File: example.aln

package info (click to toggle)
libbpp-seq 2.4.1-3
  • links: PTS, VCS
  • area: main
  • in suites: buster
  • size: 3,008 kB
  • sloc: cpp: 18,259; perl: 2,501; makefile: 28
file content (2143 lines) | stat: -rw-r--r-- 157,006 bytes parent folder | download | duplicates (6)
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362
363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410
411
412
413
414
415
416
417
418
419
420
421
422
423
424
425
426
427
428
429
430
431
432
433
434
435
436
437
438
439
440
441
442
443
444
445
446
447
448
449
450
451
452
453
454
455
456
457
458
459
460
461
462
463
464
465
466
467
468
469
470
471
472
473
474
475
476
477
478
479
480
481
482
483
484
485
486
487
488
489
490
491
492
493
494
495
496
497
498
499
500
501
502
503
504
505
506
507
508
509
510
511
512
513
514
515
516
517
518
519
520
521
522
523
524
525
526
527
528
529
530
531
532
533
534
535
536
537
538
539
540
541
542
543
544
545
546
547
548
549
550
551
552
553
554
555
556
557
558
559
560
561
562
563
564
565
566
567
568
569
570
571
572
573
574
575
576
577
578
579
580
581
582
583
584
585
586
587
588
589
590
591
592
593
594
595
596
597
598
599
600
601
602
603
604
605
606
607
608
609
610
611
612
613
614
615
616
617
618
619
620
621
622
623
624
625
626
627
628
629
630
631
632
633
634
635
636
637
638
639
640
641
642
643
644
645
646
647
648
649
650
651
652
653
654
655
656
657
658
659
660
661
662
663
664
665
666
667
668
669
670
671
672
673
674
675
676
677
678
679
680
681
682
683
684
685
686
687
688
689
690
691
692
693
694
695
696
697
698
699
700
701
702
703
704
705
706
707
708
709
710
711
712
713
714
715
716
717
718
719
720
721
722
723
724
725
726
727
728
729
730
731
732
733
734
735
736
737
738
739
740
741
742
743
744
745
746
747
748
749
750
751
752
753
754
755
756
757
758
759
760
761
762
763
764
765
766
767
768
769
770
771
772
773
774
775
776
777
778
779
780
781
782
783
784
785
786
787
788
789
790
791
792
793
794
795
796
797
798
799
800
801
802
803
804
805
806
807
808
809
810
811
812
813
814
815
816
817
818
819
820
821
822
823
824
825
826
827
828
829
830
831
832
833
834
835
836
837
838
839
840
841
842
843
844
845
846
847
848
849
850
851
852
853
854
855
856
857
858
859
860
861
862
863
864
865
866
867
868
869
870
871
872
873
874
875
876
877
878
879
880
881
882
883
884
885
886
887
888
889
890
891
892
893
894
895
896
897
898
899
900
901
902
903
904
905
906
907
908
909
910
911
912
913
914
915
916
917
918
919
920
921
922
923
924
925
926
927
928
929
930
931
932
933
934
935
936
937
938
939
940
941
942
943
944
945
946
947
948
949
950
951
952
953
954
955
956
957
958
959
960
961
962
963
964
965
966
967
968
969
970
971
972
973
974
975
976
977
978
979
980
981
982
983
984
985
986
987
988
989
990
991
992
993
994
995
996
997
998
999
1000
1001
1002
1003
1004
1005
1006
1007
1008
1009
1010
1011
1012
1013
1014
1015
1016
1017
1018
1019
1020
1021
1022
1023
1024
1025
1026
1027
1028
1029
1030
1031
1032
1033
1034
1035
1036
1037
1038
1039
1040
1041
1042
1043
1044
1045
1046
1047
1048
1049
1050
1051
1052
1053
1054
1055
1056
1057
1058
1059
1060
1061
1062
1063
1064
1065
1066
1067
1068
1069
1070
1071
1072
1073
1074
1075
1076
1077
1078
1079
1080
1081
1082
1083
1084
1085
1086
1087
1088
1089
1090
1091
1092
1093
1094
1095
1096
1097
1098
1099
1100
1101
1102
1103
1104
1105
1106
1107
1108
1109
1110
1111
1112
1113
1114
1115
1116
1117
1118
1119
1120
1121
1122
1123
1124
1125
1126
1127
1128
1129
1130
1131
1132
1133
1134
1135
1136
1137
1138
1139
1140
1141
1142
1143
1144
1145
1146
1147
1148
1149
1150
1151
1152
1153
1154
1155
1156
1157
1158
1159
1160
1161
1162
1163
1164
1165
1166
1167
1168
1169
1170
1171
1172
1173
1174
1175
1176
1177
1178
1179
1180
1181
1182
1183
1184
1185
1186
1187
1188
1189
1190
1191
1192
1193
1194
1195
1196
1197
1198
1199
1200
1201
1202
1203
1204
1205
1206
1207
1208
1209
1210
1211
1212
1213
1214
1215
1216
1217
1218
1219
1220
1221
1222
1223
1224
1225
1226
1227
1228
1229
1230
1231
1232
1233
1234
1235
1236
1237
1238
1239
1240
1241
1242
1243
1244
1245
1246
1247
1248
1249
1250
1251
1252
1253
1254
1255
1256
1257
1258
1259
1260
1261
1262
1263
1264
1265
1266
1267
1268
1269
1270
1271
1272
1273
1274
1275
1276
1277
1278
1279
1280
1281
1282
1283
1284
1285
1286
1287
1288
1289
1290
1291
1292
1293
1294
1295
1296
1297
1298
1299
1300
1301
1302
1303
1304
1305
1306
1307
1308
1309
1310
1311
1312
1313
1314
1315
1316
1317
1318
1319
1320
1321
1322
1323
1324
1325
1326
1327
1328
1329
1330
1331
1332
1333
1334
1335
1336
1337
1338
1339
1340
1341
1342
1343
1344
1345
1346
1347
1348
1349
1350
1351
1352
1353
1354
1355
1356
1357
1358
1359
1360
1361
1362
1363
1364
1365
1366
1367
1368
1369
1370
1371
1372
1373
1374
1375
1376
1377
1378
1379
1380
1381
1382
1383
1384
1385
1386
1387
1388
1389
1390
1391
1392
1393
1394
1395
1396
1397
1398
1399
1400
1401
1402
1403
1404
1405
1406
1407
1408
1409
1410
1411
1412
1413
1414
1415
1416
1417
1418
1419
1420
1421
1422
1423
1424
1425
1426
1427
1428
1429
1430
1431
1432
1433
1434
1435
1436
1437
1438
1439
1440
1441
1442
1443
1444
1445
1446
1447
1448
1449
1450
1451
1452
1453
1454
1455
1456
1457
1458
1459
1460
1461
1462
1463
1464
1465
1466
1467
1468
1469
1470
1471
1472
1473
1474
1475
1476
1477
1478
1479
1480
1481
1482
1483
1484
1485
1486
1487
1488
1489
1490
1491
1492
1493
1494
1495
1496
1497
1498
1499
1500
1501
1502
1503
1504
1505
1506
1507
1508
1509
1510
1511
1512
1513
1514
1515
1516
1517
1518
1519
1520
1521
1522
1523
1524
1525
1526
1527
1528
1529
1530
1531
1532
1533
1534
1535
1536
1537
1538
1539
1540
1541
1542
1543
1544
1545
1546
1547
1548
1549
1550
1551
1552
1553
1554
1555
1556
1557
1558
1559
1560
1561
1562
1563
1564
1565
1566
1567
1568
1569
1570
1571
1572
1573
1574
1575
1576
1577
1578
1579
1580
1581
1582
1583
1584
1585
1586
1587
1588
1589
1590
1591
1592
1593
1594
1595
1596
1597
1598
1599
1600
1601
1602
1603
1604
1605
1606
1607
1608
1609
1610
1611
1612
1613
1614
1615
1616
1617
1618
1619
1620
1621
1622
1623
1624
1625
1626
1627
1628
1629
1630
1631
1632
1633
1634
1635
1636
1637
1638
1639
1640
1641
1642
1643
1644
1645
1646
1647
1648
1649
1650
1651
1652
1653
1654
1655
1656
1657
1658
1659
1660
1661
1662
1663
1664
1665
1666
1667
1668
1669
1670
1671
1672
1673
1674
1675
1676
1677
1678
1679
1680
1681
1682
1683
1684
1685
1686
1687
1688
1689
1690
1691
1692
1693
1694
1695
1696
1697
1698
1699
1700
1701
1702
1703
1704
1705
1706
1707
1708
1709
1710
1711
1712
1713
1714
1715
1716
1717
1718
1719
1720
1721
1722
1723
1724
1725
1726
1727
1728
1729
1730
1731
1732
1733
1734
1735
1736
1737
1738
1739
1740
1741
1742
1743
1744
1745
1746
1747
1748
1749
1750
1751
1752
1753
1754
1755
1756
1757
1758
1759
1760
1761
1762
1763
1764
1765
1766
1767
1768
1769
1770
1771
1772
1773
1774
1775
1776
1777
1778
1779
1780
1781
1782
1783
1784
1785
1786
1787
1788
1789
1790
1791
1792
1793
1794
1795
1796
1797
1798
1799
1800
1801
1802
1803
1804
1805
1806
1807
1808
1809
1810
1811
1812
1813
1814
1815
1816
1817
1818
1819
1820
1821
1822
1823
1824
1825
1826
1827
1828
1829
1830
1831
1832
1833
1834
1835
1836
1837
1838
1839
1840
1841
1842
1843
1844
1845
1846
1847
1848
1849
1850
1851
1852
1853
1854
1855
1856
1857
1858
1859
1860
1861
1862
1863
1864
1865
1866
1867
1868
1869
1870
1871
1872
1873
1874
1875
1876
1877
1878
1879
1880
1881
1882
1883
1884
1885
1886
1887
1888
1889
1890
1891
1892
1893
1894
1895
1896
1897
1898
1899
1900
1901
1902
1903
1904
1905
1906
1907
1908
1909
1910
1911
1912
1913
1914
1915
1916
1917
1918
1919
1920
1921
1922
1923
1924
1925
1926
1927
1928
1929
1930
1931
1932
1933
1934
1935
1936
1937
1938
1939
1940
1941
1942
1943
1944
1945
1946
1947
1948
1949
1950
1951
1952
1953
1954
1955
1956
1957
1958
1959
1960
1961
1962
1963
1964
1965
1966
1967
1968
1969
1970
1971
1972
1973
1974
1975
1976
1977
1978
1979
1980
1981
1982
1983
1984
1985
1986
1987
1988
1989
1990
1991
1992
1993
1994
1995
1996
1997
1998
1999
2000
2001
2002
2003
2004
2005
2006
2007
2008
2009
2010
2011
2012
2013
2014
2015
2016
2017
2018
2019
2020
2021
2022
2023
2024
2025
2026
2027
2028
2029
2030
2031
2032
2033
2034
2035
2036
2037
2038
2039
2040
2041
2042
2043
2044
2045
2046
2047
2048
2049
2050
2051
2052
2053
2054
2055
2056
2057
2058
2059
2060
2061
2062
2063
2064
2065
2066
2067
2068
2069
2070
2071
2072
2073
2074
2075
2076
2077
2078
2079
2080
2081
2082
2083
2084
2085
2086
2087
2088
2089
2090
2091
2092
2093
2094
2095
2096
2097
2098
2099
2100
2101
2102
2103
2104
2105
2106
2107
2108
2109
2110
2111
2112
2113
2114
2115
2116
2117
2118
2119
2120
2121
2122
2123
2124
2125
2126
2127
2128
2129
2130
2131
2132
2133
2134
2135
2136
2137
2138
2139
2140
2141
2142
2143
CLUSTAL W (1.8) multiple sequence alignment


t73             LIVSQIRVMVRDG--IHKAMDEE-V------------LIARRVKPYSGNGTQVRNDVEDA
t66             LIVSQIRVMVRDG--IHKAMDEE-V------------LIARRVKPCSGNGTQVRNDVEDA
t32             LIVSQIRVMVRDG--IHKAMDEE-V------------LIARRVKPYSGNGTQVRNDVEDA
t75             LIVSEIRVMVRDE--VHKAMDEE-C------------LIARRVKPYSGNGNQIRNDIEDA
t79             LIVSEVRVMVRDG--LNIAIDEL-C------------LIANRVKTFSGSQNQVRNAVEDA
t27             LIVSEVRVMVRDG--LNIAIDEL-C------------LIANRVKTMSGSQNQVRNAVEDA
t93             LIVSEVRVMVRDG--LNIAIDEL-C------------LIANRVKTMSGSQNQVRNAVEDA
t59             LIVSEVRVMVRDG--LNIAIDEL-C------------LIANRVKTFSGSQNQVRNAVEDA
t7              LIVSEVRVMVRDG--LNIAIDEL-C------------LIANRVKKFSGSQGQVRNAIEDA
t78             LIVSEVRVMVRDG--LNIAIDEL-C------------LIANRVKTFSGSQGQVRNAIEDA
t12             LIVSEVRVMVRDG--INIAIDEL-C------------LIANRVKAFSGHQNQVRNAMEDA
t81             LIVSEVRHMVRDG--ANVAIDEL-C------------LIACRVKAFSGHGHQVRNAVEDA
t21             LIVSEVRHMVRDG--ANIAIDEL-C------------LIACRVKAFSGHGNQVRNAVEDA
t80             LIVSEVRHMVRDG--VNIAVDEI-C------------LIANRVKSMSGQGNQVRNAMEMA
t14             LIVSEVRHMVRDG--VNIAVDEI-C------------LIANRVKSMSGQGNQVRNAMEMA
t85             LIVSEVRHVVRDG--VNIAVDEI-C------------LIANRVKSMSGQGNQVRNAMEMA
t62             LIVSEVRVMVRDG--IHIAVDEI-C------------LIANRVKCMSGQGNQARNAMEMA
t19             LIVSEVRHMVRDG--INIAVDEI-C------------LIANRVKCVSGQGNQARNAMEMA
t77             LIVSEVRHMVRDG--INIAVDEI-C------------LIANRVKSMSGQGNQARNAMEMA
t88             LIVSECRLIIRDG--NHDAIDEM-CCVANDLNNEIERLVASMVKSFRGHDSQARNNSECM
t37             LIVSDMRLIIREG--NDDAIDEM-CCVANELNNVIERLVASMVKEFRGHDCQARNNSECI
t35             LIVSDMRLIIREG--NDDAIDEM-CCVANELNNVIERLVASMVKEFRGHDCQARNNSECI
t48             LIVSDMRLIIREG--SDDAIDEM-CCVANELNNVIERLVASMVKEFRGHDCQARNNSECI
t55             LIVSDMRLIIREG--NDDAIDEM-CCVANELNNVIERLVASMVKEFRGHDCQARNNSECI
t46             LIVSDMRLIIREG--NDDAIDEM-CCVANELNNVIERLVASMVKEFRGHDCQARNNSECI
t67             LIVSDMRLIIREG--NDDAIDEM-CCVANELNNVIERLVASMVKEFRGHDCQARNNSECI
t57             LIVSDMRLIIREG--NDDAIDEM-CCVANELNNVIERLVASMVKEFRGHDCQARNNSECI
t56             LIVSEWRLFIRDG--HDDAIDEM-CCEANELNNDIEKLVASMVKGFRGHDSQARNNAECI
t13             GIVSECRMIIRDE--HDDAIDEM-C------------LVASMVKKLSGCENQARNNHECA
t5              GIVSECRMIIRDE--HDDAIDEM-C------------LVASMVKKLSGCENQARNNHECA
t38             GIVSECRMIIRDE--SDDAIDEM-C------------LVASMVKKLSGCEDQARNNHECA
t33             GIVSECRMIIRDE--SDDAIDEM-C------------LVASMVKKLSGCEDQARNNHECA
t100            GIVSECRMIIRDE--SDDAIDEM-C------------LVASMVKKLSGCEDQARNNHECA
t34             GIVSECRMIIRDE--SDDAIDEM-C------------LVASMVKKLSGCEDQARNNHECA
t84             GIVSECRMIIRDE--SDDAIDEM-C------------LVASMVKKLSGCDDQARNNHECA
t92             GIVSECRMIIRDE--SDDAIDEM-C------------LVASMVKKLSGCEDQARNNHECA
t3              GIVSECRMIIRDE--SDDAIDEM-C------------LVASMVKKLSGCEQQARNNRECA
t22             GIVSECRVIIRDQ--SDDAIDER-Y------------LVASVVKRLSGCENQARNNRECA
t64             GIVSECRMIIRDE--TDDAIDEV-C------------LVASMVKKLSGCENQTRNNRECA
t18             GIVSECRMIIRDE--TDDAIDEV-C------------LVASMVKKLSGCENQTRNNRECA
t68             GIVSECRMIIRDE--TDDAIDEV-C------------LVASMVKKLSGCENQTRNNRECA
t28             GIVSECRMIIRDE--ADDAIDEM-C------------LVASMVKKLSGCENQARNNRECA
t82             GIVSECRMIIRDE--ADDAIDEM-C------------LVASMVKKLSGCENQARNNRECA
