курсором"
#: lazarusidestrconsts.srkmecunknown
msgid "unknown editor command"
msgstr "неизвестная команда редактора"
#: lazarusidestrconsts.srkmecunusedunits
msgid "Unused Units ..."
msgstr "Неиспользуемые модули ..."
#: lazarusidestrconsts.srkmecup
msgid "Move cursor up"
msgstr "Переместить курсор вверх"
#: lazarusidestrconsts.srkmecviewanchoreditor
msgid "View anchor editor"
msgstr "Показать редактор привязок"
#: lazarusidestrconsts.srkmecviewcomponents
msgid "View components"
msgstr "Показать список компонентов"
#: lazarusidestrconsts.srkmecvieweditormacros
msgid "View editor macros"
msgstr "Показать макросы редактора"
#: lazarusidestrconsts.srkmecviewforms
msgid "View forms"
msgstr "Показать формы"
#: lazarusidestrconsts.srkmecviewhistory
msgctxt "lazarusidestrconsts.srkmecviewhistory"
msgid "View History"
msgstr "Показать историю"
#: lazarusidestrconsts.srkmecviewpseudoterminal
msgctxt "lazarusidestrconsts.srkmecviewpseudoterminal"
msgid "View console in/output"
msgstr "Показать ввод/вывод в консоли"
#: lazarusidestrconsts.srkmecviewtaborder
msgid "View Tab Order"
msgstr "Показать порядок перехода"
#: lazarusidestrconsts.srkmecviewthreads
msgctxt "lazarusidestrconsts.srkmecviewthreads"
msgid "View Threads"
msgstr "Показать потоки исполнения"
#: lazarusidestrconsts.srkmecviewunitdependencies
msgid "View unit dependencies"
msgstr "Показать зависимости модулей"
#: lazarusidestrconsts.srkmecviewunitinfo
msgid "View unit information"
msgstr "Показать сведения о модуле"
#: lazarusidestrconsts.srkmecviewunits
msgid "View units"
msgstr "Показать модули"
#: lazarusidestrconsts.srkmecwordcompletion
msgid "Word Completion"
msgstr "Завершить слово"
#: lazarusidestrconsts.srkmecwordendleft
msgid "Move cursor word-end left"
msgstr "Переместить курсор на конец слова слева"
#: lazarusidestrconsts.srkmecwordendright
msgid "Move cursor word-end right"
msgstr "Переместить курсор на конец слова справа"
#: lazarusidestrconsts.srkmecwordleft
msgid "Move cursor word left"
msgstr "Переместить курсор на слово влево"
#: lazarusidestrconsts.srkmecwordright
msgid "Move cursor word right"
msgstr "Переместить курсор на слово вправо"
#: lazarusidestrconsts.srkmeczoomin
msgid "Zoom in"
msgstr "Увеличить масштаб"
#: lazarusidestrconsts.srkmeczoomout
msgid "Zoom out"
msgstr "Уменьшить масштаб"
#: lazarusidestrconsts.srkmeditforcmd
msgid "Edit keys of command"
msgstr "Редактирование клавиш вызова команды"
#: lazarusidestrconsts.synfcontinuewithnextmouseupaction
msgid "Continue with next mouse up action"
msgstr "Выполнить также следующее действие при отпускании кнопки мыши"
#: lazarusidestrconsts.synffoldcomments
msgid "Fold comments"
msgstr "Свернуть комментарии"
#: lazarusidestrconsts.synffoldcommentsinselection
msgid "Fold comments in selection"
msgstr "Свернуть комментарии в выделенном"
#: lazarusidestrconsts.synffoldinactiveifdef
msgid "Fold inactive Ifdef"
msgstr "Свернуть неактивный блок IFDEF"
#: lazarusidestrconsts.synffoldinactiveifdefexcludemixedstate