t41             GIVSECRMIIRDE--ADDAIDEM-C------------LVASMVKKLSGCENQARNNRECA
t71             GIVSECRMIIRDQ--SDDAIDEMVV------------LVASMVKEMSGCENQARNNSECA
t94             GIVSECRMIIRDQ--SDDAIDEMVC------------LVASMVKELSGCENQARNNRECA
t99             GIVSEVRMIIRDE--SDDAIDEM-C------------LVASMVKALSGCENQARNNRECA
t40             GIVSECRMIIRDE--SDDAIDEV-C------------LVASMVKALSGCENQARNNRECA
t90             GIVSECRMIIRDE--SDDAIDEV-C------------LVASMVKALSGCENQARNNRECA
t4              GIVSECRMIIRDE--PDDAIDEV-C------------LVASMVKELSGCENQARNNRECA
t36             MIWSEVRKMVRER--REQAIDNK-C------------LIAARVKMMSGYVLQVRNALEDA
t87             MIWSEVRKMVRER--REQAIDNK-C------------LIAARVKMMSGYMLQVRNALEDA
t89             MIWSEHRKMVREG--REQAIDNK-C------------LIAKRVKVMSGYILQVRNAPEDA
t39             MIWSEHRKMVREG--REQAIDNK-C------------LIAKRVKVMSGYILQVRNAPEDA
t8              MIWSEHRKMVREG--REQAIDNK-C------------LIAKRVKVMSGYILQVRNAPEDA
t6              MIWSEHRKMVREG--REQAIDNK-C------------LIAKRVKVMSGYILQVRNAPEDA
t58             MIWSEYRHMVREG--RDQAIDNK-C------------LIAARVKVMSGYVLQVRNAPEDA
t54             MIWSEYRHMVREG--RDQAIDNK-C------------LIAARVKVMSGYVLQVRNAPEDA
t65             MIWSEYRQMVREG--NDQSIDNK-C------------LIADRVKMMSGVVRQVRNAPEDA
t29             MIWSEYRQMVREG--NDQSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t98             MIWSEHRQMVREG--NDQSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t83             MIWSEYRQMVREG--NDQSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t95             MIWSEYRQMVREG--TDQSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t20             MIWSEYRQMVREG--TDQSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t69             MIWSDYRQMVREG--GDDSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t2              MIWSDYRQMVREG--GDDSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t10             MIWSDYRQMVREG--GDDSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t31             MIWSEYRSMVREG--ADQSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t15             MIWSEYRSMVREG--SDQSIDNH-C------------LIAARVKMMSGVVRQVRNAPEDA
t63             MIWSEYRSMVREG--SDQSIDNK-C------------LTAARVKLMSGVVRQVRNAPEDA
t50             MIWSEYRSMVREG--SDQSIDNK-C------------LTAARVKLMSGVVRQVRNAPEDA
t25             MIWSEYRSMVREG--SDQSIDNK-C------------LTAARVKMMSGVVRQVRNAPEDA
t51             MIWSEYRSMVREG--SDQSIDNK-C------------LIAARVKMMSGVVRQVRNAPEDA
t9              MIWSECRQMVREK--TDNAIDNQ-C------------LIAARVKENSGHVKQVRNDSEDI
t47             MIWSECRQMVREK--SDNAIDNQ-C------------QIAARVKRNSGHVKQVRNDSEDI
t60             MIWSECRQMVREK--TDNAIDNQ-C------------QIAARVKENSGHVKQVRNDSEDI
t30             MIWSECRQMVREK--TDNAIDNQ-C------------QIAARVKENSGHVKQVRNDSEDI
t70             MIWSECRQMVREK--NDNAIDNQ-C------------LIAARVKEDSGHVKQVRNASEDI
t91             MIWSECRQMVREK--NDNAIDNQ-C------------LIAARVKEDSGHVKQVRNASEDI
t49             MIWSECRQMVREK--NDNAIDNQ-C------------LIAARVKENSGHVKQVRNASEDI
t52             MIWSEERQMVREK--VDNAVDNQ-C------------LIAARVKENCGHVKQVRNASEDI
t43             MIWSEVRQMVREG--SDNAIDNR-C------------LIAARVKHVQGHVKQVRNANEDA
t1              MIWSEVRQMMREG--TDNAIDNQ-C------------LIAARVKHMQGHVKQVRNANEDA
t86             MIWSEVRQMVREG--TDNAIDNR-C------------LIAARVKPVQGHVKQVRNANEDA
t72             MIWSEVRQMVREG--TDNAIDNR-C------------LIAARVKHVQGHVKQVRNANEDA
t96             MIWSEVRQMVREG--TDNAIDNR-C------------LIAARVKHVQGHVKQVRNANEDA
t44             MIWSEVRQMVREG--TDNAIDTR-C------------LIAARVKHMQGHVKQVRNANEDA
t45             MIWSEVRQMVREG--TDNAIDNC-C------------LIAARVKHMQGHVKQVRNANEDA
t74             MIWSEVRQMVREG--TDNAIDNC-C------------LIAARVKHMQGHVKQVRNANEDA
t26             MIWSEVRQMVREG--TDNAIDNR-C------------LIAARVKHMSGHVKQVRNANEDA
t61             MIWSEVRQMVREG--TDNAIDNR-C------------LIAARVKHMSGHVKQVRNANEDA
t97             MIWSEVRQMVREG--TDNAIDNR-C------------LIAARVKHMSGHMKQVRNANEDA
t17             MIWSEVRQMVREG--ADNAIDNR-C------------LIAARVKHFSGHTKQVRNANEDA
t11             MIWSEVRQMVREG--TDNAIDNR-C------------LIAARVKHFSGHTKQVRNANEDA
t23             MIWSECQRMLREH--EDQAIANE-C------------LIAFKVKLVNGHVKQVRNASEDA
t76             LSSSHEVRVVNHKSKPDEHIADK-D------------MCADAMCNGSGHTGRIHNAVEGG
t53             LSSSHEVRVVNHKSKPDEHIADK-D------------MCADAMCNGSGHTGRIHNAVEGG
t16             LSSSHEVRVVNHKSKPDEHIADK-D------------MCADAMCNGSGHTGRIHNAVEGG
t42             LSSSHEMRVVHHKSKPDEEIADQ-D------------LCAEEMCKGSGHTGRIHSAVEGG
t24             QSSSHEMRVVHHKSKPDEEITDQ-D------------LCAEEMCKGSGHTGRIHSAVEGG
                

t73             N--CQEFVGI---RELGKH-YK-CMDGFHTVNNGAGEN-SESAMWIFDLWMCKLNHGMQR
t66             N--CQEFVGI---RELGKH-YK-CMDGFHTVNNGAGEN-SESAMWIFDLWMCKLNHGMQR
t32             N--CQEFVGI---RELGKH-YK-CMDGFHTVNNGAGEN-SESAMWIFDLWMCKLNHGMQR
t75             N--GQEFVGI---RELGKH-YD-CMDGYHTVNNGAGEN-SESAMWIFDLWMCKLNHGMQR
t79             A--RPDFVGT---RELGKQ-YE-CMDGVGAVDTGAGDN-SESAVVIFDIWMCQLPHGMQW
t27             A--RPDFVGI---RELGKQ-YE-CMDGVGAVDTGAGDN-SESAVVIFDIWMCQLPHGMQW
t93             A--RPDFVGI---RELGKQ-YE-CMDGVGAVDTGAGDN-SESAVVIFDIWMCQLPHGMQW
t59             A--RPDFVGI---RELGKQ-YE-CMDGVGAVDTGAGDN-SESAVVIFDVWMCQLPHGMQW
t7              A--RPDFVGI---RELGKQ-YE-CMDGVGAVDTGAGDN-SESAVVIFDIWMCQLPHGMQW
t78             A--RPDFVGI---RELGKQ-YE-CMDGVGAVDTGAGDN-SESAVVIFDIWMCQLPHGMQW
t12             Q--RPDFVGI---RELGKQ-YQ-CMDGHGAVDTGAGRN-SESAVWIFDIWMCKLAHGMQW
t81             A--RPDFIGI---RELGKP-Y--CMDGHGAVNTGAGHN-SESAVWIFDIWMYKLSHGMQW
t21             P--RPDFIGV---RELGKP-Y--CMDGHGAVNTGAGVN-SESAVWIFDIWMYKLSHGMQW
t80             A--RQNFVGM---RELEKV-YE-CMDGQGAVNTEAGNN-SESAVWIFDIWMCKLTHGMQD
t14             A--RQNFVGM---RELEKV-YQ-CMDGQGAVNTEAGNN-SESAVWIFDIWMCKLTHGMQD
t85             A--RQNFVGM---RELDKA-YQ-CMDGQKAVNTEAGNN-SESAVWIFDICMCKLTHGMQD
t62             A--RQNFVGM---RELGKQ-YQ-CMDGQGAVNTEAGNN-SESAVWIFDIWMCRLTHGMQD
t19             A--RQNFVGM---RELGKQ-YQ-CMDGQGAVNTEAGNN-SESAVWIFDIWMCRLTHGMQD
t77             A--RQNFVGM---RELGKQ-YH-CMDGQGTVNTEAGNN-SESAVWIFDIWLCRLTHGMQD
t88             R--SAPFIGV---RELFKR-YHKCVEGAGCVHTVAGTP-SDSPVWMFDQFMCQLTHSMVD
t37             T--AAAFIGT---RELFKR-YPKCMEGARCVHTVAGPP-SESPVWMFDKFMCQLTHSMVN
t35             T--AAAFIGT---RELFKR-YPKCMEGARCVHTVAGPP-SESPVWMFDKFMCQLTHSMVN
t48             T--AAAFIGT---RELFKR-YPKCMEGARCVHTVAGPP-SESPVWMFDKFMCQLTHSMVN
t55             T--AAAFIGT---RELFKR-YPKCMEGARCVHTVAGPP-SESPVWMFDKFMCQLTHSMVN
t46             T--AAAFIGT---RELFKR-YPKCMEGARCVHTVAGPP-SESPVWMFDKFMCQLTHSMVN
t67             T--AAAFIGT---RELFKR-YPKCMEGARCVHTVAGPP-SESPVWMFDKFMCQLTHSMVN
t57             T--AAAFIGT---RELFKR-YPKCMEGARCVHTVAGPP-SESPVWMFDKFMCQLTHSMVN
t56             I--AAPFIGV---RELFKR-YIKCVEGAGCVYTVA-AP-SESPVWMFDKFMCHLTHSMVV
t13             I--PPPFHGV---REMFKRVYE-CMEGIGCVNTVAGNP-SESSAWMFDKVMYQLTHSMVW
t5              I--PPPFHGV---REMFKRVYE-CMEGIGCVNTVAGNP-SESSAWMFDKVMYQLTHSMVW
t38             I--SHPFHGV---REMFKR-YE-CMEGIGCVNTVAGNP-SESSAWMFDKFMYQLTHSMVW
t33             I--SHPFHGV---REMFKR-YE-CMEGIGCVNTVAGNP-SESSAWMFDKFMYQLTHSMVW
t100            I--SHPFHGV---REMFKR-YE-CMEGIGCVNTVAGNP-SESSAWMFDKFMYQLTHSMVW
t34             I--SHPFHGV---REMFKR-YE-CMEGIGCVNTVAGNP-SESSAWMFDKFMYQLTHSMVW
t84             I--SHPFHGV---REMFKR-YE-CMEGIGCVNTVAGNP-SESSAWMFDKFMYQLTHSMVW
t92             I--SHPFHGV---REMFKR-YE-CMEGIGCVNTVAGNP-SESSAWMFDKFMYQLTHSMVW
t3              T--SIPFLGV---RELWKR-YE-CMEGIGCVNTVAGKP-SQSSVWMFDRFMYKLTHSMVW
t22             I--SIPFLGV---RELWKR-YE-CMEGIGCVNTVAGTP-SESSVWMFDRFMYKLTHSMVW
t64             IT-SPPFIGV---RELFKR-YG-CMEGIGCVNTVAGMP-SESSVWMFDRFMYKLTHSMVW
t18             IT-SPPFIGV---RELFKR-YG-CMEGIGCVNTVAGMP-SESSVWMFDRFMYKLTHSMVW
t68             I--SPPFIGV---RELFKR-YG-CVEGIGCVNTVAGMP-SESSVWMFDRFMYKLTHSMVW
t28             I--SPPFIGV---RELFKR-YH-CMEGIGCVNTVAGMP-SESSVWMFDQFMYKLTHSMIW
t82             I--SPPFIGL---RELFKR-YV-CMEGIGCVNTVAGMP-SESSVWMFDRFMYKLTHSMVW
t41             I--SPPFIGL---RELFKR-YV-CMEGIGCVNTVAGMP-SESSVWMFDRFMYKLTHSMVW
t71             I--SPQFIGV---RELFKR-YR-CMEGIGCVNTVAGAP-SESSVWMFDRFMYKLTHSMVW
t94             I--SPPFTGV---RELFKR-YR-CMEGIGCVNTVAGIP-SESSVWMFDRFMYRLTHSMVW
t99             I--SPPFIGV---RELFKR-YG-CMEGIGCVNTVAGIP-SESSIWMFDRFMYKLTHSMVW
t40             I--SPPFIGV---RELFKR-YG-CMEGIGCVNTVAGIP-SESSVWMFDRFMYKLTHSMVW
t90             I--SPPFIGV---RELFKR-YG-CMEGIGCVNTVAGIP-SESSVWMFDRFMYKLTHSMVW
t4              I--SPPFIGV---RELFKR-YG-CMEGIGCVNTVAGMP-SESSVWMFDRFMYKLTHSMVW
t36             L--YVFFTGTKGTRELVKY-YM-CMEGHGCVNTMAKKS-SQSGIWKFNAFMC-LMHLMEG
t87             L--YVFFTGNKGTRELVKY-YM-CMEGHGCVNTMAKKS-SQSGIWKFNAFMC-LMHLMEG
t89             L--YNFFTGHKGTRELVKY-YM-CMEGEGVVNTMAKKS-SQSGIWKFNAFMC-LMRLMQG
t39             L--YNFFTGHKGTRELVKY-YM-CMEGEGVVNTMAKKS-SQSGIWKFNAFMC-LMRLMQG
t8              L--YNFFTGHKGTRELVKY-YM-CMEGEGVVNTMAKKS-SQSGIWKFNAFMC-LMRLMQG
t6              L--YNFFTGHKGTRELVKY-YM-CMEGEGVVNTMAKKS-SQSGIWKFNAFMC-LMRLMQG
t58             L--YNFFTGHKGTRELVKY-YM-CMEGEGCVNTMAKKS-SQSGIWKFNAFMC-LMHLMQG
t54             L--YNFFTGHKGTRELVKY-YM-CMEGEGCVHTMAKKS-SQSGIWKFNAFMC-LMHLMQG
t65             L--YNFFTGQKGTRELIKF-YF-CMEGCGCVNTMAKNS-SQSAPWKFNRFMC-LMHLMQS
t29             L--YNFFTGQKGTRELIKF-YF-CMEGCGCVNTMAKNS-SQSAPWKFNRFMC-LMHLMQS
t98             L--YNFFTGQKGTKELVKF-YF-CMEGCGCVNTMAKKS-SQSAPWKFNRFMC-LMHLMQS
t83             L--YNFFTGQKGTKELIKF-YF-CMEGCGTVNTMAKDS-SQSAPWKFNRFMC-LMHLMQS
t95             L--YNFFTGQKGTRELIKF-YF-CMEGCGCVNTMAKNS-SQSAPWKFNRFMC-LMHLMQL
t20             L--YNFFTGQKGTRELIKF-YF-CMEGCGCVNTMAKNS-SQSAPWKFNRFMC-LMHLMQL
t69             L--YNFFTGHKGTRELVKY-YH-CMEGCGCVNTMAKSS-SQSAPWKFNRFMC-LMHLMQE
t2              L--YNFFTGQKGTRELVKY-YH-CMEGCGCVNTMAKSS-SQSAPWKFNRFMC-LMYLMQD
t10             L--YNFFTGQKGTRELVKY-YH-CMEGCGCVNTMAKSS-SQSAPWKFNRFMC-LMYLMQD
t31             L--YTFFTGQKGTRELIKY-YF-CMEGCGCVNTMAKQS-SQSAPWKFNRFMC-LMHLMQN
t15             L--YTFFTGQKGTRELIKY-YF-CMEGCGCVNTMAKNS-SQSAPWKFNRFMC-LMHLMQN
t63             L--YTFFTGQKGKRELIKY-YF-CMEGCGCVNTMAKNS-SQSAPWKFNRFMC-LMHLMQD
t50             L--YTFFTGQKGTRELIKY-YF-CMEGCGCVNTMAKNS-SQSAPWKFNHFMC-LMHLMQN
t25             L--YTFFTGQKGTRELIKY-YF-CMEGCGCVNTMAKNS-SQSAPWKFNRFMC-LMHLMQN
t51             L--YTFFTGQKGTRELIKY-YF-CMEGCGCVNTMAKNS-SQSAPWKFNRFMC-LMHLMQN
t9              L--YNHFTGKKGARELIKR-YV-CMEGHDCVNTVANVS-SQSAIWKFDRFMCDLMHLMQN
t47             L-CYHHFTGKKGARELIKR-YI-CMEGHDCVNTMANVS-SQSAVWNFDRFMCDLMHLMQN
t60             L-CYHHFTGKKGARELIKR-YI-CMEGHDCVNTMANVS-SQSAVWNFDRFMCDLMHLMQN
t30             L-CYHHFTGKKGARELIKR-YI-CMEGHDCVNTMANVS-SQSAVWNFDRFMCDLMHLMQN
t70             M--YNHFTGKKGARELIKR-YI-CMEGHDCVNTMANVS-SQSAVWKFDRFMCDLMHLMQD
t91             M--YNHFTGKKGARELIKR-YI-CMEGHDCVNTMANVS-SQSAVWKFDRFMCDLMHLMQD
t49             M--YNHFTGNKGACELIKG-YV-CMEGHDCVNTMANIS-SQSAVWKFDRFMCDLMHLMQD
t52             L--YNHFTGKKGARELIKR-YI-CMEGHDCVNTMAHDS-SQSATWKFDRFMCDLMHLMQG
t43             L--YQNFTGQKGAREKIKR-YL-CMEGHDCVNTMAKPS-SQSAVWKFDRFMCALMHLMQK
t1              L--YQNFTGQKGAREKIKR-YL-CMEGHDCVNTMAKPS-SQSAVWKFDRFMCCLMHLMQN
t86             L--YQNFTGQKGAREKIKR-YL-CMEGHDCVNTMAKPS-SQSAVWKFDRFMCALMHLMQN
t72             L--YQNFTGQKGAREKIKR-YL-CMEGHDCVNTMAKVS-SQSAVWKFDRFMCALMHLMQN
t96             L--YQNFTGQKGAREKIKR-YL-CMEGHDCVNTMAKPS-SQSAVWKFDRFMCALMHLMQV
t44             L--YQNFSGQKGAREKIKR-YL-CMEGHDCVNTMAKPS-SQSAVWKFDRFMCDLMHLMQN
t45             L--YQNFTGQKGAREKIKR-YK-CMEGHDCVNTMAKSS-SQSAVWKFDRFMCDLMHLMQN
t74             L--YQNFTGQKGAREKIKR-YL-CMEGHDCVNTMAKPS-SQSAVWKFDRFMCDLMHLMQN
t26             L--YQNFTGKKGAREKIKR-YL-CMEGHECVVTMAKNS-SISAMWKFDRFMCDLMHLMQN
t61             L--YQNFTGQKGAREKIKR-YL-CMEGHECVNTMAKNS-SVSAVWKFDQFMCDLMHLMQN
t97             L--YQNFTGQKGAREKIKR-YL-CMEGHECVNTMAKNS-SVSAVWKFDRFMCDLMHLMQN
t17             L--YQNFTGQKGAREKIKR-YL-CMEGQDCVNTMAKSS-SQSAVWKFDRFMCDLVHLMQN
t11             L--YQNFTGQKGAREKIKR-YL-CMEGQDCVNTMAKSS-SQSAVWKFDRFMCDLVHLMQN
t23             H--YTFFAGEKGARELIKR-YS-CMEGDGCVNTMAEGR-SESAVWKFDPFMCQLTHSMQS
t76             I--VTNFHGF---AEMPKN-HD-VMEEQGGPGTCLAPQQSADTSWPFVMFTVDLAHRCRG