msgid "Fold inactive Ifdef (exclude mixed state)"
msgstr "Свернуть неактивный блок IFDEF (за исключением условно активных)"
#: lazarusidestrconsts.synffoldinactiveifdefinselection
msgid "Fold inactive Ifdef in selection"
msgstr "Свернуть неактивный блок IFDEF в выделенном"
#: lazarusidestrconsts.synffoldinactiveifdefinselectionexcludemixedstate
msgid "Fold inactive Ifdef in selection (exclude mixed state)"
msgstr "Свернуть неактивный блок IFDEF в выделенном (за исключением условно активных)"
#: lazarusidestrconsts.synfhidecomments
msgid "Hide comments"
msgstr "Скрыть комментарии"
#: lazarusidestrconsts.synfhidecommentsinselection
msgid "Hide comments in selection"
msgstr "Скрыть комментарии в выделенном"
#: lazarusidestrconsts.synfmatchactionbuttonofmousedown
msgid "Match action button of mouse down"
msgstr "Учитывать кнопку мыши при её нажатии"
#: lazarusidestrconsts.synfmatchactionlineofmousedown
msgid "Match action line of mouse down"
msgstr "Учитывать строку при нажатии кнопки мыши"
#: lazarusidestrconsts.synfmatchactionmodifiersofmousedown
msgid "Match action modifiers of mouse down"
msgstr "Учитывать модификаторы при нажатии кнопки мыши"
#: lazarusidestrconsts.synfmatchactionposofmousedown
msgid "Match action pos of mouse down"
msgstr "Учитывать положение мыши при нажатии кнопки"
#: lazarusidestrconsts.synfsearchallactionofmousedown
msgid "Search all action of mouse down"
msgstr "Искать все действия при нажатии кнопки мыши"
#: lazarusidestrconsts.synfunfoldactiveifdef
msgid "Unfold active Ifdef"
msgstr "Развернуть активный блок IFDEF"
#: lazarusidestrconsts.synfunfoldactiveifdefinselection
msgid "Unfold active Ifdef in selection"
msgstr "Развернуть активный блок IFDEF в выделенном"
#: lazarusidestrconsts.synfunfoldall
msgctxt "lazarusidestrconsts.synfunfoldall"
msgid "Unfold all"
msgstr "Развернуть всё"
#: lazarusidestrconsts.synfunfoldallifdef
msgid "Unfold all Ifdef"
msgstr "Развернуть все блоки IFDEF"
#: lazarusidestrconsts.synfunfoldallifdefinselection
msgid "Unfold all Ifdef in selection"
msgstr "Развернуть все блоки IFDEF в выделенном"
#: lazarusidestrconsts.synfunfoldallinselection
msgid "Unfold all in selection"
msgstr "Развернуть всё в выделенном"
#: lazarusidestrconsts.synfunfoldcomments
msgid "Unfold comments"
msgstr "Развернуть комментарии"
#: lazarusidestrconsts.synfunfoldcommentsinselection
msgid "Unfold comments in selection"
msgstr "Развернуть комментарии в выделенном"
#: lazarusidestrconsts.synfunfoldinactiveifdef
msgid "Unfold inactive Ifdef"
msgstr "Развернуть неактивный блок IFDEF"
#: lazarusidestrconsts.synfunfoldinactiveifdefinselection
msgid "Unfold inactive Ifdef in selection"
msgstr "Развернуть неактивный блок IFDEF в выделенном"
#: lazarusidestrconsts.uefilerocap
msgid "File is readonly"
msgstr "Файл только для чтения"
#: lazarusidestrconsts.uefilerotext1
msgid "The file \""
msgstr "Файл \""
#: lazarusidestrconsts.uefilerotext2
msgid "\" is not writable."
msgstr "\" не для записи."