t53             I--VTNFHGF---AEMPKN-YD-VMEEQGGPGTCLAPQQSADTSWPFVMFTVDLAHRCRG
t16             I--VTNFHGF---AEMPKN-YD-VMEEQGGPGTCLAPQQSADTSWPFVMFTVDLAHRCRG
t42             I--WTNFHGF---AEMPKN-YD-VMEEQGGPGTCIAPRQSADTSWPFMVFTVDLAHRCRG
t24             I--WTNFHGF---AEMPKN-YD-VMEEQGGPGTCVAPRQSADTNWPFMVFPVELAHRCRG
                

t73             --------GDIGRVKRDVQKFPKLKEGAPNCSSFVKPYFMGCDMFHKQVEYRGTHGLVLD
t66             --------GDIGRVKRDVQKFPKLKEGAPNCSSFVKPYFMGCDMFHKQVEYRGTHGLVLD
t32             --------GDIGRVKQDVQKFPKLKEGAPNCSSFVKPYFMGCDMFHKQVEYRGTHGLVLD
t75             --------GDIGRVQQDVHKFPKLKEGAPNCSSFVKPVFMGCDMFHRQVQNRGNHGLVLD
t79             --------GDIGRVVVDHPKFLKLEEGAPNCSSIPMPYFLGVDMFHREVILKGAKGLVLP
t27             --------GDIGRVVVDHPKFLKLEEGAPNCSSIPMPYFLGCDMFHREVILKGAKGLVLP
t93             --------GDIGRVVVDHPKFLKLEEGAPNCSSIPMPYFLGCDMFHREVILKGAKGLVLP
t59             --------GDIGRVVVDHPKFLKLEEGAPNCSSIPMPYFLGCDMFHREVILKGAKGLVLP
t7              --------GDIGRVVVDHPKFLKLEEGAPNCSSMPMPYFLGCDMFHREVILKGAKGLVLP
t78             --------GDIGRVVVDHPKFLKLEEGAPNCSSIPMPYFLGCDMFHREVILKGAKGLVLP
t12             --------GDIGRVSVDHPKFLKLEEGAPRCSSCPMPYFLGCEMFHRQVILKGAKGLVLP
t81             --------GDIGRVGVDHPKFLKLEEGAPNCSSLPMPYFLGVDMFHRQVTIKGAKGLVLP
t21             --------GDIGRVDVDHPKFLKLEEGAPNCSSLPMPYFLGVDMFHKQVTLKGAKGLVLP
t80             FGD-----GDIGRVVVDHPKFEKLEEGAPNCSSHPVPYFLGIDMFHKQVMAKGSKGLILP
t14             FGD-----GDIGRVVCDHPKFEKLEEGAPNCSSHPMPYFLGVDMFHEQVMAKGSKGLILP
t85             --------GDIGRVVCDHPKFEKLEEGAPNCSSIPMPYFLGIDMFHKQVMAKGSKGLILP
t62             --------GDIGRVECDHPKFAKLEEGAPNCSSLPMPYFLGIDMFHNQVMAKGSKGLILP
t19             --------GDIGRVECDHPKFAKLEEGAPNCSSLPMPYFLGIDMFHKQVMGKGSKGLILP
t77             --------GDIGRVECDHPKFAKLEEGAPNCSSLPMPYFLGIDMFHRQVMAKGSKGLILP
t88             --------GDLGRVVQDNVIFAKLKEGAPHCISL--PHFLGIDMFHTQVFVGGH--LILP
t37             --------GDLGRVVHDNWTFTKLKEGAPHCIAL--PYFMGIDMFHIQVFVGGN--LILP
t35             --------GDLGRVVHDNWTFTKLKEGAPHCIAL--PYFMGIDMFHIQVFVGGN--LILP
t48             --------GDLGRVVHDNWTFTKLKEGAPHCIAL--PYFMGIDMFHIQVFVGGN--LILP
t55             --------GDLGRVVHDNWTFTKLKEGAPHCIAI--PYFMGIDMFHIQVFVGGN--LILP
t46             --------GDLGRVVHDNWTFTKLKEGAPHCIAL--PYFMGIDMFHIQVFVGGN--LILP
t67             --------GDLGRVVMDNWTFTKLKEGAPHCIAL--PYFMGIDMFHIQVFLGGD--LILP
t57             --------GDLGRVVMDNWTFTKLKEGAPHCIAL--PYFMGIDMFHIQVFIGGD--LILP
t56             --------GDLGRVLRDNTTFAKLKEGAPVCISL--PYFLGMDMFHQQVFMGGN--LILP
t13             --------GDLRRVVHDNVTFSKLKEGAPHCISH--PYFLGIDMFHIQVYSKGF--LTLP
t5              --------GDLRRVVHDNVTFSKLKEGAPHCISH--PYFLGIDMFHIQVYSKGF--LTLP
t38             --------GDLGRVYYDNITFSKLKEGAPHCISQ--PFFLGIDMFHIQVYFKGS--LTLP
t33             --------GDLGRVYYDNITFSKLKEGAPHCISH--PFFLGIDMFHIQVYFKGS--LTLP
t100            --------GDLGRVYYDNITFSKLKEGAPHCISH--PFFLGIDMFHIQVYFKGS--LTLP
t34             --------GDLGRVYYDNITFSKLKEGAPHCISH--PFFLGIDMFHIQVYFKGS--LTLP
t84             --------GDLGRVYYDNITFSKLKEGAPHCISH--PFFLGIDMFHIQVYFKGS--LTLP
t92             --------GDLGRVYYDNITFSKLKEGAPHCISH--PFFLGIDMFHIQVYFKGS--LTLP
t3              --------GDLGRVYWDNLTFQKLKEGAPHCIAV--PNYLNIDMFHIQVFYKGP--LTLP
t22             --------GDLGRVYVDNQTFSKLKEGAPHCISA--PYYLNIDMFHIQVFYKGS--LTLP
t64             --------GDLRRVFPDNATFSKLKEGAPHVISH--PYFLGIDMFHDQVVYRGP--LTLP
t18             --------GDLRRVFPDNATFSKLKEGAPHVISH--PYFLGIDMFHEQVVYRGP--LTLP
t68             --------GDLRRVFPDNAHFSKLKEGAPHVISH--PYFLGIDMFHDQVVYRGP--LTLP
t28             --------GDLGRVFPDNATFSKLKEGAPHVISH--PYFLGIDMFHAQVFYRGS--LTLP
t82             --------GDLGRVFPDNCTFSKLKEGAPHVISH--PYFLGIDMFHGQVVYRGS--LTLP
t41             --------GDLGRVFPDNCTFSKLKEGAPHVISH--PYFLGIDMFHGQVVYRGS--LTLP
t71             --------GDLARVFHDNGTFAKLKEGAPHVISV--PYFLGIDMFHGQVFLRGS--LTLP
t94             --------GDLGRVFQDNATFSKLKEGAPHVISH--PYFLGIDMFHGQVFYRGS--LTLP
t99             --------GDLGQVFPDVSTFSKLKEGAPHVISQ--PYFLGIDMFHDQVFYRGS--LTLP
t40             --------GDLGRVYPDNPTFSKLKEGAPHVISH--PYFLGIDMFHDQVFYRGS--LTLP
t90             --------GDLGRVYPDNPTFSKLKEGAPHVISH--PYFLGIDMFHDQVFYRGS--LTLP
t4              --------GDLGRVFPDNATFSKLKEGAPHVISV--PYFLGIDMFHDQVFYRGS--LTLP
t36             --------GDL--------------------CSY--PSFLGMCMFHAMVQSKGD--LVLP
t87             --------GDL--------------------CSY--PSFLGMCMFHAMVQSKGD--LVLP
t89             --------GDL--------------------CSY--PSFLGMCMFYAMVQSKGD--LVLP
t39             --------GDL--------------------CSY--PSFLGMCMFYAMVQSKGD--LVLP
t8              --------GDL--------------------CSY--PSFLGMCMFYAMVQSKGD--LVLP
t6              --------GDL--------------------CSH--PSFLGMCMFYAMVQSKGD--LVLP
t58             --------GDL--------------------CSH--PSFLGMCMFHAMVKSKGN--LVLP
t54             --------GDL--------------------CSH--PSFLGMCMFHAMVQSKGN--LVLP
t65             --------GDL--------------------CNS--PSFLGMCMFHPQVQAKGE--LVLP
t29             --------GDL--------------------CNC--PSFLGMCMFHPQVQAKGE--LVLP
t98             --------GDL--------------------CNS--PPFLGMCMFHPQVQMKGE--LVLP
t83             --------GDL--------------------CNS--PSFLGMCMFHPQVQAKGE--LVLP
t95             --------GDL--------------------CNP--PSFLGMCMFHPQVRSKGE--LVLP
t20             --------GDL--------------------CNP--PSFLGMCMFHPQVRSKGE--LVLP
t69             --------GDL--------------------CNS--PGFLGMCMFHPQVQRKGE--LVLP
t2              --------GDL--------------------CNS--PGFLGMCMFHPQVQAKGE--LVLP
t10             --------GDL--------------------CNS--PGFLGMCMFHPQVQAKGE--LVLP
t31             --------GDL--------------------CNL--PSFLGMCMFHNQVQCKGE--LVLP
t15             --------GDL--------------------CNS--PSFLGMCMFHNQVPNKGA--LVLP
t63             --------GDL--------------------CNS--PSFLGMCMFHNQVSFKGE--LVLP
t50             --------GDL--------------------CNS--PSFLGMCMFHNQVSVKGE--LVLP
t25             --------GDL--------------------CNS--PSFLGMCMFVNQVSFKGE--LVLP
t51             --------GDL--------------------CNS--PSFLGMCMFHVQVQFKGE--LVLP
t9              --------GDL--------------------CSY--PSFLPMCMFVPQVLSKGE--LVLP
t47             --------GDL--------------------CSY--PSFLPMCMFVSQVLSKGE--LVLP
t60             --------GDL--------------------CSV--PSFLPMCMFVSQVLHKGE--LVLP
t30             --------GDL--------------------CSV--PSFLPMCMFVSQVLHKGE--LVLP
t70             --------GDL--------------------CSY--PSFLPMCMFVAQVIAKGE--LVLP
t91             --------GDL--------------------CSY--PSFLPMCMFVAQVIAKGE--LVLP
t49             --------GDL--------------------CSY--PSFLPMCMFVAQVIAKGE--LVLP
t52             --------GDL--------------------CSY--PSFLPVCMFVAQVINKGE--LVLP
t43             --------GDL--------------------CSH--PSFLGMCMFHEQVRCKGE--LVLP
t1              --------GDL--------------------CSH--PSFLGMCMFVEQVRCKGE--LVLP
t86             --------GDL--------------------CSH--PSFLGMCMFHEQVRRKGE--LVLP
t72             --------GDL--------------------CSH--PSFLGMCMFHEQVRRKGE--LVLP
t96             --------GDL--------------------CSH--PSFLGMCMFHEQVRRKGE--LVLP
t44             --------GDL--------------------CSH--PSFLGMCMFHEQVRCKGE--LVLP
t45             --------GDL--------------------CSV--PSFLGMCMFHEQVRCKGE--LVLP
t74             --------GDL--------------------CSV--PSFLGMCMFHEQVRCKGE--LVLP
t26             --------GDL--------------------CSF--PSFLGMCMFHDQVRCKGE--LVLP
t61             --------GDL--------------------CSF--PSFLGMCMFHEQVRCKGE--LVLS
t97             --------GDL--------------------CSF--PSFLGMCMFHQQVRCKGE--LVLP
t17             ---GARGSGDL--------------------CSF--PSFLGMCMFHEQVRCKGE--LVLP
t11             ---GARGSGDL--------------------CSF--PSFLGMCMFHEQVRCKGE--LVLP
t23             --------GDL--------------------CSV--PSFLGVCMFQRQVVMKGE--LVLP
t76             --------GDMPQNTGDSMTCPHLAEGLAAVNS---RAFIGVSIYDLKVSHKMI--QACN
t53             --------GDIPQNTGDSMTCPHLAEGLAAVNS---RAFIGVSTYDLKVSHKMI--QACN
t16             --------GDIPQNTGDSMTCPHLAEGLAAVNS---RAFIGVSTYDLKVSHKMI--QACN
t42             --------GDTPTQAGDSMTFPHLAEGLPAVNS---RAFVGVSSYDLRVSHKMI--QACT
t24             --------GDTP--------FPHLAEGLPAVNS---RAFIGVSSYDLKVSHKMI--QACN
                

t73             DTWNEESATFPYPQVHSRSDKRCLNGLHQGDHEESVH---HAPRI----MR---LIGH-H
t66             DTWNEESATFPYPQVHSRSDKRCLNGLHQGDHEESVH---HAPRI----MR---LIGH-H
t32             DTWNEESATFPYPQVHSRSDKRCLNGLHQGDHEESVH---HAPRI----MR---LIGH-H
t75             DTWNEESGTFPYPQVHSRNEKRCINKLHQGDHNESCH---HNPRI----VR---RIGH-H
t79             D--NEDSMAFPYVQVHSRSVKRCLNVLHQGDHEESRH---HNARI----VR---RIGL-N
t27             D--NEDSMAFPYVQVHSRSVKRCLNVLHQGDHEESRH---HNARI----VR---RIGM-N
t93             D--NEDSMAFPYVQVHSRSVKRCLNVLHQGDHEESRH---HNARI----VR---RIGM-N
t59             D--NEDSMAFPYVQVHSRSVKRCLNVLHQGDHEESRH---HNARI----VR---RIGM-N
t7              D--NEDSMAFPYVQVHSRSVKRCLNVLHQGDHEESRH---HNARI----VR---RIGM-N
t78             D--NEDSMAFPYVQVHSRSVKRCLNVLHQGDHEESRH---HNARI----VR---RIGM-N
t12             D--NEDSMAFPYVQVHSRSVKRCLNVLVQGDHDESRH---HNARI----VA---RIGM-N
t81             DIWNESPMAFPYAQVHSKSHKRCLNVLVQGDHEESEH---HNARI----MS---KIGT-H
t21             DIWNESPMAFPYAQVHSKSHKRCLNVLVQGDHEESEH---HNARI----MS---RIGT-H
t80             DTWNEASMAFPYPQVHSKSHRRVLNVLHQGDVEES-H---HSARC----VR---RIGF-H
t14             DTWNEASMAFPYPQVHSKSHRRVLNVLHQGDVEES-H---HSARC----VR---RIGF-H
t85             DTWNEASMAFPYPQVHSKSHRRVLNVLHQGDHEES-H---VSARC----MR---RIGF-H
t62             DTWNEASMAFPYPQVHSKSHRRVLNVLHQGDHEES-H---HSARC----MR---RIGY-H
t19             DTWNEASMAFPYPQVHSKSHRRVLNVLHQGDHEES-H---HSARC----MR---RIGYGH
t77             DTWNEASMAFPYPQVHSKSHRRVLNVLHQGDHEES-H---HSARC----MR---RIGY-V
t88             DPCYELSISVMYAGHASYNQKRCINNLDQGDQEDSNHRKEHKIRASVLLYR---QIGI-L
t37             DPCYELSISVMYAGHASYNQKRCINGLDNGDRQDSDPRKEHKIRNSVLLYR---QIGL-L
t35             DPCYELSISVMYAGHASYNQKRCINGLDNGDRQDSDPRKEHKIRNSVLLYR---QIGL-L
t48             DPCYELSISVMYAGHASYNQKRCINGLDNGDRQDSDPRKEHKIRNSVLLYR---QIGL-L
t55             DPCYELSISVMYAGHASYNQKRCINGLDNGDRQDSDPRKEHKIRNSVLLYR---QIGL-L
t46             DPCYELSISVMYAGHASYNQKRCINGLDNGDRQDSDPRKEHKIRNSVLLYR---QIGL-L
t67             DPCYELSISVMYAGHASYNQKRCINGLDNGDRQDSDPRKEHKIRNSVLLYR---QIGL-L
t57             DPCYELSISVMYAGHASYNQKRCINGLDNGDRQDSDPQKEHKIRNSVLLYR---QIGL-L
t56             DPCYELSISVMYAGHASYNQKRCLNNLDQGDREDSSHRKEHKIRRSVLLYQ---QIGC-L
t13             DPRYEISMSVMYSQHHSFSMKRCLNGLDHGDREESPHQIEHKMRKSVLIYN---PIGY-L
t5              DPRYEISMSVMYSQHHSFSMKRCLNGLDHGDREESPHQIEHKMRKSVLIYS---PIGY-L
t38             DPRYELSMSVMYSQHHSFSQKRCLNGLDVGDREESPHHIDHKMRKSVLIYN---PIGY-L
t33             DPRYELSMSVMYSQHHSFSQKRCLNGLDVGDREESPHQIEHKMRKSVLIYN---PIGY-L
t100            DPRYELSMSVMYSQHHSFSQKRCLNGLDVGDREESPHQIEHKMRKSVLIYN---PIGY-L
t34             DPRYELSMSVMYSQHHSFSQKRCLNGLDVGDREESPHQIEHKMRKSVLIYN---PIGY-L
t84             DPRYELSMSVMYSQHHSFSQKRCLNGLDVGDREESPHQIEHKMRKSVLIYN---PIGY-L
t92             DPRYELSMSVMYSQHHSFSQKRCLNGLDVGDREESPHQIEHKMRKSVLIYN---PIGY-L
t3              DPHYELSMSVMYAQHHSFSQKRCLNALDHGDREESPHQIEHKMRKSVLLYN---PIGY-L
t22             DPRYELSMSVMYAQHHSFSQKRCLNALDYGDREESPHQIEHKMRKSVLLYY---TIGW-L
t64             DPRYELSMSVMYAQHHSFSQKRCLNALDHGDTQESPHGIEHNMRNSVLLYN---PIGF-L
t18             DPRYELSMSVMYAQHHSFSQKRCLNALDHGDTQESPHGIEHNMRNSVLLYN---PIGF-L
t68             DPRYELSMSVMYAQHHSFSQKRCLNALDHGDTQESPHGIEHNMRNSVLLYN---PIGF-L
t28             DPRYELSMSVMYSQHHSFSQKRCLNPLDHGDRQESSHGIEHNMRSSVLLYN---PIGF-L
t82             DPRYELSMSVMYSQHHSFSQKRCLNPLDHGDRQESPHGIEHNMRSSVLLYN---PIGF-L
t41             DPRYELSMSVMYSQHHSFSQKRCLNPLDHGDRQESPHGIEHNMRSSVLLYN---PIGF-L
t71             DPRYELSMSVMYAQHHSFSQKRCLNHLDHGDRQESPHGIEHNMRKSVLLYN---PQGY-L
t94             DPRYELSMSVMYAQHHSMSQKRCLNTLDHGDRQESPHGIEHNMRKSVLLYD---PIGY-L
t99             DPRYELSMSVMYAQHHSFSQKRCLNALDHGDRQESPHGIEHNMRKSVLLDS---PIGY-L
t40             DPRYELSMSVMYAQHHSFSQKRCLNALDHGDRQESPHGIEHNMRKSVLLDS---SIGY-I
t90             DPRYELSMSVMYAQHHSFSQKRCLNALDHGDRQESPHGIEHNMRKSVLLDS---PIGY-I
t4              DPRYEMSMSVMYAQHHSFSQKRCLNALDYGDRQESPHGIEHNMRKNVLLDN---PIGH-L
t36             DSPNEDSVSFMYIQHHSFHEKRCLNPLNVGDREDSEHIKEKHMRI----YA---NIGG-H
t87             DSPNEDSVSFMYIQHHSFHEKRCLNPLNVGDREDSDHVKEKHMRI----YA---NIGG-H
t89             DSCNEDSVSFMYIQHHSFHEKRCLNPLNVGDREDSDHTKEKHMRI----YA---NIGG-H
t39             DSCNEDSVSFMYIQHHSFHEKRCLNPLNVGDREDSDHTKEKHMRI----YA---NIGG-H
t8              DSCNEDSVSFMYIQHHSFHEKRCLNPLNVGDREDSDHTKEKHMRI----YA---NIGG-H
t6              DSCNEDSVSFMYIQHHSFHEKRCLNPLNVGDREDSDHTKEKHMRI----YA---NIGG-H
t58             DSCNEDSVSFMYIQHHSFHEKRCLNHLNVGDREDSEHIKEKHMRV----YA---SIGG-H
t54             DSCNEDSVSFMYIQHHSFHEKRCLNHLNVGDREDSEHIKEKHMRI----YA---SIGG-H
t65             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDSQDSQHLREKQLRI----YG---RIGK-V
t29             DNPNENSVEFMYRRHHSLSDKRCLNLLFVGDSQDSQHQREKQLRI----YG---RIGK-V
t98             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDSQDSQHLREKQLRI----YG---RIGK-V
t83             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDSQDSQHLREKQLRI----YG---RIGK-V
t95             DNPNENSVEFMYRRHHSLSDKRCLNLLYTGDSQDSQHLREKQLRI----YG---RIGR-V
t20             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDSQDSQHLREKQLRI----YG---RIGR-V
t69             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDNQDSQHLREKQLRM----YG---EIGK-V
t2              DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDNQDSQHLREKQLRM----YG---EIGK-V
t10             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDNQDSQHLREKQLRM----YG---EIGK-V
t31             DNVNENSVEFMYRRHHSLSDKRCLNLLYVGDNQDSQHLREKQLRI----YQ---NIGK-V
t15             DNVNENSVEFMYRRHHSLSDKRCLNLLYVGDNQDSQHLREKQLRI----YP---SIGK-V
t63             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDEQDSSHLREKQLRL----YA---RIGK-V
t50             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDNQDSSHLREKQLRL----YA---RIGK-V
t25             DNPNENSVEFMYRRHHSLSDKRCLNLLYVGDNQDSSHLREKQLRL----YA---RIGK-V
t51             DHPNENSVEFMYRRHHSLSDKRCLNLLYVGDNQDSQHLREKQLRI----YA---RIGK-V
t9              DSSNEESISFVYLQHHSFSVKRCLNYLNVGDSADSKHLKEKHLRA----EGMPGNIGK-H
t47             DSSNEESISFVYLQHHSFSDKRCLNYLNVGDNSDSKHLKEKHLRA----QGMPGNIGK-H
t60             DSSNEESISFVYLQHHSFSDKRCLNYLNVGDNADSKHLKEKHLRA----QGMPGNIGK-H
t30             DSSNEESISFVYLQHHSFSEKRCLNYLNVGDNADSRHLKEKHLRA----QGMPGNIGK-H
t70             DSSTEESISFMYLQHHSFSDKRCLNYLNVGDNEDSKHAKEKFLRG----DG---GIGQ-H
t91             DSSTEESISFMYLQHHSFSDKRCLNYLNVGDNEDSKHAKEKFLRG----DG---GIGQ-H
t49             DSSNEESISFMYLQHHSFSDKRCLNCLNVGDNEDSKHLKEKFLRA----DG---GIGQ-H
t52             DSSNEESISFMYLQHHSFSEKRCLNYLNVGDNEDSKHLKEKFLRA----DG---NIGQ-H
t43             DSPNEESVSFVYIQHHSFSDKRCLNCLNVGDNDDSEHLKEKHLRI----YG---QIGH-H
t1              DSPNEESLSFVYIQHHSFSDKRCLNCLNVGDNDDSEHLKEKHLRI----YG---QIGR-H
t86             DSPNEESVSFVYIQHHSFSDKRCLNCLNVGDNDDSEHLKEKHLRI----YG---QIGR-H
t72             DSPNEESVSFVYIQHHSFSDKRCLNCLNAGDNDDSEHLKEKHLRT----YG---QIGR-H
t96             DSPNEESVSFVYIQHHSFSDKRCLNCLNVGDNDDSEHLKEKHLRV----YG---QIGR-H
t44             DSPNEESVSFVYIQHHSFSDKRCLNYLNVGDNDDSEHLKEKHLRI----YG---VIGK-H
t45             DSPNEESVSFVYIQHHSFSDKRCLNYLNVGDNDDSEHLKEKHLRI----YG---EIGK-H
t74             DSPNEESVSFVYIQHHSFSDKRCLNYLNVGDNDDSEHIKEKHLRI----YG---EIGK-H
t26             DSKNEESVSFVYIQHHSFSDKRCLNYLNVGDNEDSEHLKEKHLRV----YG---NIGK-H
t61             DSKNEESVSFVYIQHPSFSDKRCLNYLNVGDNEDSEHLKEKVLRV----YG---DIGK-H
t97             DSKNEESVSFVYIQHHSFNDKRCLNYLNVGDNEDSEHLEEKHLRV----YG---NIGK-H
t17             DSKNEESVSFVYIQHHSFSDKRCLNELNVGDNEDSIHLKEKHLRI----YG---NIGK-V
t11             DSKNEESVSFVYIQHHSFSDKRCLNSLNVGDNEDSIHLKEKHLRI----YG---DIGK-H
t23             DSADEGSVSFMYIQHHSFAAKRCLNVLNVGDNEDSVHLRHKQLRV----YG---KIGK-H
t76             PIQN---------DNHAFSDQRCLNDLSQGVVGASFPKMQHGVRH----YK---K-----
t53             PIQN---------DNHAFSDQRCLNDLAQGVVGASHPKMQHGVRH----YK---K-----
t16             PIQN---------DNHAFSDQRCLNDLAQGVVGASHPKMQHGVRH----YK---K-----
t42             LIQN---------DNVAFSDQRPLNDLNQGCVGTSHPKMPHGVRH----YK---K-----
t24             PIQN---------DNVAFSDQRVLNDLSQGCVGTSHPKMPHGVRH----YK---K-----
                

t73             LVIIVLMNHDMGRLNHLEPDAVIPSPLRIGGDGWVPKPI------------------EDG
t66             LVIIVLMNHDMGRLNHLEPDAVIPSPLRIGGDGWVPKPI------------------EDG
t32             LVIIVLMNHDMGRLNHLEPDAVIPSPLRIGGDGWVPKPI------------------EDG
t75             LVIIVLVNRDMGRLNYIEPDALVPSPLRFGGDEWVPKPI------------------EDG
t79             LVIISYANVDMGRLNHCEDEAIVFSPLRYGGAGFVSKPI------------------GDG
t27             LVIISYANVDMGRLNHCEDQAIVYSPLRYGGAGFVSKPI------------------ADG
t93             LVIISYANVDMGRLNHCEDQAIVYSPLRYGGAGFVSKPI------------------ADG
t59             LVIISYANVDMGRLNHCEDEAIVFSPLRYGGAGFVSKPI------------------ADG
t7              LVIISYANVDMGRLNHCEDEAIVFSPLRYGGAGFVSKPI------------------ADG
t78             LVIISYANVDMGRLNHCEDEAIVFSPLRYGGAGFVSKPI------------------ADG
t12             MVIIRYLNVEMGRLNHCEDDAMVYSPLRIGGAGTHSKPI------------------ADG
t81             LVIINIINVEMQRLNHCEDKAIVYSPDRIGGAGFHSKPI------------------ADG
t21             LVIVNVINVEMQRLNHCEDKAIVYSPDRIGGAGFHSKPI------------------ADG
t80             LVIIVFWNVEMGRLNHCEDEAIIYSPLRIGGAGFHSKPV------------------DDG
t14             LVIIVYWNVEMGRLNHCEDEAIIYSPLRIGGAGFHSKPV------------------DDG
t85             LVIINFWNVEMGRLNHCEDEAIIYSPLRIGGAGFHSKPI------------------NDG
t62             RVIINYWNVEMGRLNHCEDEAIIYSPLRIGGAGFHSKPI------------------ADG
t19             LVIINFWNVEMGRLNHCEDEAIIYSPLRIGGAGFHSKPI------------------ADG
t77             LVIINFWNVEMGRLIHCEDEAIIYSPLRIGGAGFHSKPI------------------ADG
t88             -VIIKEANELMNRLNHKEPENGIIFPLR---DAQDPKQI------------------LNG
t37             -VIIKEANELMGRLNHKEPKNGVIFPLR---GAQGPKQI------------------SNG
t35             -VIIKEANELMGRLNHKEPKNGVIFPLR---GAQGPKQI------------------SNG
t48             -VIIKEANELMGRLNHKEPKNGVIFPLR---GAQGPKQI------------------SNG
t55             -VIIKEANELMGRLNHKEPKNGVIFPLR---GAQGPKQI------------------SNG
t46             -VIIKEANELMGRLNHKEPKNGVIFPLR---GAQGPKQI------------------SNG
t67             -VIIKEANELMGRLNHKERKNGVIFPLR---GAQGPKQI------------------SNG
t57             -VIIKEANEIMGRLNHKERKNGVIFPLR---GAQGPKQI------------------SNG
t56             -VITRERNELMGRLNHKEPRDGVIFPHR---GAQGPKQL------------------ANG
t13             -VIIKDANSMMGRLNHHESRAVVAFPLR---GAEGPKQV------------------MEG
t5              -VIIKDANSMMGRLNHHESRAIVAFPLR---GAEGPKQV------------------MEG
t38             -VIIKNANSLMGRLNHHESRLIVTFPLR---GAEGPKQV------------------MEG
t33             -VIIKNANSLMGRLNHYESRAIVTFPLR---GAEGPKQV------------------MEG
t100            -VIIKNANSLMGRLNHHESRAIVTFPLR---GAEGPKQV------------------MEG
t34             -VIIKNANSLMGRLNHHESRAIVTFPLR---GAEGPKQV------------------MEG
t84             -VIIKNANSLMGRLNHHESRAIVTFPLR---GAEGPKQV------------------MEG
t92             -VIIKNANSLMGRLNHHESRAIVTFPLR---GAEGPKQV------------------MEG
t3              -VIIKNANSMMGRLNHHESCAIVMFPLR---GAEGPKQI------------------IEG
t22             -VIIKNADSMMGRLNHHESCAMVMFPLR---GAEGPKQI------------------MEG
t64             -VIIKNINSMMGRLNHHESRAVVGFPLR---GAENPKQI------------------MEG
t18             -VIIKNINSMMGRLNHHESRAVVGFPLR---GAENPKQI------------------MEG
t68             -VIIKNINSMMGRLNHYESRAVVGFPLR---GAENPKQI------------------MEG
t28             -VIIDNINPMMGRLNHHESRAIVTFPLR---GAEHPKQI------------------VEG
t82             -VIIDNINPMMGRLNHHESRAIVTFPLR---GAEHPKQI------------------MEG
t41             -VIIDNINPMMGRLNHHESRAIVTFPLR---GAEHPKQI------------------MEG
t71             -VIIKNVNSMMGRLNHHESRAVVTFPLR---GADNPRQI------------------MEG
t94             -VIIKNVNSMMGRLNHHESRAKVTFPLR---GADNPRQI------------------MEG
t99             -VIIKNINSMMGRLNHHESRAVFAFPLR---GAENPKQI------------------MEG
t40             -VIIKNLNSMMGRLNHHESRAVVTFPLR---GAEDPKQI------------------MEG
t90             -VIIKNVNSMMGRLNHHESRAVVTFPLR---GAEDPKQI------------------MEG
t4              -VIIKNENSMMGRLNHHESRAVVTFPLR---GAEDPKQK------------------MEG
t36             -IIIREWNDVMGRLNHIEPGAEVIFPLRK--RGQHSKPV------------------IDG
t87             -IIIREWNDVMGRLNHIEPGAEVIFPLRK--RGQHSKPV------------------IDG
t89             -IIIREWNDVMGRLNVIEPEAEVIFPLRK--RGQHSKPV------------------IDG
t39             -IIIREWNDVMGRLNVIEPEAEVIFPLRK--RGQHSKPV------------------IDG
t8              -IIIREWNDVMGRLNVIEPEAEVIFPLRK--RGQHSKPV------------------IDG
t6              -IIIREWNDVMGRLNVIEPEAEVIFPLRK--RGQHSKPV------------------IDG
t58             -IIIREWNDVMGRLNHIEPGAEVTFPLRR--RGQASKPV------------------IDG
t54             -IIIREWNEVMGRLNHIEVGAEVTFPLRR--RGQASKPV------------------IDG
t65             -VIIKVWNAVMGRLNHHEPPAEVMFPLRK--GGQDSKPF------------------IDG
t29             -VIIKVWNAAMGRLNHVEPPAEVMFPLRR--GGSDSKPF------------------LDG
t98             -VIIKVWNAVMGRLNHHEPPAEVMFPLRR--GGSDSKPF------------------IDG
t83             -VIIKVWNAVMGRLNHHEPPAEVMFPLRR--GGSCSKPF------------------VDG
t95             -VILQVWNAVMGRLNHHEPPAEVMFPLRK--GGSNSKPV------------------YDG
t20             -VILQVWNAVMGRLNHHEPPAEVMFPLRK--GGSNSKAV------------------YDG
t69             -VIIKVVNAVMGRLNHVEPSAEVMFPLRK--GGSDSKPF------------------IDG
t2              -VIIKVVNAVMGRLNHHEPSAEVMFPLRK--GGSDSKPF------------------IDG
t10             -VIIKVVNAVMGRLNHHEPSAEVMFPLRK--GGSDSKPF------------------IDG
t31             -VIIKVWNANMGRLNHHEPPAEVMFPLRK--GGSDSKPF------------------IDG
t15             -VIIKVWNAAMGRLNHHEPPAEVMFPLRK--GGSDSKPF------------------IDG
t63             -VIIKVWNAVMGRLNHHEPPAAVMFPLRK--GGSDSKPF------------------IDG
t50             -VIIKVWNAVMGRLNHHEPPAEVMFPLRK--CGSDSKPF------------------IDG
t25             -VIIKVWNAVMGRLNHHEPPAEVVFPLRK--GGSDSKPF------------------IDG
t51             -VIIKVWNAVMGRLNHHEPPAEVVFPLRK--GGSDSKPF------------------IDG
t9              -VIINVWNAVMGRLNHHEPPAEVVFPLRQ--GGPDSKPM------------------IDG
t47             -VIINVWNAVMGRLNHHESPAEVVFPLRQ--GGPDSKPM------------------IDG
t60             -VIINVWNAVMGRLNHHEPPAEVVFPLRQ--GGPDSKPM------------------IDG
t30             -VIISVWNAVMGRLNHHEPPAEVVFPLRQ--GGPDSKPM------------------MDG
t70             -VIINVWNAVMGRLNHHEPPPEVVFPLRQ--GGPDSKPM------------------VDG
t91             -VIINVWNAVMGRLNHHEPPPEVVFPLRQ--GGPDSKPM------------------VDG
t49             -VIINMWNAVMGRLNHHEPPPEVVYPLRQ--GGPNSKPM------------------VDG
t52             -VIINMWNAVMGRLNHHEPPAEVNFPLRQ--GGPDSKPM------------------VDG
t43             -VIINVWNAFMGRLNHHEPPAEVVYPLRK--GGPDSK-M------------------VDG
t1              -VIINVWNAFMGRLNHHEPPAEVVYPLRK--GGPDSKPV------------------VDG
t86             -VIINVWNAFMGRLNHHEPPAEAVYPLRK--GGPDSKPM------------------VDG
t72             -VIINVWNAFMGRLNHHEPPAEVVYPLRK--GGPDSKPM------------------VDG
t96             -VIINVWNAFMGRLNHHEPPAEVVYPLRK--GGPDSKLM------------------VDG
t44             -VIINVWNAFMGRLNHHEPPADVEYPLRK--GGPDSKPM------------------VDG
t45             -VIINVWNAFMGRLNHHEPPAEVMYPLRK--GGPESKPM------------------VDG
t74             -VIINVWNAFMGRLNHHEPPAEVMYPLRK--GGPESKPM------------------VDG
t26             -VIINSWNAMMGRLNHHEPAAEVVYPLRK--GGPESKPM------------------VDG
t61             -VIINVWNAMMGRLNHHEPAAEVVCPLRK--GGPDSKPM------------------VDG
t97             -VIINVWNAMMGRLNHHEPAAEVVCPLRK--GGPDSKPM------------------VDG
t17             -VIINVWNAMMGRLNHHEPAAEVVYPLRK--GGPDSKPM------------------VDG
t11             -VIINVWNAMMGRLNHHEPAAEVVYPLRK--GGPDSKPM------------------VDG
t23             -VIISVPNAIMGRLNHHEPSAIVVFPLRQ--RGADSKSV------------------GDG
t76             ---RVYENEVGGRLDDAEAIDDMGVWIRW--EGVKHAWCHPIGSCPDHLVCSLLVLQPAR
t53             ---RVYENEVGGRLDDAEAIDDMGVWIRW--EGVKHAWCHPIGSCPDHLVCSLLVLQPAR
t16             ---RVYENEVGGRLDDAEAIDDMGVWIRW--EGVKHAWCHPIGSCPDHLVCSLLVLQPAR
t42             ---KVYENEVGDRLDDAEGIDDVGVWMRW--NGVKHAWCHIIGSCPDHLVCSLLVLQPGR
t24             ---RVYENEVGDRLDDAEAVDDVGVWMRW--AGVKVAVCHVIGSCPDHLVVSLLVLQPAR
                

t73             FFDK-D-Q------SRPDVANASIVPDK----DQWVGAHNQWGSSLRKVGLAVHDLR-NI