#: lazarusidestrconsts.uelocked
msgid "Locked"
msgstr "Зафиксирован"
#: lazarusidestrconsts.uemacrorecording
msgid "Recording"
msgstr "Идёт запись"
#: lazarusidestrconsts.uemacrorecordingpaused
msgid "Rec-pause"
msgstr "Запись приостановлена"
#: lazarusidestrconsts.uemaddwatchatcursor
msgid "Add &Watch At Cursor"
msgstr "Добавить &наблюдение у курсора"
#: lazarusidestrconsts.uemaddwatchpointatcursor
msgid "Add Watch&Point At Cursor"
msgstr "Добавить точку останова с наблюдением у &курсора"
#: lazarusidestrconsts.uembookmarknset
#, object-pascal-format
msgid "Bookmark &%s: %s"
msgstr "Закладка &%s: %s"
#: lazarusidestrconsts.uembookmarknunset
#, object-pascal-format
msgid "Bookmark &%s"
msgstr "Закладка &%s"
#: lazarusidestrconsts.uembookmarknunsetdisabled
#, object-pascal-format
msgid "Bookmark %s"
msgstr "Закладка %s"
#: lazarusidestrconsts.uemcloseotherpages
msgid "Close All &Other Pages"
msgstr "Закрыть &прочие вкладки"
#: lazarusidestrconsts.uemcloseotherpagesplain
msgid "Close All Other Pages"
msgstr "Закрыть прочие вкладки"
#: lazarusidestrconsts.uemcloseotherpagesright
msgid "Close Pages on the &Right"
msgstr "Закрыть вкладки &справа"
#: lazarusidestrconsts.uemcloseotherpagesrightplain
msgid "Close Pages on the Right"
msgstr "Закрыть вкладки справа"
#: lazarusidestrconsts.uemclosepage
msgid "&Close Page"
msgstr "&Закрыть вкладку"
#: lazarusidestrconsts.uemcopyfilename
msgid "Copy Filename"
msgstr "Копировать имя файла"
#: lazarusidestrconsts.uemcopytonewwindow
msgid "Clone to New Window"
msgstr "Клонировать в новом окне"
#: lazarusidestrconsts.uemcopytootherwindow
msgid "Clone to Other Window"
msgstr "Клонировать в другом окне"
#: lazarusidestrconsts.uemcopytootherwindownew
msgctxt "lazarusidestrconsts.uemcopytootherwindownew"
msgid "New Window"
msgstr "Новое окно"
#: lazarusidestrconsts.uemdebugword
msgctxt "lazarusidestrconsts.uemdebugword"
msgid "Debug"
msgstr "Отладка"
#: lazarusidestrconsts.uemencoding
msgid "Encoding"
msgstr "Кодировка"
#: lazarusidestrconsts.uemevaluatemodify
msgid "&Evaluate/Modify ..."
msgstr "&Вычислить/Изменить ..."
#: lazarusidestrconsts.uemfinddeclaration
msgid "&Find Declaration"
msgstr "&Найти объявление"
#: lazarusidestrconsts.uemfindinotherwindow
msgid "Find in other Window"
msgstr "Найти в другом окне"
#: lazarusidestrconsts.uemgotobookmark
msgid "&Goto Bookmark"
msgstr "&Перейти по закладке"
#: lazarusidestrconsts.uemgotobookmarks
msgid "Goto Bookmark ..."
msgstr "Перейти по закладке ..."
#: lazarusidestrconsts.uemhighlighter
msgid "Highlighter"
msgstr "Подсветка синтаксиса"
#: lazarusidestrconsts.ueminspect
msgctxt "lazarusidestrconsts.ueminspect"
msgid "&Inspect ..."
msgstr "&Просмотреть ..."