t66             FFDK-D-Q------SRPDVANASIVPDK----DQWVGAHNQWGSSLRKVGLAVHDLR-NI
t32             FFDK-D-Q------ARPDVANASIVPDK----DQWVGAHNQWGSSLRKVGLAVHDLR-NI
t75             FFDK-D-Q------ARPDVANA-IVPDR----DQWVGAHKEWGSSLCKVGLAVHDLR-NV
t79             FFDK-D-Q------ARPLMANAVCVPEN----DQWTGAVGQWCSSVVKCGLADHPLE-NI
t27             FFDK-D-Q------ARPLMANAVCVPEN----DQWTGAVGQWCSSVVKCGLADHPLE-NI
t93             FFDK-D-Q------ARPLMANAVCVPEN----DQWTGAVGQWCSSVVKCGLADHPLE-NI
t59             FFDK-D-Q------ARPLMANAHCVPEN----DQWTGAVGQWCSSVVKCGLADHPLE-NI
t7              FFDK-D-Q------ARPLMANAHCVPEN----DQWTGAVGQWCSSVVKCGLADHPLE-NI
t78             FFDK-D-Q------ARPLMANAHCVPEN----DQWTGAVGQWCSSVVKCGLADHPLE-NI
t12             FFDK-D-Q------ARPLIANAHIVPEN----DQWTGAVAQWCSSVIKCGLANHDLE-NI
t81             FFDK-D-Q------ARPIIANAHIVPVN----DQWTGPMAQWCSSVIKCGLANHELE-DV
t21             FFDK-D-Q------ARPIIANAHIVPIY----DQWTGPMAQWCSSVIKCGLANHELK-VV
t80             FFDK-D-Q------ARPVIASAHIVPEH----DQWSGAMAQWCSSVIKCGLANHDLE-NV
t14             FFDK-D-Q------ARPVIASAHIVPEH----DQWSGAMAQWCSSVIKCGLANHDLE-NV
t85             FFDK-D-Q------ARPVIANAHIVPEH----DQWSGAMAQWCSSVIKCGLANHDLE-NV
t62             FFDK-D-Q------ARPVIANAHIVPEY----DQWSGAMAQWCSSVIKCGLANHDLE-NV
t19             FFDK-D-Q------ARPVIANAHIVPEY----DQWSGAMAQWCSSVIKCGLANHDLE-NV
t77             FFDK-D-Q------ARPVIANAHIVPEY----DQWSGAMPQWVSSVIKCGLANHDLE-NV
t88             LFDK-E-E------NRPMVQDADSVVGS----AQWAGQHRSWCSSDDKA-----------
t37             LFEK-E-E------NRPMVQDAGSVPGR----KQWAGQHRAWCSSDDKA-----------
t35             LFEK-E-E------NRPMVQDAGSVPGR----KQWAGQHRAWCSSDDKA-----------
t48             LFEK-E-E------NRPMVQDAGSVPGR----KQWAGQHRAWCSSDDKA-----------
t55             LFEK-E-E------NRPMVQDAGSVPGR----KQWAGQHRAWCSSDDKA-----------
t46             LFEK-E-E------NRPMVQDAGSVPGR----KQWAGQHRAWCSSDDKA-----------
t67             LFEK-E-E------NRPMVQDAGSVPGR----KQWAGQHRAWCSSDDKA-----------
t57             LFEK-E-E------NRPMVQDAGSVPGR----KQWAGQHRAWCSSDDKA-----------
t56             LFEK-E-E------NRPMVQDAGSVPER----AQWPGQQRAWCSSDDKA-----------
t13             LFDK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t5              LFDK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t38             LFLK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t33             LFLK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t100            LFLK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t34             LFLK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t84             LFLK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t92             LFLK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t3              LFDK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t22             LFDK-E-E------ARPMVQDAASVPGR----AQWVGRVRAWCSSDVKA-----------
t64             HFDK-E-E------ARPIVQDAASVPGK----AQWVGRVRAWCSSDVKA-----------
t18             HFDK-E-E------ARPIVQDAASVPGK----AQWVGRVRAWCSSDVKA-----------
t68             HFDK-E-E------ARPIVQDAASVPEK----AQWVGRVRAWCSSDVKA-----------
t28             HFDK-E-E------ARPIVKDAASVPGK----AQWVGRIRAWCSSDVKA-----------
t82             HFDK-E-E------ARPIVQDAASVPGE----AQWVGHIRAWCSSDIKA-----------
t41             HFDK-E-E------ARPIVQDAASVPGE----AQWVGHIRAWCSSDIKA-----------
t71             HFDK-E-E------ARPVVQDAPGVPGK----AQWVGKVRAWCSSDVKA-----------
t94             HFDK-E-E------ARPVVQDAPGVPEQ----AQWVGKMRAWCSSDVKA-----------
t99             HFDK-EKE------ARPVVQDAPGVPGK----AQWVGRIRAWCSSDVKA-----------
t40             HFDK-E-E------ARPVVQDAPGVPGK----AQWVGRVRAWCSSEIKT-----------
t90             HFDK-E-E------ARPVVQDAPGVPGK----AQWVGRVRAWCSSEIKT-----------
t4              SFDK-E-E------ARPVVQDAPGVPGR----AQWVGRVRPWCSSDVKA-----------
t36             FFAK-D-E------DRPGIQNAVSVPCG----DQWVGSIRGWCSSQHRYGLANHILVHEP
t87             FFAK-D-E------DRPGIQNAMSVPCG----DQWVGSIRGWCSSQHRYGLANHILVHEP
t89             FFAK-D-E------ERPGIQNAMNVPCG----DQWVGSIRGWCSSQHRYGLANHILVHEP
t39             FFAK-D-E------ERPGIQNAMNVPCG----DQWVGSIRGWCSSQHRYGLANHILVHEP
t8              FFAK-D-E------ERPGIQNAMNVPCG----DQWVGSIRGWCSSQHRYGLANHILVHEP
t6              FFAK-D-E------ERPGIQNAMNVPCG----DQWVGSIRGWCSSQHRYGLANHILVHEP
t58             FFAK-D-E------DRPGIQNAMSVPCG----DQWVGSVRGWCSSQHRYGLAIHILVHQQ
t54             FFAK-D-E------DRPGIQNAMSVPCG----EQWVGSVRGWCSSQHRYGLAIHILVHQQ
t65             FF------------DRPGIANAMSVKCG----DQWVGSIRGWCSSQHQYGLANHILVHGP
t29             FF------------DRPGIANAMSVPCG----DQWVGSIRGWCSSQHQYGLANHILIHGP
t98             FF------------DRPGIANAMSVPCG----DQWVGSIRGWCSSQHQYGLANHILVHNP
t83             FF------------DRPGIANAMSVPCG----DQWVGSIRGWCSSQHQYGLANHILIHNP
t95             FF------------DRPAIANAMSVPCG----DQWVGSIRGWCSSQHQYGLANHILVHGP
t20             FF------------DRPGIANAMSVPCG----DQWVGSIRGWCSSQHQYGLANHILVHGP
t69             FF------------DRPGIANAMSVPCG----DQWVGSIRGWCSSQHQYGLANHILVHGP
t2              FF------------DRPGIANAMSVPCG----DQWMGSIKGWCSSQHQYGLANHILVHGP
t10             FF------------DRPGIANAMSVPCG----DQWMGSIKGWCSSQHQYGLANHILVHGP
t31             FF------------DRPGIANAMNVPCG----DQWVGCIRGWCSSQHQYGLANHILVHGP
t15             FF------------DRPGIANAMSVPCG----DQWVGCIRGWCSSQHQYGLANHILVHGP
t63             FF------------DRPGIANAMSVPCG----DQWMGIIRGWCSSQHQYGLANHILVHGP
t50             FF------------DRPGIANAMSVPCG----DQWMGVIRGWCSSQHQYGLANHVLVHGP
t25             FF------------DRPGIANAMSVPCG----DQWMGVIRGWCSSQHQYGLANHILVHGP
t51             FF------------DRPGIANAMSVPCG----DQWVGVIRGWCSSQHQYGLANHILVHGP
t9              FFDK-D-D------DRPGIANAMSVPCG----EQWGGPTRGWCSSQQKFGLASHTLSHDP
t47             FFDK-D-D------DRPGIANAMSVPCG----EQWGGPTRGWCSSQQKFGLASHTLSHDP
t60             FFDK-D-D------DRPGIANAMSVPCG----EQWGGPTRGWCSSQQKFGLASHTLSHNP
t30             FFDK-D-D------DRPGIANAMSVPCG----EQWGGPTRGWCSSQQKFGLASHTLSHTP
t70             FFDK-D-D------DRPGIANAMNVPCG----DQWGGPIRGWCSSQHKFGLAFHTLSHDP
t91             FFDK-D-D------DRPGIANAMNVPCG----DQWGGPIRGWCSSQHKFGLAFHTLSHDP
t49             FFDK-D-D------DRPGIANAMNVPCG----DQWGGPIRGWCSSQHRFGLAFHTLKHDP
t52             FFDK-D-D------DSPGIANAMNVPCG----DQWGGPIRGWCSSQHKFGLASHTLSHDP
t43             FFDK-E-D------DRPGIANAVSVPCA----DQVGGPIRGWCSSQVNFGLANHTLVQ-P
t1              FFDK-E-D------DRPGIANAVSVPCA----DQVGGPIRGWCSSQVKFGLANHTLVQ-P
t86             FFDK-E-D------DRPGIANAVSVPCA----DQVGGPIRGWCSSQVKFGLANHTLVQ-P
t72             FFDK-E-D------HRPGIANAVSVPCA----DQVGGPLRGWCSSQVKFGLANHTLVQ-P
t96             FFDK-E-D------ERPGIANAVSVPCA----DQVGGPIRGWCSSQVKFGLANHTLVQ-P
t44             FFDK-E-D------DRPGIANAVSVPCG----DQVGGPIRGWCSSQVKFGLANHTLAQNP
t45             FFDK-E-D------DRPGIANAVSVPCT----DQVGGPIRGWCSSQVKFGLANHTLVHNP
t74             FFDK-E-D------DRPGIANAVSVPCA----DQVGGPIRGWCSSQVKFGLANHTLVHNP
t26             FFDK-E-D------DRPGIANAVSVPCD----DQWGGPVRGWCSSQHKFGLADHTLIHIP
t61             FFDK-E-D------DRPGVANAVSVPCD----DQWGGPVRGWCSSQHKFGLADHTLVHIP
t97             FFDK-E-D------DRPGVANAMSVPCD----DQWGGPVRGWCSSQHKFGLADHTLVHVP
t17             FFDK-E-D------DRPGIANAVAVPCS----DQWGGPVRGWCSSQHKFGLADHTLVHVP
t11             FFDK-E-D------DRPGIANAVAVPCS----DQWGGPVRGWCSSQHKFGLADHTLVHVP
t23             FYDK-D-E------DRPGIANAVSVPVA----EQWVGSVRGWYSSEHKYGLANHILI-GP
t76             NFIQLS-MVRDTPHRLPKMASAAPVYKQTCHLEQVQGTARMWGKSGPRVVLNGHMLK-TQ
t53             NFIQLS-MVRDTPHGLPKMASAAPVYKQTCHLEQVQGTARMWGKSGPRVVLNGHMLK-TQ
t16             NFIQLS-MVRDTPHGLPKMASAAPVYKQTCHLEQVQGTARMWGKSGPRVVLNGHMLK-TQ
t42             NFIQLS-VVHDTPHRLPKMASAAAVFKQTCHLEQVPGTARMWGKSGPRVRLNGHVLK-NQ
t24             NFIQLS-VVHDTPHRLPKMASAAAVFKQTCHLEQVAGTARVWGKSGPRVKLNGHVLK-NQ
                

t73             SDLYRCVWMDCHLGANHYRQISRMKMITPTYTHMTEYANGL----WHPFYKASDHKNEAQ
t66             SDLYRCVWMDCHLGANHYRQISRMKMITPTYTHMTEYANGL----WHPFYKASDHKNEAQ
t32             SDLYRCVWMDCHLGANHYRQISRMKMITPTYTHMTEYANGL----WHPFYKASDHKNEAQ
t75             SDLYRCVWMECVLGANHYQQVSRMKMVTPAYTHMTEYANGL----WHPFYKNPDHKNEAQ
t79             SRLLRCVVMECVLGANVYHQISRMKMHGPTYSHVMEYAHGL----WKPFYQASDHKNEAQ
t27             SRLLRCVVMECVLGANVYHQISRMKMHGPTYSHVMEYAHGL----WKPFYQASDHKNEAQ
t93             SRLLRCVVMECVLGANVYHQISRMKMHGPTYSHVMEYAHGL----WKPFYQASDHKNEAQ
t59             SRLLRCVVMECILGANVYHQISRMKMHGPTYSHVMEYAHGM----WKPFYQASDHKNEAQ
t7              SRLLRCVVMECVLGANVYHQISRMKMHGPTYSHVMEYAHGM----WKPFYQASDHKNEAQ
t78             SRLLRCVVMECVLGANVYHQISRMKMHGPTYSHVMEYAHGM----WKPFYQASDHKNEAQ
t12             SRLLRCVVMECVLGANVYHQASRMKMHGPYYAHVTEYAHGL----WKPFYQTSDHKNEAQ
t81             SRLLRCVGMECNLGANHYHQVSRMKMHGPIYSHMTEYAVGL----WKPFYQASEHKNEAQ
t21             SRLLRCVGMECNLGANHYHQVSRMKMHGPIYSHMTEYAHGL----WKPFYQASEHKNEAQ
t80             SRLLRCVMIDCNQGANHYIQISRMKVHGPTYSHMTEYAHGL----WKPFYQASDHKNDAQ
t14             SRLLRCVMIDCNQGANHYIQISRMKVHGPTYSHMTEYAHGL----WKPFYQASDHKSDAQ
t85             SRLLRCVEIDCNQGANHYVQISRMKMYGPTYSHMTEYAHGL----WKPFYQASDHKNDAQ
t62             SRLLRCVVIDCNHGANHYVQISRMKMHGPTYSHMTEYAHGL----WKPFYQASDHKNDAQ
t19             SRLLRCVVIDCNHGANHYVQISRMKMHGPTYSHMTEYAHGL----WKPFYQASDHKNDAQ
t77             SRLLRCVVIDVNQGANHYVQISRMKMHGPTYSHMTEYAHGL----WKPFYQASDHKNDAQ
t88             SQLPRNTHIVVEIGANVYEQFSRMKTNIPIYAHVTEYAVGV----ERPFYE-SEFKNEAQ
t37             SQLPRNTRIVAEIGANVYEQYSRMKTNIPIYARVTEYAVGV----ARPFYD-AEFKNEAQ
t35             SQLPRNTRIVAEIGANVYEQYSRMKTVIPIYARVTEYAVGV----PRPFYD-AEFKNEAQ
t48             SQLPRNTRIVAEVGANVYEQYSRMKTVIPIYARVTEYAVGV----PRPFYD-AEFKNEAQ
t55             SQLPRNTRIVAEIGANVYEQYSRMKTNIPIYARVTEYAVGV----ARPFYD-AEFKNEAQ
t46             SQLPRNTRIVAEIGANVYEQYSRMKTNIPIYARVTEYAVGV----ARPFYD-AEFKNEAQ
t67             SQLPRNTRIVAEIGANVYEQYSRMKTNIPIYARVTEYAVGV----ARPFYD-AEFKNEAQ
t57             SQLPRNTRIVAEIGANVYEQYSRMKTNIPIYARVTEYAVGV----ARPFYD-AEFKNEAQ
t56             SKLPRNTKMVAEIGANVYEQASRMKTNIPIYAHVTEYALGV----DRPFYD-SEFKNEAQ
t13             SQLPRNDPIVPEVGANVYQQVSRMKTNIPIFAHVTEYAVGI----VKPFYD-NEWKQEAQ
t5              SQLPRNDPIVPEVGANVYQQVSRMKTNIPIFAHVTEYAVGI----VKPFYD-NEWKQEAQ
t38             SQLPRNDPIVPEVGANVYQQVSRMKTNIPIFAHVTEYAVGI----VKPFYD-SEWKQEAQ
t33             SHLPRNDPIVPEVGANVYQQVSRMKTNIPIFAHVTEYAVGI----VKPFYD-SEWKQEAQ
t100            SQLPRNDPIVPEVGANVYQQVSRMKTNIPIFAHVTEYAVGI----VKPFYD-SEWKQEAQ
t34             SQLPRNDPIVPEVGANVYQQVSRMKTNIPIFAHVTEYAVGI----VKPFYD-SEWKQEAQ
t84             SQLPRNDPIVPEVGANVYQQVSRMKTNIPIFAHVTEYAVGI----VKPFYD-SEWKQEAQ
t92             SQLPRNDPIVPEVGANVYQQVSRMKTNIPIFAHVTEYAVGI----VKPFYD-SEWKQEAQ
t3              SRLPRNDPVVHEVGANVYQQISRMKTSIPIYAHVTEYAVGI----IKPFYD-NEWKQEAQ
t22             SQLPTNDPIVPEVGANVYQQVSRMKTSIPIYAHVTEYAVGI----VKPFYD-NEWKQEAQ
t64             SKLPRNDPIVPEVGANVYQQLSRMKTNIPIYAHVTEYAVGI----VKPFYD-NEWKQEAQ
t18             SKLPRNDPIVPEVGANVYQQLSRMKTNIPIYAHVTEYAVGI----VKPFYD-NEWKQEAQ
t68             SKLPRNDPIVPEVGANVYQQISRMKTNIPIYAHVTEYAVGI----VKPFYD-NEWKQEAQ
t28             SQLPRNDPIVPEVGANVYQQDSRMKTNIPIYAHVTEYACGI----VKPFYE-NEWKQEAQ
t82             SQLPRNDPIVPEVGANVYQQVSRMKTNIPIYAHTTEYACGI----VKPFYE-NEWKQEAQ
t41             SQLPRNDPIVPEVGANVYQQVSRMKTNIPIYAHTTEYACGI----VKPFYE-NEWKQEAQ
t71             SQLPRNDTIVPEVGANVYQQVSRVKTHIPIYAHVTEYAVGI----VKPFYN-NEWKQEAQ
t94             SQLPRNDTIVPEVGANVYQQVSRVKTNIPIYAHVTEYAVGI----VKPFYN-NEWKQEAQ
t99             SELPRNDAIVPEVGANVYQQVSRMKTNIPIYAHATEYAVGI----VKPFYD-NEWKQEAQ
t40             SELPRNDAIVVEVGANVYQQISRMKTDIPIYAHATEYAVGI----VKPVYD-NEWKQEAQ
t90             SELPRNDAIVPEVGANVYQQISRMKTDIPIYAHATEYAVGI----VKPVYD-NEWKQEAQ
t4              SELPRNDAIWPEVGANVYQQISRMKTNIPIYPHVTEYAVGI----VKPFYL-NEWKQEAQ
t36             SKLHKTYRINRKVGANAYDQDSRMKAAAPVYPHIMEYAHGM----FNPFYGLSEPKNNAQ
t87             SKLHKTYRINRKVGANAYDQDSRMKAAAPVYPHIMEYAHGM----FNPFYGLSEPKNNAQ
t89             SKLHKTYKINRKVGANAYDQVSRMKAAAPVYPHIMEYAHGM----FNPFYGLSEPKNNAQ
t39             SKLHKTYKINRKVGANAYDQVSRMKAAAPVYPHIMEYAHGM----FNPFYGLSEPKNNAQ
t8              SKLHKTYKINRKVGANAYDQVSRMKAAAPVYPHIMEYAHGM----FNPFYGLSEPKNNAQ
t6              SKLHKTYKVVRKVGANAYDQVSRMKAAAPVYPHIMEYAHGM----FNPFYGLSEPKNNAQ
t58             SRLHKTYNIDRKNGANAYEQDSRMKAGAPVYPHIMEYAHGM----FNPFYGMSEPKNNAQ
t54             SRLHKTYNIDRKNGANAYDQDSRMKAGAPVYPHIMEYAHGM----FVPFYGMSEPKNNAQ
t65             SKLHRTYAINKKMGANVYQQTSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t29             SKLHRTYAINKKMGANVYQQTSRMKAAAPLYPHIMEYAHGM----VKPFYGQSEPKNEAQ
t98             SRLHRTYAINKKMGANVYQQSSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t83             SRLHRTYAINKKMGANVYQQTSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t95             SKLHRTYAINRKVGANVYQQTSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t20             SKLHRTYAINRKVGANVYQQMSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t69             SKLHRTYAINKKMGANVYQQISRMKALAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t2              SKLHRTYAINKKMGANVYQQISRMKALAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t10             SKLHRTYAINKKMGANVYQQISRMKALAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t31             SKLHRTYAINKKMGANVYQQTSRMKAAAPIYPHIMEYAHGM----VKPFYGISEPKNEAQ
t15             SKLHRTYAINRKMGANVYQQTSRMKAAAPLYPHIMEYAHGM----VEPFYGISEPKNEAQ
t63             SKLHRTYAINKKMGANVYQQDSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t50             SKLHRTYAINKKMGANVYQQDSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t25             SKLHRTYAINKKMGANVYQQDSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t51             SKLHRTYAINKKMGANVYQQDSRMKAAAPLYPHIMEYAHGM----VKPFYGISEPKNEAQ
t9              SSLHRTFAINRKMGANVYQQTSRMKASAPFYPHCMEYAHGV----CKPFYEHSEPKNEAQ
t47             SNLHRTFAINRKMGANVYQQASRMKASAPFYHHCMEYAHGV----CKPFYEHSEPKNEAQ
t60             SNLHRTFAINRKMGANVYQQTSRMKASAPFYHHCMEYAHGV----CKPFYEHSEPKNEAQ
t30             SNLHRTFAINRKMGANVYQQTSRMKASAPFYHHCMEYAHGV----CKPFYEHSEPKNEAQ
t70             SKLHRTFAINQKMGANVYQQMSRMKTPAPFYPHVMEYAHGV----CKPFYEHSEPKNEAQ
t91             SKLHRTFAINQKMGANVYQQMSRMKTPAPFYPHVMEYAHGV----CKPFYEHSEPKNEAQ
t49             SKLHRTFAINEKMGANVYQQNSRMKASAPFYPHVMEYAHGV----CKPFYEHSEPKNDAQ
t52             SKLHRTFGINKNMGANVYQQTSRMKANAPFYPHVMEYAHGV----CKPFYEHSEPKNEAQ
t43             SKLHRTFKINKKMGANVYQQTSRMKAEAPVYPHIMEYAHGV----CKPFYERSEPKNEAQ
t1              SKLHRTFKINKKMGANVYQQTSRMKAEAPVYPHIMEYAHGV----CKPFYERSEPKNEAQ
t86             SKLHRTFKINKKMGANVYHQTSRMKAEAPVYPHIMEYAHGV----CKPFYERSEPKNEAQ
t72             SKLHRTFKINKKIGANVYQQTSRMKADAPVYPHIMEYAHGV----YKPFYERSEPKNEAQ
t96             SKLHRTFKINKKIGANVYQQTSRMKAEAPVYPHIMEYAHGV----CKPFYERSEPKNEAQ
t44             SKLHRTFKINKKMGANVYQQTSRMKAEAPVYPHIMEYAHGV----CKPFYDRSEPKNEAQ
t45             SKLHRTFAINKKMGANVYQQTSRMKAEAPVYPHIMEYAHGV----CKPFYERSEPKNEAQ
t74             SKLHRTFAINKKMGANVYQQTSRMKAEAPVYPHIMEYAHGV----CKPFYERSEPKNEAQ
t26             SKLHRTFAINKKMGANVYQQTSRMKAAAPVYSHVMEYAHKV----VKPFYARSEPKNEAQ
t61             SKLHRTFAITKKMGANVYQQTSRMKATAPVYPHVMEYAHGV----VKPFYDRSEPKNEAQ
t97             SKLHRTFPINKKMGANVYQQTSRMKATAPVYPHVMEYAHGV----IKPFYDRSEPKNEAQ
t17             SLLHRTFAINRKMGANVYQQTSRMKAAAPVYPHMMEYAHGV----VKPFYERSEPKNEAQ
t11             SLLHRTFAINKKMGANVYQQTSRMKAAAPVYPHMMEYAHGV----VKPFYERSEPKNEAQ
t23             SKLHRTYQTTAKMGANVVKATNRMKRPQPVYPHVMEYANGV----VKPFYEVAESKNEAQ
t76             NTLHRQYLVDVELQATMVFVAARMKTDSSMYMSVREILHG------------CGIKDEAQ
t53             NTLHRQYLVDVELGATMVFVAARMKTDLSMYMSVREILHG------------CGIKDEAQ
t16             NTLHRQYLVDVELGATMVFVAARMKTDLSMYMSVREILHG------------CGIKDEAQ
t42             NILHRQYLVDVNLGATMVFVLARMKTDASMYMSHREILHGGTFDAAKPFRQICGTKDEAQ
t24             NVLHRQYLVDVDLGATMVFVAARMKTDASMYMSHREILHGGTFDAAKPFRQICGVKDEAQ
                

t73             GVGEK-PHQLPCVESETCQYETKHAKVCKQVHG-ALYLIGMKTVVKPLLGDWEGCKCRS-
t66             GVGEK-PHQLPCVESETCQYETKHAKVCKQVHG-ALYLIGMKTVVKPLLGDWEGCKCRS-
t32             GVGEK-PHQLPCVESETCQYETKHAKVCKQVHG-ALYLIGMKTVVKPLLGDWEGCKCRS-
t75             GVGEK-PHQLPCVESETCQYETKHAKVCKQVHG-ALYLIGMKTVAKPVLGDWEGCKCRSD
t79             GVGER-THQLPCVESHTCQYEVKHAKVCKLVHH-ALYLLGLRTVMKPHLGDVDGCRCRSD
t27             GVGER-THQLPCVESHTCQYEVKHAKVCKLVHH-ALYLLGIHTVMKPHLGNVDGCRCRSD
t93             GVGER-THQLPCVESHTCQYEVKHAKVCKLVHH-ALYLLGIHTVMKPHLGNVDGCRCRSD
t59             GVGER-THQLPCVDSHTCQYEVKHAQVCKLVHH-ALYLLGLRTVMKPHLGDVDGCRCRSD
t7              GVGER-THQLPCVDSHTCQYEVKHAQVCKLVHH-ALYLLGLRTVMKPHLGDVDGCRCRSD
t78             GVGER-THQLPCVDSHTCQYEVKHAQVCKLVHH-ALYLLGLRTVMKPHLGDVDGCRCRSD
t12             GVGES-THQLPCVESQTCQYEVKHAKVCKLVHH-ALYLLALHTMMKPRLGDIDGCRCRSE
t81             GLGER-PHQLPCVESQTCQYEIKVAKVCKLVHV-ALYLVGLKTVVKPKLGDWDGIRCRSE
t21             GVGER-PHQLPCVESQKCQYEVKVAKVCKLVHV-ALYLVGLKTVVKPKLGDWDGVRCRSD
t80             GVGER-PHQLPCVESQTCQYEMKHAKVCKLVHG-ALYLIALKTVVKPKLGVWQGCRCRSQ
t14             GVGER-PHQLPCVESQTCQYEMKHAKVCKLVHG-ALYLIALKTVVKPKLGVWQGCRCRSQ
t85             GVGER-PHQLPCVESQTCQYEVKHANVCKLVHA-ALYLIGLKTVVKPELGVWEGCRCRSQ
t62             GVGER-PHQLPCVEPQTCQYEVKHAKVCKLVHG-ALYLIGLQTVVKPKLGVWEGVQCRSQ
t19             GVGER-THQLPCVEPQTCQYEVKHAKVCKLVHG-ALYLIGLQNVVKPKLGVWEGVQCRSQ
t77             GVGER-VHQLPCVEPQTCQYEVKHAKVCKHVHG-ALYLIGLQTVVKPKLGVWEGCQCRSQ
t88             GWGES-GTSIPCVDSPDVQYEMKVAWVDKLMHT-ALYLMPLATVHKPEMGTVRGERCRAI
t37             GQGES-GTSIPCVDSPDIQYEMKHAWVEKLMHS-ALYLMPLATVHKPEMGTVKGERCRTI
t35             GQGES-GTSIPCVDSPDIQYEMKHAWVEKLMHS-ALYLMPLATVHKPQMGTVKGERCRTI
t48             GQGES-GTSIPCVDSPDIQYEMKHAWVEKLMHS-ALYLMPLATVHKPEMGTVKGERCRTI
t55             GQGES-GTSIPCVDSPDIQYEMKHAWVEKLMHS-ALYLMPLSTVHKPEMGTVKGERCRTI
t46             GQGES-GTSIPCVDSPDIQYEMKHAWVEKLMHS-ALYLMPLATVHKPEMGTVKGERCRTI
t67             RQGES-GTSIPCVDSPDIQYEMKHAWVEKLMHS-ALYLMPLATVHKPEMGTVKGERCRTI
t57             GQGES-GTSIPCVDSPDIQYEMKHAWVEKLMHS-ALYLMPLATVHKPEMGTVKGERCRTI
t56             GQGES-GTSIPCVDSPDVQYELKHAWVDKLMHT-ALYLMPLPTVHKPKMGTVKGERCRAM
t13             GQGEA-GACIPCVDSKDVQYELKHAYVKKLMHT-SLYLMHIETCHKPVMGTVKGNRCRAI
t5              GQGEA-GACIPCVDSKDVQYELKHAYVKKLMHT-SLYLMHIETCHKPVMGTVKGNRCRAI
t38             GQGEA-GACIPCVDSPDVQYELKHAYVKKLVHT-SLYLMHIDTCHKPVMGTIKGNRCRAI
t33             GQGEA-GACIPCVDSPDVQYELKHAYVKKLVHN-SLYLMHIDTCHKPAMGTVKGNRCRAI
t100            GQGEA-GACIPCVDSPDVQYELKHAYVKKLVHT-SLYLMHIDTCHKPVMGTVKGNRCRAI
t34             GQGEA-GACIPCVDSPDVQYELKHAYVKKLVHT-SLYLMHIDTCHKPVMGTVKGNRCRAI
t84             GQGEA-GACIPCVDSPDVQYELKHAYVKKLVHT-SLYLMHIDTCHKPVMGTVKGNRCRAI
t92             GQGEA-GACIPCVDSPDVQYELKHAYVKKLVHT-SLYLMHIDTCHKPVMGTVKGNRCRAI
t3              GQGEA-GASIPCVNSPDVQYELKHAHIKKLMHT-SLYLMHLGTCHKPVMGTVKGDRCRAI
t22             GQGEA-GASIPCVNSPDVQYELKHAHIKKLMHT-SLYLMHLKTCHKPVMGTVKGDRCRAI
t64             GVGEA-GASIPCVDSPDVQYELKHAEVRKLMHD-SLYLMHLETCHKPIMGTVKGDRCRAI
t18             GVGEA-GASIPCVDSPDVQYELKHAEVRKLMHD-SLYLMHLETCHKPIMGTVKGDRCRAI
t68             GVGEA-GASIPCVDSPDVQYELKHAEVRKLMHD-SLYLMHLETCHKPIMGTVKGDRCRAI
t28             GQGEA-GASIPCVDSPDVQYELKHAEVKKLMHD-SLYLMHLETCHKPIMGTVKGDRCRAI
t82             GQGEA-GASIPCVDSPDVQYELKHANVKKLMHD-SLYLMHLETCHKPIMGTVKGDRCRAI
t41             GQGEA-GASIPCVDSPDVQYELKHANVKKLMHD-SLYLMHLETCHKPIMGTVKGDRCRAI
t71             GQGEA-GASIPCVDSPDDQYELKHAEVKKLMHD-SLYLPHLETCHKPIMGTVKGGRCRAS
t94             GQGEA-GASIPCVDSPDVQYELKHAEVKKLMHD-SLYLPHLETCHKPIMGTVKGGRCRAS
t99             GQGET-GASIPCVDSPDVQYEMKHAEVKKLMHD-SLYLMHIETCHKPIMGTVKGDRCRAT
t40             GQGEA-GASIPCVDSPDVQYELKHAEVKKLMHD-SLYLMHLETCHKPIMGTVKGDRCRAT
t90             GQGEA-GASIPCVDSPDVQYELKHAEVKKLMHD-SLYLMHLETCHKPIMGTVKGDRCRAT
t4              GQGEA-GASIPCVDSPDVQYELKHAEVKKLMHD-SLYLWHLETCVKPIMGTVKGDRCRAT
t36             GNGEN-PMNKPCVESEDCQYEKKHASMDKLMHQ-SLYLMHINIMSKPAMGEWVGNRCRNE
t87             GNGEN-PMNKPCVESEDCQYEKKHASMDKLMHQ-SLYLMHINVMSKPAMGEWVGNRCRND
t89             GNGEN-PMNVPCVESEDCQYEKKHASMTKLMHQ-SLYLMHINIMSKPAMGEWVGVRCRNE
t39             GNGEN-PMNVPCVESEDCQYEKKHASMTKLMHQ-SLYLMHINIMSKPAMGEWVGVRCRNE
t8              GNGEN-PMNVPCVESEDCQYEKKHASMTKLMHQ-SLYLMHVNIMSKPAMGEWVGVRCRNE
t6              GNGEN-PMNVPCVESEDCQYEKKHASMTKLMHQ-SLYLMHINIMSKPAMGEWVGVRCRNE
t58             GNGEN-PMNVPCVESDDCQYEKKHASMDKQMHQ-SLYLMHMNIMSKPAMGEWVGNRCRNE
t54             GNGEN-PMNVPCVESDDCQYEKKHASMDKQMHQ-SLYLMHMNIMSKPAMGEWVGNRCRNE
t65             GNGEN-PMNVPSVESGECQYEHKHAAMEKLMHH-SLYLMRVNTMSKPVMGDWVGNRCRAE
t29             GNGEN-PMNVPSVESGECQYESKHAAMEKLMHQ-SLYLMRVNTMPKPVMGDWDGNRCRAE
t98             GNGEN-PMNVPSVESGECQYESKHAAMEKLMHQ-SLYLMRVNTMSKPVMGDWVGNRCRAE
t83             GNGEN-PMNVPSVESGECQYESKHAAMEKLMHQ-SLYLMRVNTMSKPVMGDWVGNRCRAE
t95             GNGEN-PMNVPSVESGECVYESKHAAMEKLMHQ-SLYLMRVNTMSKPVMGDWVGHRCRAE
t20             GNGEN-PMNVPSVESGECVYESKHAAMEKLMHQ-SLYLMRVNTMSKPVMGDWVGHRCRAE
t69             GNGEN-PMNVPCVESGECQYENKHAAMEKLMHQ-SLYLMRVNTMSKPVMGDWVGNRCRAE
t2              GNGEN-PMNVPCVESGECQYENKHAAMEKLMHQ-SLYLMRVNTMSKPVMGDWVGNRCRAE
t10             GNGEN-PMNVPCVESGECQYENKHAAMEKLMHQ-SLYLMRVNTMSKPVMGDWVGNRCRAE
t31             KNGEN-PMNVPCVESGECQYESKHAAMEKLMHQ-SLYLMRVNTMSKPVMGDWVGNRCRAE
t15             KNGEN-PMNVPCVESGECQYESKHAAMEKLMHQ-SLYLMRVNTMSKPVLGDWVGNRCRAE
t63             KNGEN-PMNVPCVESGECQYESKHAAMEKLMHQ-SLYLMRANTMSKPVMGDWVGSRCRAE
t50             KNGEN-PMNVPCVESGECQYESKHAAMEKLMHQ-SLYLMRANTMSKPVMGDWVGSRCRAE
t25             KNGEN-PMNVPCVESGECQYESKHAAMEKLMHQ-SLYLMRANTMSKPVMGDWVGSRCRAE
t51             KNGEN-PMNVPCVESGECQYESKHAAMEKLMHQ-SLYLMRVNTMSKPIMGDWVGNRCRAD
t9              GNGEK-PMNVPCVESIDCQYENKHATMTKLMHH-SLYLMRMHTMSKPIMGDVNGNRCRAD
t47             GNGEK-PMNVPCVESRDCQYENKHATMTKLMHQ-SLYLMRMHTMSKPIMGHVNGNRCRAD
t60             GNGEK-PMNVPCVESIDCQYESKHAAMTKLMHQ-SLYLMRIHTMSKPIMGDVNGNRCRAD
t30             GNGEK-PMNVPCVESIDCQYENKHATMTKLMHQ-SLYLMRMHTMSKPIMGDVNGNRCRAD
t70             GNGEKVPMNVPCVESMDCQYENKHAPMAKLMHQDSLYLMRMHTMSKPLMGDVNGNRCRAD
t91             GNGEKVPMNVPCVESMDCQYENKHAPMAKLMHQ-SLYLMRMHTMSKPLMGDVNGNRCRAD
t49             GNGDKVPMNVPCVESMDCQYENKHAPMAKLMHQ-SLYLMRMYTMSKPIMGDVNGNRCRAE
t52             GNGEK-PMNVPCVESIECQYENKHATMAKLMHD-SLYLMRMHTMSKPVMGDVNGHRCRAD
t43             GNGEK-QGNVPCVESMECQYENKHAIMAKLMHP-PLYLMRMETMSKPPMGDVDGHRCRAG
t1              GNGEK-QGNVPCVESMECQYENKHAIMAKLMHP-PLYLMRMETMSKPPMGDVDGHRCRAK
t86             GNGEK-QGNVPCVESMECQYENKHAIMAKLMHP-PLYLMRMETMSKPPMGDVDGHRCRAG
t72             GNGEK-QGNVPCVESVECQYENKHAIMAKLMHP-PLYLMRMETMSKPPMGDVDGHRCRAG
t96             GNGEK-QGNVPCVESMECQYENKHAIMAKLMHP-PLYLMRMETMSKPPMGDVDGHRCRAG
t44             GNGEK-QGNVPCVESMDCQYENKHAIMAKLMHP-PLYLMRMETMSKPPMGYVDGHRCRAG
t45             GNGEK-QGNVPCVESMDCQYENKHAIMAKLMHP-PLYLMRMETMSKPPMGDVDGHRCRAG
t74             GNGEK-QGNVPCVESMDCQYENKHAIMAKLMHP-PLYLMRMETMSKPPMGDVDGHRCRAG
t26             GNGEK-QWNVPCVESMDCQYENKHATMAKLMHP-PLYLMRMQTMAKPPMGDVDGHRCRAG
t61             GNGEK-QWNVPCVESMDCQYENKHATMAKLMHP-PLYLVKMQTMSKPPMGDVDGHRCRAG
t97             GNGEK-QWNVPCVESMDCQYENKHATMAKLMHP-PLYLVKMQTMSKPPMGDVDGHRCRAG
t17             GNGEK-QWNVPCVQSVDCQYENKHATMAKLMHP-PLYLMRMETMSKPPMGDVDGVRCRAG
t11             GNGEK-QWNVPCVQSVDCQYENKHATMAKLMHP-PLYLMRMETMSKPPMGDVDGVRCRAG
t23             GNGEK-PVNVPCVESPDCQYESKHARVNKLMHP-SLYLMCMEAMNKPIMGDWDGNRCRSP
t76             ADGQR-PATLIVVLSKDNKGITEHGAVLKKIHP----------LCKRCMENGRCLRYKND
t53             ADGQR-PATLIVVLSKDNKGITEHGAVLKKIHP----------LCKRCMENGRCLRYKND
t16             ADGQR-PATLIVVLSKDNKGITEHGAVLKKIHP----------LCKRCMENGRCLRYKND
t42             PDGRR-PATLLVVLSKDNQGITEHGAVLKHVHP----------LCKKDCNNNRCLRCKNV
t24             PDGQR-PATLLVVLSKDNVGITEHGAVLKHVHP----------LCKKDCNNNRCLRCKNV
                

t73             --KLYVSQLDH----KTLSK-NLGLY--MQKRTWLATAPLQ------IGCMFMLVGRKKN
t66             --KLYVSQLDH----KTLSK-NLGLY--MQKRTWLATAPLQ------IGCMFMLVGRKKN
t32             --KLYVSQLDH----KTLSK-NLGLY--MQKRTWLATAPLQ------IGCMFMLVGRKKN
t75             LIKLYVSQLDH----KTLSK-NMGLY--MRNRTWLATSPLQ------IGCIFMLVGRKKN
t79             LNNLILSQLDD----KTLSK-NCFTY--LGNMTWLATSPLH------IGCMIIFVGRKQQ
t27             LNNLILSQLDD----KTLSK-NCFTY--LGNMTWLATSPLH------IGCMIIFVGRKQQ
t93             LNNLILSQLDD----KTLSK-NCFTY--LGNMTWLATSPLH------IGCMIIFVGRKQQ