#: lazarusidestrconsts.ueminvertassignment
msgctxt "lazarusidestrconsts.ueminvertassignment"
msgid "Invert Assignment"
msgstr "Обратить присваивание"
#: lazarusidestrconsts.uemlineending
msgid "Line Ending"
msgstr "Конец строки"
#: lazarusidestrconsts.uemlockpage
msgid "&Lock Page"
msgstr "З&афиксировать положение в редакторе"
#: lazarusidestrconsts.uemmovepageleft
msgid "Move Page Left"
msgstr "Переместить вкладку влево"
#: lazarusidestrconsts.uemmovepageleftmost
msgid "Move Page Leftmost"
msgstr "Поместить вкладку слева"
#: lazarusidestrconsts.uemmovepageright
msgid "Move Page Right"
msgstr "Переместить вкладку вправо"
#: lazarusidestrconsts.uemmovepagerightmost
msgid "Move Page Rightmost"
msgstr "Поместить вкладку справа"
#: lazarusidestrconsts.uemmovetonewwindow
msgid "Move to New Window"
msgstr "Переместить в новое окно"
#: lazarusidestrconsts.uemmovetootherwindow
msgid "Move to Other Window"
msgstr "Переместить в другое окно"
#: lazarusidestrconsts.uemmovetootherwindownew
msgctxt "lazarusidestrconsts.uemmovetootherwindownew"
msgid "New Window"
msgstr "Новое окно"
#: lazarusidestrconsts.uemnextbookmark
msgid "Goto Next Bookmark"
msgstr "Перейти к следующей закладке"
#: lazarusidestrconsts.uemodified
msgid "Modified"
msgstr "Изменён"
#: lazarusidestrconsts.uemopenfileatcursor
msgid "&Open File at Cursor"
msgstr "&Открыть файл у курсора"
#: lazarusidestrconsts.uemprevbookmark
msgid "Goto Previous Bookmark"
msgstr "Перейти к предыдущей закладке"
#: lazarusidestrconsts.uemprocedurejump
msgid "Procedure Jump"
msgstr "Перейти к процедуре"
#: lazarusidestrconsts.uemreadonly
msgctxt "lazarusidestrconsts.uemreadonly"
msgid "Read Only"
msgstr "Только чтение"
#: lazarusidestrconsts.uemrefactor
msgid "Refactoring"
msgstr "Переработка кода"
#: lazarusidestrconsts.uemsetfreebookmark
msgctxt "lazarusidestrconsts.uemsetfreebookmark"
msgid "Set a Free Bookmark"
msgstr "Установить свободную закладку"
#: lazarusidestrconsts.uemshowlinenumbers
msgid "Show Line Numbers"
msgstr "Показывать номера строк"
#: lazarusidestrconsts.uemsource
msgctxt "lazarusidestrconsts.uemsource"
msgid "Source"
msgstr "Исходный код"
#: lazarusidestrconsts.uemtogglebookmark
msgid "&Toggle Bookmark"
msgstr "П&ереключить закладку"
#: lazarusidestrconsts.uemtogglebookmarknset
#, object-pascal-format
msgid "Toggle Bookmark &%s: %s"
msgstr "Переключить закладку &%s: %s"
#: lazarusidestrconsts.uemtogglebookmarknunset
#, object-pascal-format
msgid "Toggle Bookmark &%s"
msgstr "Переключить закладку &%s"
#: lazarusidestrconsts.uemtogglebookmarks
msgid "Toggle Bookmark ..."
msgstr "Переключить закладку ..."
#: lazarusidestrconsts.uemtogglebreakpoint
msgid "Toggle &Breakpoint"
msgstr "П&ереключить точку останова"
#: lazarusidestrconsts.uemviewcallstack
msgctxt "lazarusidestrconsts.uemviewcallstack"
msgid "View Call Stack"
msgstr "Показать стек вызовов"
#: lazarusidestrconsts.uenotimplcap
msgid "Not implemented yet"
msgstr "Еще не реализовано"
#: lazarusidestrconsts.uepins
msgid "INS"
msgstr "ВСТ"
#: lazarusidestrconsts.uepovr
msgid "OVR"
msgstr "ЗАМ"
#: lazarusidestrconsts.uepreadonly
msgid "Readonly"
msgstr "Только чтение"
#: lazarusidestrconsts.uepselchars
#, object-pascal-format
msgid "%d"
msgstr "%d"
#: lazarusidestrconsts.uepselcol
msgid "COL"
msgstr "СТЛБ"
#: lazarusidestrconsts.uepselcxchars
#, object-pascal-format
msgid "%d * %d"
msgstr "%d * %d"
#: lazarusidestrconsts.uepselline
msgctxt "lazarusidestrconsts.uepselline"
msgid "LINE"
msgstr "СТРК"
#: lazarusidestrconsts.uepselnorm
msgid "DEF"
msgstr "УМЛЧ"
#: lazarusidestrconsts.unitdepoptionsforpackage
msgid "Options for Package graph"
msgstr "Параметры диаграммы пакетов"
#: lazarusidestrconsts.unitdepoptionsforunit
msgid "Options for Unit graph"
msgstr "Параметры диаграммы модулей"
#: lazarusidestrconsts.versioninfotitle
msgid "Version Info"
msgstr "Сведения о версии"
|