t59             LNNLILSQLDD----KTLSK-NCFTY--LGNMTWLATSPLH------IGCMIIFVGRKQQ
t7              LNNLILSQLDD----KTLSK-NCFTY--LGNMTWLATSPLH------IGCMIIFVGRKQQ
t78             LNNLILSQLDD----KTLSK-NCFTY--LGNMTWLATSPLH------IGCMIIFVGRKQQ
t12             LNKLALSQLDD----KTLSK-NCFQY--LGNMTWLATSPLH------VGCMIIF------
t81             LNKLYLSQLDD----KTLSK-NCFIY--LGNMTWLATSPLQ------IGWLVLFDGRKRQ
t21             LNKLYLSQLDD----KTLSK-NCFRY--LGNMTWLATSPLQ------NGCVVIFAGRKRQ
t80             LSKLVLSQLDE----KTLSK-NCSIY--LGNMTWLATSPLQ------IGCVILFGGRKRQ
t14             LSKLVLSQLDE----KTLSK-NCSIY--LGNMTWLATSPLQ------IGCVILFGGRKRQ
t85             LSKLALSQLDE----KTLSK-NCSIY--LGNMTWLATSPLQ------IGCIILFGGRKRQ
t62             LSKLILSQLDD----KTLSK-NCSIY--LGNMTWLATSPLQ------IGCIIMFDGRKRQ
t19             LSKLILSQLDD----KTLSK-NCSIY--LGNMTWLATSPLQ------IGCIILFDGRKRQ
t77             LSKLILSQLDD----KTLSK-NCNIY--LGNMTWLATFPLQ------IGCIILFDGRKRQ
t88             L-KLLMMQLD------TLSR-NQLPK--LCQGTWLDASPLQ------IGVQVMLVGKKGG
t37             L-KLLMVQLDE----KTLSQ-NQIPD--LCQRTWLDASPLQ------IGVQVVLVGKKRG
t35             L-KLLMVQLDE----KTLSQ-NQIPD--LCQRTWLDASPLQ------IGVQVVLVGKKRG
t48             L-KLLMVQLDE----KTLSQ-NQIPD--LCQRTWLDASPLQ------IGVQVVLVGKKRG
t55             L-KLLMVQLDE----KTLSQ-NQIPD--LCQRTWLDASPLQ------IGVQVVLVGKKRG
t46             L-KLLMVQLDE----KTLSQ-NQIPD--LCQRTWLDASPLQ------IGVKVVLVGKKRG
t67             L-KLLMVQLDE----KTLSQ-NQIPD--LCQRTWLDASPLQ------IGVQVVLVGKKRG
t57             L-KLLMVQLDE----KTLSQ-NQIPD--LCQRTWLDASPLQ------IGVQVVLVGKKRG
t56             L-KLNMMQLDE----KTLSQ-NQIIK--LCQRTWLDASPLQ------IGVNCVLPGKKGG
t13             L-KLSMIQLDQ----KTLSQ-NQRAK--LCQRTWLDTSPLQ------MGMTLVLVGKKVG
t5              L-KLSMIQLDQ----KTLSQ-NQRAK--LCQRTWLDTSPLQ------MGMTLVLVGKKVG
t38             L-KLTMIQLDQ----KTLSQ-NQRAR--LCQRTWLDTSPLQ------MGMTIVLVGKKVG
t33             L-KLTMIQLDQ----KTLSQ-NQRAR--LCQRTWLDTSPLQ------MGMTIVLVGKKVG
t100            L-KLTMIQLDQ----KTLSQ-NQRAR--LCQRTWLDTSPLQ------MGMTIVLVGKKVG
t34             L-KLTMIQLDV----KTLSQ-NQRAR--LCQRTWLDTSPLQ------MGMTIVLMGKKVG
t84             L-KLTMIQLDV----KTLSQ-NQRAR--LCQRTWLDTSPLQ------MGMTIVLMGKKVG
t92             L-KLTMIQLDV----KTLSQ-NQRAR--LCQRTWLDTSPLQ------MGMTIVLMGKKVG
t3              L-KLSMIQLDQ----KTLSQ-NVRAR--LCQRTWLDTSPLQ------MGMVAVLLGKKLG
t22             L-KLKMIQLDQ----KTLSQ-NQAAR--LCKRTWLDTSPLQ------MGMNVVLIGQKLG
t64             L-KLPMIQLDQ----KTLSH-NQPRR--LCQRTWLDASPLQ------VGMNIMLMGKKAP
t18             L-KLPMIQLDQ----KTLSH-NQPRR--LCQRTWLDASPLQ------VGMNIMLKGKKAP
t68             L-KLPMIQLDQ----KTLSH-NQPRR--LCQRTWLDASPLQ------VGMNIMLMGKKAP
t28             L-KLSMIQLDE----KTLSQ-NQRPG--LCQRTWLDANPLQ------MGMNTMLVGKKTP
t82             L-KLNMIQLDQ----KTLSQ-NQRPG--LCQRTWLDASPLQ------MGMHIMLVGKKTP
t41             L-KLNMIQLDQ----KTLSQ-NQRPG--LCQRTWLDASPLQ------MGMHIMLVGKKTP
t71             L-KLKMIQLDQ----KTLSQ-NQQRR--LCQRTWLDSSPLQ------MGMKIMLQGKKTP
t94             L-KLNMIQLDQ----KTLSQ-NQQRR--LCQRTWLDASPLQ------MGMKIMLQGKKIP
t99             L-KLKMIQLDQ----KTLSQ-NQKRR--LCQRTWLDASPLQ------MGMKMMLQGKKTP
t40             L-KLKMIQLDQ----KTLSQ-NQKKR--LCQCTWLDACPLQ------MGMKIMLQGKKTP
t90             L-KLKMIQLDQ----KTLSQ-NQKKR--LCQCTWLDACPLQ------LGMKIMLQGKKTP
t4              L-KLKMIVLDP----KTLSQ-NQKRR--LCQRTWLDASPLQ------VGMKIMLQGKKTP
t36             LTALRIIQLDVGVSGKTLGQ-NIGVSKLLNDRTWLATSPLE------IGCGVMSVEKKEA
t87             LTALRIIQLDVGHSGKTLGQ-NIGVSKLLNDRTWLATSPLE------IGCLVMSVEKKEA
t89             LTALRIVQLDVGHSGKTLGQ-NIGVSKLLNDRTWLATSPLE------IGCGVISVEKKEA
t39             LTALRIVQLDVGHSGKTLGQ-NIGVSKLLNDRTWLATSPLE------IGCGVISVEKKEA
t8              LTALRIVQLDVGHSGKTLGQ-NIGVSKLLNDRTWLATSPLE------IGCGVISVEKKEA
t6              LTALRIVQLDVGHSGKTLGQ-NIGVSKLLNDRTWLATSPLE------IGCGVISVEKKEA
t58             LTALHVVQLDVGFSGKTLGQ-NIGISELLNDRTWLATSPLE------IGCGVMAVEKKEA
t54             LTALHIVQLDVGFSGKTLGQ-NIGISELLNDRTWLATSPLE------IGCGVMAVEKKEA
t65             LTALQTVQLDVGSSGKTLGQ-NIVTSKKLGDRTWLAASPLQ------IGCGVMVQEKKIA
t29             LTALQTVQLDVGSSGKTLGQ-NIVTSKKLGDRTWLAASPLQ------IGCGVMVQEKKIA
t98             LTALQTVQLDVGSSEKTLGQ-NIVTSKRLGDRTWLAASPLQ------IGCGVMVQEKKIA
t83             LTALQTVQLDLGSSGKTLGQ-NIVTSKKLGDRTWLAASPLQ------IGCGIMVQEKKIA
t95             LTELQTVQLDVGSSGKTLGQ-NIVTSKKLGDRTWLAASPLQ------IGCGVMVQEKKIA
t20             LTELQTVQLDVGSSGKTLGQ-NIVTSKKLGDRTWLAAPPLQ------IGCDVMVQEKKIA
t69             LTALKTGQLDVGSSGKTLGQ-NIMTSKKLGDRTWLAANPLQ------IGRGVMVWEKKVA
t2              LTALKTGQLDVGSSGKTLGQ-NIMVSKKLGDRTWLAASPLQ------IGCGVMVWEKKVP
t10             LTALKTGQLDVGSSGKTLGQ-NIMVSKKLGDRTWLAASPLQ------IGCGVMVWEKKVP
t31             LTALKTVQLDVGSNGKTLGK-NIMTPKKLGDRTWLAASPLQ------IGCGVMVQEKKVA
t15             LTALKTVQLDIGNSGKTLGQ-NIMTPKRLGERTWLAASPLQ------IGCGVVVQEKKVA
t63             LTALKTVQLDVGSSGKTLGQ-NIMTPKKLGDRTWLAASPLQ------IGCDVMVQEKKVA
t50             LTALKTVQLDVGSSGKTLGQ-NIMTPKKLGDRTWLAASPLQ------IGCDVMVQEKKVA
t25             LTALKIVQLDVGSSGKTLGQ-NIMTPKKLGDRTWLAASPLQ------IGCDVMVQEKKVA
t51             LTALKTVQLDVGSSGKTLGQ-NIMTPKNLGDKTWLAASPLQ------IGCGIMVQEKKVA
t9              LTALKMLQLDIGFSAKTLGQ-NVVVPHLLGHRTWLATSPLQ------IGCGVMIFGNKIG
t47             LTALKMLQLDIGFSAKTLCQ-NIVVAHLLGHRTWLATSPLQ------IGCMVMIFGNKIG
t60             LTALKMLQLDIGFSAKTLGQ-NIVVPHCLGHRTWLATSPLQ------IGCMVMIFGNKIG
t30             LTALKMLQLDIGFSAKTLGQ-NIIVPHCLGHRTWLATSPLQ------IGCMVMIVGNKIG
t70             LTSLKMLQLDIGFCAKTLGQ-NIVVPKLLGHRTWLATAPLQ------IGCGMMIFGNKIG
t91             LTSLKMLQLDIGFCAKTLGQ-NIVVPKLLGHRTWLATAPLQ------IGCGMMIFGNKIG
t49             LTSLKMLQLDIGFSAKTLGQ-NIVPPKLLGHRTWLATSPLQ------IGCGVMIFGNKIG
t52             LTALKMLQLDIGFSAKTLGQ-NIVAPKLLGVRTWLATSPLQ------IGCGVMIFGNKIG
t43             LTALKVVQLDIGFSSKTLGQLNIIDCKLLGHRTWLATSPLQ------IGVDVMVMGNKIG
t1              LTALKIVQLDIGFSAKTLGQLNIIDCKLLGRHTWLATSPLQ------IGCDMMVMGNKIG
t86             LTALKIVQLDIGFSAKTLGQLNIIDCKLLGHRTWLATSPLQ------IGCDVMVMGNKIG
t72             LTALKIVQLDIGFSAKTLGQLNIIDCKLLGHRTWLATSPLQ------IGCDVMVMGNKIG
t96             LTALKIVQLDIGFSAKTLGQLNIIDCKLLGHRTWLATSPLQ------IGCDVMVIGNKIG
t44             LTALKIVQLDIGFSAKTLGQLNIIDCKLLGHRTWLATSPLQ------IGCDIMVMGNKIG
t45             LTALKIVQLDIGFSAKTLGQLNIIDCKLLGHRTWLATSPLQ------IGCDVMVMGNKIG
t74             LTALKIVQLDIGFSAKTLGQLNIIDCKLLGHRTWLATSPLQ------IGCDVMVVGNKIG
t26             LTALKIVQLDIGFSQKTLGQ-NIIDSKHLGHRTWLATSPLQ------IGCSAMVMGNKIG
t61             LTALKIVQLDIGFSSKTLGQ-NIIHSKLLGHRTWLATSPLQ------IGCDVMVMGNKIG
t97             LTALQIVQLDIGFSAKTLGQ-NIIHSKLLGHRTWLATSPLQ------IGCDVVVMGNKIG
t17             LTALKIVQLDIGFSAKTLGQ-NIIDSKLLGHRTWLATSPLQ------IGCDVMVVGNKIG
t11             LTALKIVQLDIGFSAKTLGQ-NIIDSKLLGHRTWLATSPLQ------IGCDVMVVGNKIG
t23             LCLLKVIQLDMGVSGKTLGQ-NIVMAKLLGERTWLATSPLQ------IGCDVVAVGKKPE
t76             LTGDQLVQLAD----NTCAW-NLFEC--LRDSKSLFGSPLFIKVDEDRGFTAP-------
t53             LAGDQLVQLAD----NTCAW-NLFEC--LRDSKSLFGSPLFIKVDEDRGFTAP-------
t16             LAGDQLVQLAD----NTCLW-NLFEC--LRDSKSLFGSPLFIKVDEDRGFTAP-------
t42             LAGNQLIQLSD----VTCAW-NLFEC--LGDSESLFGSPLAIKVDEDRGFTAP-------
t24             LAGNQLVQLAD----ITCAW-NLFEC--LGDSESLFGSPLAIKVDEDRGFTAP-------
                

t73             SEE-NYNKAADPTVIWFYTQPIVYV-ADVFGCTKGKNPQEMRG------NNVMSESLGDD
t66             SEE-NYNKAADPTVIWFYTQPIVYV-ADVFGCTKRKNPQEMRG------NNVMSESLGDD
t32             SEE-NYNKAADPTVIWFYTQPIVYV-ADVFGCTKGKNPQEMRG------NNVMSESLGDD
t75             SEE-NYNKAADPTVIWFYTQPIVYV-ADVFGCTKGKNPQEMRK------NNVISESLGDD
t79             SAN-NYNRAGDPTTICFCRKPIVMH-ADVFGCARAKDPQEMRM------NNVISESLGDD
t27             SAN-NYNRAGDPTTICFCRKPIVMH-ADVFGCARAKDPQEMRM------NNVISESLGDD
t93             SAN-NYNRAGDPTTICFCRKPIVMH-ADVFGCARAKDPQEMRM------NNVISESLGDD
t59             SGN-NYNQAGDPTTICFCRKPIVMH-ADVFGCARAKDPQEMRM------NNVISESLGDD
t7              SGN-NYNRAGDPTTICFCRKPIVMH-ADVFGCARAKDPQEMRM------NNVISESLGDD
t78             SGN-NYNRAGDPTTICFCRKPIVMH-ADVFGCARAKDPQEMRM------NNVISESLGDD
t12             ------------------------------------------V------NNVLSQSLGDD
t81             SAE-DYNRAADPTTISFCRKPIVQH-ADVFGCDRDKDPQEMRT------NNVISESLGDD
t21             SAE-DYNRAADPTTIAFCRKPIVQH-ADVFGCDKDKDPQEMRM------NNVISESLGDD
t80             SHGLNYNRAADPTTICFYKKPIVVQGADVFGCARGKDPQEMKA------NNVISGSLGDD
t14             SHGLNYNRAADPTTICFYKKPIVVQGADVFGCARGKDPQEMKA------NNVISGSLGDD
t85             SHGLNYNRAADPTMICFYKKPIVVQGADIFGCARGKDPQEMKS------NNVISGSLGDD
t62             SHGLQYNRAADPTTICFYKKPIVVQGADIFGCARGKDPQEMKA------NNVTSGSLGDD
t19             SHGLQYNRAADPTTICFYKKPIVVQGADIFGCARGKDPQEMKA------NNVTSGSLGDD
t77             SYGLQYNRAADPTTICFYKKPIVVQGADIFGCARGKDPQEMKA------NNVTSGSLGDD
t88             SKK-EYELAADQVIIYFYQAPIIYVKADVFSGTVAKKAQAMR-------KSTGSQSIGDD
t37             SKK-DYELAADPVIIYFYQAPIIHHKADVFAGTVAKKSQAMRS------RSIGSQSVGDD
t35             SKK-DYELAADPVIIYFYQAPIIYHKADVFAGTVAKKSQAMRS------RSIGSQSVGDD
t48             SKK-DYELAADPVIIYFYQAPIIYHKADVFAGTVAKKSQAMRS------RSIGSQSVGDD
t55             SKK-DYELAADPVIIYFYQAPIIHHKADVFAGTVAKKSQAMRS------RSIGSQSVGDD
t46             SKK-DYELAADPVIIYFYQAPIIHHKADVFAGTVAKKSQAMRS------RSIGSQSVGDD
t67             SKK-DYELAADPVIIYFYQAPIIHHKADVFAGTVAKKAQAMRS------RSIGSPSVGDD
t57             SKK-DYELAADPVIIYFYQAPIIHHKADVFAGTVAKKAQAMRS------RSIGSPSVGDD
t56             SNK-DYELAADPVIIYFYQAPIIHHKADVFSGTVAKKAQAMRQ------QSTGSQSVGDD
t13             SKK-DYEVAADPVIMYFYDAPMIMRPTDVFEGTNNKKAQAMRS------RSTASQSIGDD
t5              SKK-DYEVAADPVIMYFYDAPMIMRPTDVFEGTNNKKAQAMRS------RSTASQSIGDD
t38             SKK-DYEIAADPVIMYFYQAPMIMRPTDVFEGTNNRKAQAMRS------RSTASQSIGDD
t33             SKK-DYEIAADPVIMYFYQAPMIMRPTDVFEGTNNRKAQAMRS------RSTASQSIGDD
t100            SKK-DYEIAADPVIMYFYQAPMIMRPTDVFEGTNNRKAQAMRS------RSTASQSIGDD
t34             SKK-DYEIAADPVIMYFYQAPMIMRPTDVFEGTNNRKAQAMRS------RSTASQSIGDD
t84             SKK-DYEIAADPVIMYFYQAPMIMRPTDVFEGTNNRKAQAMRS------RSTASQSIGDD
t92             SKK-DYEIAADPVIMYFYQAPMIMRPTDVFEGTNNRKAQAMRS------RSTASQSIGDD
t3              SKK-DYEIAADPVIKYFYQAPIIMRRTDVFEGTDDQKAQAMRV------RSTASQSIGDD
t22             SKH-DYEIAADPVIMYFYQAPIIMRRTDVFEGTDDQKAQAMRL------RSTASRSIGDD
t64             SKK-DYEIAADPVIMYFYQAPIIMRRTDVFEGTHNKKAQAMRV------RSTASQSIGDD
t18             SKK-DYEIAADPVIMYFYQAPIIMRRTDVFEGTHNKKAQAMRV------RSTASQSIGDD
t68             SKK-NYEIAADPVIMYFYQAPIIMRRTDVFEGTHNKKAQAMRV------RSTASQSIGDD
t28             SKK-DYEIAADPVIMYFYQAPIIMRRTDVFEGTNNKKSQAMRV------QSTSSQSIGDD
t82             SKK-DYEIAADPVIMYFYQAPIIMQRTDVFEGTNNKKSQAMRV------HSTSSQSIGDD
t41             SKK-DYEIAADPVIMYFYQAPIIMQRTDVFEGTNNKKSQAMRV------HSTSSQSIGDD
t71             SKK-DYEIAADPAIMHFYRAPIIMRRTDVFEGTNNKKAQAMRI------RSTASQSIGDD
t94             SKK-DYEIAADPAIMYFYQATIIMRRTDVFEGTNNKKAQAMRM------RSTASQSIGDD
t99             SKK-DYEIAADPVIMYFYQSPIIMRRTDVFEGTNNKKAQAMRV------RSTASQSIGDD
t40             SKK-DYEIAADPVIMYFYQSPIIMRRTDVFEGTNNKKAQAMRI------RSTASQSIGDD
t90             SKK-DYEIAADPVIMYFYQSPIIMRRTDVFEGTNNKKAQAMRV------RSTASQSIGDD
t4              SKK-DYEIAADPVIMYFYQSPIIMRHTDVFEGTNNKKAQAMRL------RSTASQSIGDD
t36             SPK-EFEVAADPTVIYFYRNLIIQKITDVLSAVRMESPQEMRT------QDVNSSSLGDN
t87             SGK-EFEVAADPTVIYFYRNLIIAKITDVLSAVRMESPQEMRE------QDVNSSSLGDN
t89             SPK-EFEVAADPTVIYFYRSLIIVHITDVLSAVRMDSPQEMRN------QDVNSPSLGDN
t39             SPK-EFEVAADPTVIYFYRSLIIVHITDVLSAVRMDSPQEMRN------QDVNSPSLGDN
t8              SPK-EFEVAADPTVIYFYRSLIIVHITDVLSAVRMDSPQEMRN------QDVNSPSLGDN
t6              SPK-EFEVAADPTVIYFYRSLIIVHITDVLSAVRMDSPQEMRN------QDVNSPSLGDN
t58             SPK-EFEVAADPTVIYFYRNLIIQHITDVLSAVRMDSPQEMRV------QDVNSPSLGDN
t54             SPK-EFEVAADPTVIYFYRNLIIQHITDVLSAVRMDSPQEMRV------QDVNSPSLGDN
t65             SPQ-EVEVAAD---IYFYRNMVVQRLTDVVAAVRMQSPQEMRTPVLVCIQKVDSVSLGDD
t29             SPQ-EVEVAAD---IYFYRNMVVQRLTDVVAAVRMQSPQEMRTPVLVCIQKVDSVSLGDD
t98             SPQ-EVEVAAD---IYFYRNMVVQRHTDVVAAVRMQSPQEMRNPVLVCIQKVDSASLGDD
t83             SPQ-EVEVAAD---IYFYRNMVVQRHTDVVAAVRMQSPQEMRNPVLVCIQKVDSISLGDD
t95             SPQ-QVEVAAD---IYFYRNMVVQRLTDVVAAVRMQSPQEMRCRKLVCIQKVDSPSLGDD
t20             SPQ-QVEVAAD---IYFYRNMVVQRLTDVVAAVRMQSPQEMRTPKLVCIQKVDSPSLGDD
t69             SPQ-EVEVAAD---IYFYRNMVIECLTDVVRAVRMQSPQEMRAPVLVCIQKVDSPSLGDD
t2              SPQ-EVEVAAD---IYFYRNMVIECLTDVVRAVRMQSPQEMRAPVLVCIQKVDSPSLGDD
t10             SPQ-EVEVAAD---IYFYRNMVIECLTDVVRAVRMQSPQEMRAPVLVCIQKVDSPSLGDD
t31             SPQ-EVE-AAD---IFFYRNMVIQRLTDVVAAVRMQSPQEMRPPVLVCIQYVDSPSLGDD
t15             SPQ-EVEVAAD---IYFYRNMVIQTLTDVVAAVRMQSPQEMRPPVLVCIQDVDSVSLGDD
t63             SPQ-EVEVAAD---IYFYRNMVIQRLTDVVAAVRMQSPQEMRLPVLVCIQDVDSPSLGDD
t50             SPQ-EVEVAAD---IYFYRNMVIQRLTDVVAAVRMQSPQEMRLPVLVCIQDVDSPSLGDD
t25             SPQ-EVEVAAD---IYFYRNMVIQRLTDVVAAVRMQSPQEMRLPVLVCIQDVDSPSLGDD
t51             SPQ-EVEVAAD---IYFYRNMVIQRLTDVVAAVRMQSPQEMRPPVLVCIQDVDSPSLGDD
t9              SAN-EFEAAADPTVIYFYRNRIVRRLADVISTVRMNSPQEMRN------QDVDSHSLGDD
t47             SAN-EFEAAADPTVIYFYRNRIVRRLADVISTVRMNSPQEMRE------QDVDSHSLGDD
t60             SEN-EFEAAADPTVIYFYRNRIVRRLADVISTVRMNSPQEMRN------QDVDSHSLGDD
t30             SEN-EFEAAADPTVIYFYRNRIVRRLADVISTVRMNSPQEMRN------QDVDSHSLGDD
t70             STQ-EFEAAADPTVIYFYRNRIVRRMADVISTVRMKSPQEMRG------QDVDSHSLGDD
t91             STQ-EFEAAADPTVIYFYRNRIVRRMADVISTVRMKSPQEMRG------QDVDSHSLGDD
t49             STQ-EFESAADPTVIYFYRNRIVKRMADVISTVRMKSPQEMRG------QDVDSHSLGDD
t52             STQ-EFEAAADPTVIYFYRNRIIRRVADVISTVRMKSPQEMRE------QDVDSHSLGDD
t43             SPS-EFEVAADPTIIWFYRNCIVHKLADTVSTAKMKSPQEMRH------QDVDSPSLGDD
t1              SPS-EFEVAADPTIIWFYRDCIVHKLADTVSTAKMKAPQEMRV------QDVDSPSLGDD
t86             SPS-EFEVAADPTIIWFYRNCIVHKLADTVSTAKMKAPQEMRV------QDVDSPSLGDD
t72             SPS-EFEVAADPTIIWFYRNCIVHKLADTVSTAKMKAPQEMRH------QDVDSPSLGDD
t96             SPS-EFEIAADPTIIWFYRNCIVHKLADTVSTAKMKAPQEMRV------QDVDSPSLGDD
t44             SPS-EFEVAADPTIIWFYRNCIVHKLADVVSTAKMKSPQEMRV------QDVDSPSLGDD
t45             SPA-EFEVAADPTIIWFYRNCIVHKLADLVSTAKMKSPQEMRV------QDVDSPSLGDD
t74             SPA-GFEVAADPTIIWFYRNCIVHKLADLVSTAKMKSPQEMRV------QDVDSPSLGDD
t26             SPQ-EVELAADPTVIYFYRNCIVQKMADVVSTVKMKSPQEMRV------QDVDSASLGDD
t61             SPQ-EVELAADPSVIYFYQNCIVQKMADVVSTVKMKSPQEMRV------QDVDSASLGDD
t97             SPQ-EVELAADPSVIYFYQNCIVQKMADVVSTVKMKSPQEMRV------QDVDSASLGDD
t17             SPQ-EFELAADPTVIYFYRNCIVQKLADVVSTVKMKSPQEMRV------QDVDSPSLGDD
t11             SPQ-EFELAADPTVIYFYRNCIVQKLADVVSTVKMKSPQEMRV------QDVDSPSLGDD
t23             SPQ-EFECAADPTVIYFYKNLIIQQAADYVSAVQVKSPQEMRY------QDVNSPSDGDE
t76             SK-------VEPKCAQFYSKSCTHC----------------TM------CSVGSHASEED
t53             SK-------VEPKCAQFYSKSCTHC----------------TM------CSVGSHASEED
t16             SK-------VEPKCAQFYSKSCTHC----------------TM------CSVGSHASEED
t42             SK-------VEPKCAQFYSKSCTHH----------------MM------CSVGSNASEED
t24             SK-------VEPKCQQFYSKSCTHC----------------VM------CSVGSNASEED
                

t73             NLQD--MSGVPVTVCTSSVMVRKDMQD-SVDKRGCTWNAKE-DHLCPSSFCKGER---ED
t66             NLQD--MSGVPVTVCTSSVMVRKDMQD-SVDKRGCTWNAKE-DHLCPSSFCKGER---ED
t32             NLQD--MSGVPVTVCTSSVMVRKDMQD-SVDKRGCTWNAKE-DHLCPSSFCKGER---ED
t75             NLQD--MPGMPVTVCTSSVMVRKDMHQ-SVDKRGYTWHAKE-DHLCPDSFCKGEK---EE
t79             SLQQ--MPAVPVDVCVMSVMVNKSMPQ-SHDKRGYTWQAKQ-DHLFPVNVVKGEQ---EE
t27             SLQQ--MPAVPVTVCVMSHMVKKSMPQ-SHDKRGYTWQAKQ-DHLFPVNCVKGEQ---EE
t93             SLQQ--MPAVPVTVCVMSHMVKKSMPQ-SHDKRGYTWQAKQ-DHLFPVNCVKGEQ---EE
t59             SLQQ--MPAVPVTVCVMSHMVKKSMPQ-SHDKRGYTWQAKQ-DHLFPVNFVKGEQ---EE
t7              SLQQ--MPAVPVTVCVMSHMVKKSMPQ-SHDKRGYTWQAKQ-DHLFPVNFVKGEQ---EE
t78             SLQQ--MPAVPVTVCVMSHMVKKSMPQ-SHDKRGYTWQAKQ-DHLFPVNFVKGEQ---EE
t12             SLQQ--MHAMPVTVVVVSHMVKKSMPQ-SHDKRGYTWQAKDFDQLIPVSFVKGEQ---EE
t81             FLQQ--MPAVPVSVCVYSHMVKKFVPQ-SHEKRGYTWKAKE-DHLVPISYCKGEH---EE
t21             FLQQ--MPAVPVSVCVHSHMVKKFVPQ-SHEKRGVTWKAKE-DHLVPISLCKGEH---EE
t80             RLQQ--MPAMPVTICVSSYMVKKSVIQ-SHQKRGYTWRAKE-DHLIPVSFCKGEL---DE
t14             RLQQ--MPAMPVTICVSSYMVKKSVPQ-SHQKRGYTWRAKE-DHLIPVSFCKGEL---DE
t85             RLQH--MPAMPVTICVFSYMVKKAVPQ-SHQKRGYTWRAKE-DHLIPVSFCKGEL---DE
t62             RLQQ--MPAMPVTICVFSYMVKKSVPQ-SHVKRGYTWRAKE-DHLIPVSFCKGEL---EE
t19             RLQQ--MPAMPVTICVFSYMVKKLVPQ-SHQKRGYTWRAKE-DHLIPVSFCKGEL---EE
t77             RLQQ--MPAMPVTICVFSYMVKKSVPQ-SHQKRGYTWRAKE-DHLIPVSFCKGEL---EE
t88             GMQS--MPLMQNAVCVWSKMVRKVQPD-GQDKREQTWMAKD-DTLCPPSMKRGEK---TA
t37             GMQN--MPLMQNAVCVWSQMVRKVQPD-GQDKREQTWMAKD-DTLCPPCEEQGEK---AA
t35             GMQN--MPLMQNAVCVWSQMVRKVQPD-GQDKREQTWMAKD-DTLCPPCEEQGEK---AA
t48             GMQN--MPLMQNAVCVWSQMVRKVQPD-GQDKREQTWMAKD-DTLCPPCEEQGEK---AA
t55             GMQN--MPLMQNAVCVWSQMVRKVQPD-GQDKREQTWMAKD-DTLCPPCEEQGEK---AA
t46             GMQN--MPLMQNAVCVWSQMVRKVQPD-GQDKREQTWMAKD-DALCPPCKEQGEK---AA
t67             GMQN--MPLMQNAVCVWSQMVRKVQPD-GQDKREQTWVAKD-DTLCPPCKEQGEK---AA
t57             GMQK--MPLMQNAVCVWSQMVRKVQPD-GQDKREQTWVAKD-DTLCPPCKDQGEK---AA
t56             GTQV--MPLMQNLVCVWSKMVRKCMID-GQEKREQTWMAKD-DKLCPPSQEQGEK---AA
t13             DMLN--MPLTQNAMCVESEMVRKCQPD-GQDKRGYTWVAKD-DTLCPQSRDQGEK---HH
t5              DMLN--MPLTQNAMCVESEMVRKCQPD-GQDKRGYTWVAKD-DTLCPQSRDQGEK---HH
t38             DMLN--MPLTQNAMCVESEMVRKSQPD-GQDKRGYTWVAKE-DDLCPQSGDQGEK---YA
t33             DMLN--MPLTQNAMCVESEMVRKCQPD-GQDKRGYTWVAKE-DTLCPQSGDQGEK---YA
t100            DMLN--MPLTQNAMCVESEMVRKCQPD-GQDKRGYTWVAKE-DTLCPQSEDQGEK---YA
t34             DMLN--MPLTQNAMCVESEMVRKCQPD-GQDKRGYTWVAKE-DTLCPQSGDQGEK---YA
t84             DMLN--MPLTQNAMCVESEMVRKCQPD-GQDKRGYTWVAKE-DTLCPQSGDQGEK---YA
t92             DMLN--MPLTQNAMCVESEMVRKCQPD-GQDKRGYTWVAKE-DTLCPQSGDQGEK---YA
t3              DMLI--MPLVQNAMCVKSEMVRKCQPD-GPDKRGYTWMAKD-DTLCPVSAGQGEK---YA
t22             DMLI--MPLVQNAMCVNPEMVRKCQPD-GQDKRGYTWMAKN-DTLCPVSAGQGEC---YA
t64             DMLK--MPLVQNAMCVSSEMVRKCQPD-GQDKRGYTWMAKD-DTLCPQSANQGEK---YA
t18             DMLK--MPLVQNAMCVSSEMVRKCQPD-GQDKRGYTWMAKD-DTLCPQSANQGEK---YA
t68             DMLK--MPLRQNAMCVSSEMVRKCQPD-GQDKRGYTWMAKD-DTLCPQSANQGEK---YA
t28             DMLN--MPLVQNAMCVSSEMVRKCQPD-GQNKRGCTWMAKN-DTLCPQSGNQGEK---FA
t82             DMLN--MPLVQNAMCVSSEMVRKCQPD-GQNKRGYTWMAKH-DTLCPQSGNQGEK---YA
t41             DMLN--MPLVQNAMCVSSEMVRKCQPD-GQNKRGYTWMAKH-DTLCPQSGNQGEK---YA
t71             DMLN--MPLHQNAMCVSSEMVRKCQPD-GQDKRGYTWMAKD-DTLCPQSPNQGEK---YA
t94             DMLN--MPLHQNAMCVSSEMVRKCQPD-GQDKRGYTWMAKD-DTLYPQSANQGEK---YA
t99             EMLN--MPLVQNAMCVPSEMVRKCQPD-GQDKRGYTWMAKD-DPLCPQSANVGEK---YA
t40             EMLN--MPQVQNAMCVSSEMVRKCQPD-GQDKRGYTWMAKD-DTLCPQSANVGEK---YA
t90             EMLN--MPLVQNAMCVSSEMVRKCQPD-GQDKRGYTWMAKD-DTLCPQSANQGEK---YA
t4              EMLN--MPLIQNAMCVQSEMVRKCQPD-GQDKRGYTWMAKD-DTLCPQLHNQAEK---YA
t36             NGQA--MNIVPYWVCVASGVVRKTHKD-SVDKRGQTWTAKS-DFLCPLAVDQGEP---GA
t87             NGQA--MNIVPYWVCVGSGVVRKTHKD-SVDKRGQTWTAKS-DFLCPLAMDQGEI---GA
t89             NGQA--MNIVPYWVCVASGVVRKMHKD-SVEKRGQTWEAKS-DFLCPLAVDQGEP---AA
t39             NGQA--MNIVPYWVCVASGVVRKMHKD-SVEKRGQTWEAKS-DFLCPLAVDQGEP---AA
t8              NGQA--MNIVPYWVCVASGVVRKMHKD-SVEKRGQTWEAKS-DFLCPLAVDQGEP---AA
t6              NGQA--MNIVPYWVCVASGVVRKMHKD-SVEKRGQTWEAKS-DFLCPLAVDQGEP---AA
t58             NGQA--MNIVPYWVCVVSGVVRKTHKD-SVEKRGQTWTAKS-DFLCPIAVNQGEP---GA
t54             NGQA--MNIVPYWVCVVSGVVRKTHKD-SVEKRGQTWTAKS-DFLCPIAVNQGEP---GA
t65             DPQM--MNIVPYWVCVCSGVVKKAEPD-SVDKRGKTWVAKS-DFLCPAAVNEGEH---GA
t29             DPQM--MNIVPYWVCVCSGVVKKAEPD-SVDKRGKTWVAKS-DFLCPPAVNEGEH---GA
t98             DPQM--MKIVPYWVCVCSGVVKKAEPD-SVDKRGKTWVAKS-DFLCPPAVNEGEH---GA
t83             DPQM--MNIVPYWVCVCSGVVKKAEPD-SVDKRGKTWVAKS-DFLCPPAVNEGEH---GA
t95             DPQM--MNIVPYWVCVCSGVVKKAEPD-SVDKRGKTWVAKS-DFLCPPAVNEGEH---GA
t20             DPQC--MNIVPYWVCVCSGVVKKAEPD-SVDKRGKTWVAKS-DFLCPPAVNEGEH---GA
t69             VPQM--MNIVPYWVCVCSGVVKKAQPD-SVDKRGKTWVAKS-DFLCPPAMNEGEH---GA
t2              VPQM--MNIVPYWVCVCSGVVKKAQPD-SVDKRGKTWVAKS-DFLCPPAMNEGEH---GA
t10             VPQM--MNIVPYWVCVCSGVVKKAQPD-SVDKRGKTWVAKS-DFLCPPAMNEGEH---GA
t31             TPQM--MNIAPYWVCVCSGVVKKAQPD-SVDKRGKTWVAKA-DFLCPPAVSEGEH---GA
t15             TPQM--MNIAPYWVCVCSGVVKKTQPD-SVDKRGKTWVAKS-DFLCPPAVSEGEH---GA
t63             TPQK--MNIAPYWVCVCSGVVKKAQLD-SVEKRGKTWVAKS-DFLCPPAVSEGEH---GP
t50             TPQK--MNIAPYWVCVCSGVVKKAQPD-SVDKRGKTWVAKS-DFLCPPAVSEGEH---GP
t25             TPQK--MNIAPYWVCVCSGVVKKAQPD-SVDKRGKTWVAKS-DFLCPPAVSEGEH---GP
t51             TPQM--MNIAPYWVCVCSGVVKKAQPD-SVDKRGKTWVAKS-DFLCPPAISEGEH---GA
t9              DNQA--MVILPYWVCVCSGVVRKEHPDTSINKRGRTWLAKV-DFLCPPAFNQGEH---RA
t47             DNQA--MNILPYWVCVCSGVVRKEHPDTSINKRGRTWLAKM-DFLCPPAFNQGEH---RA
t60             DNQA--MNILPYVVCVCSGVVRKDHPDTSIHKRGRTWLAKV-DFLCPPAFNQGEH---RA
t30             DNQA--MNILPYVVCVCSGVVRKEHPDTSISKRGRTWLAKI-DFLCPPAFNQGEH---RA
t70             DNQA--MNILPYWVCVCSGVVRKEHPDTSINKRGRTWLAKI-DFLFPPAFNQGEH---HA
t91             DNQA--MNILPYWVCVCSGVVRKEHPDTSINKRGRTWLAKI-DFLFPPAFNQGEH---HA
t49             DNQA--MNILPYWVCVCSGVVRKEHPDTSINKRGRTWLAKI-DFLFPPAFNQGEH---HA
t52             DNQA--MTILPHWVCVVSGVVRKEHPDTSINKRGSTWLAKV-DFLCPPAFNQGEH---HA
t43             DQQA--MDILPYWVCVTSGVVRKEQPD-SVNKRGRTWLAKN-DFLCPPAFNQGEH---ER
t1              DQQE--MDILPYWVCVTSGVVRKEQPD-SVNKRGRTWLAKN-DFLCPPAFNQGEH---EA
t86             DQQA--MDILPYWVCVTSGVVRKEQPD-SVNKRGRTWLAKN-DFLCPPAFNQGEH---GA
t72             DQQA--MDILPYWVCVTSGVVRKEQPD-SVNKRGRTWLAKN-DFLCPPAFKQGEH---EA
t96             DQQA--MDILPYWVCVTSGVVRKEQPD-SVNKRGRTWLAKN-DFLCPPAFNQGEH---EA
t44             DQQA--MDILPYWVCVTSGVVRKEQPD-SVNKRGRTWLAKN-DFLCPPAFEQGEH---EA
t45             DQEA--MDILPYWVCVMSGVVRKEQPD-SVNKRGRTWLAKK-DFLVPPAFNQGEH---EA
t74             DQEA--MDILPYWVCVTSGVVRKEQPD-SVNKRGRTWLAKK-DFLVPPAFNQGEH---EA
t26             DQQP--MNIIPYWVCVTSGVVHKEQPD-SVNKRGRTWTAKN-DFLCPDAFNQGEH---GA
t61             DQQP--MNIIPYWVCVTSGVVRKEQPD-SVNKRGHTWTAKN-DFLCPPAYNQGEH---GA
t97             DQQP--MNIIPYWVCVTSGVVRKEQPD-SVNKRGRTWSAKN-DFLCPPAFNQGEH---GA
t17             NQQS--MNIIPYWVCVHSGVVQKEQPD-SVHKRGRTWTAKN-DFLCPPAFDQGEH---GA
t11             NQQS--MNIIPYWVCVHSGVVQKEQPD-SVHKRGRTWTAKN-DFLCPPAFDQGEH---GA
t23             NGQS--MHIGPYWVCVSSEVVKKSQPD-SVDKRGRTWVAKN-EFLCPPDHMQGEHSIEGA
t76             ALDLYTHKPVPDAQCFVSRVARNIPEH-SPCK----------------------------
t53             ALDLYTHRPVPDAQCFVSRVARNIPEH-SPCK----------------------------
t16             ALDLYTHKPVPDAQCFVSRVARNIPEH-SPCK----------------------------
t42             ALELYTHKPVPDPQCFVSIVVRNIPEH-SPCK----------------------------
t24             ALELYTHKPVPDPQCFVSIVVRNIPEH-SPCK----------------------------
                

t73             EPGGVTQ-----------------RCIENIAKLLYIKDV-LCNEVLNGLQWQLCWSV-GD
t66             EPGGVTQ-----------------RCIENIAKLLYIKDV-LCNEVLNGLQWQLCWSV-GD
t32             EPGGVTQ-----------------RCIENIAKLLYIKDV-LCNDVLNLLVWQLCWSV-GD
t75             EPGGVRR-----------------RIVENIVKLLYIKDV-LCNQVLNLLQWQLCWSV-GD
t79             EPEGADQ-----------------RTVHDMVRLLYSKDV-DCNMVLSLLVWQLC--H-GD
t27             EPEGADQ-----------------RTVHDMVRLLYSKDV-DCNIVLSLLVWQLC--H-GD
t93             EPEGADQ-----------------RTVHDMVRLLYSKDV-DCNIVLSLLVWQLC--H-GD
t59             EPEGADQ-----------------RTVHDMVRLLYSKDV-DCNIDLSLLVWQLC--H-GD
t7              EPEGADQ-----------------RTVHDMVRLLYSKDV-DCNIVLSLLVWQLC--H-GD
t78             EPEGADQ-----------------RTVHDMVRLLYSKDV-DCNIVLSLLVWQLC--H-GD
t12             EPEGPNN-----------------RVVHNIVKLLYTKDV-DCNTVLSLLIWQLC--H-GD
t81             EPEGAQY-----------------RVVQNIVKLLYTKDV-DCNVVLSLLVWQLC--H-GD
t21             EPEGAQY-----------------RCVQNIVKLLYTKDV-DCNVVLSLLVWQLC--H-GD
t80             EPDAAQQ-----------------RIVQNIVKLLYTKDV-SCNVVLSMLIWQIC--H-GD
t14             EPDAAQQ-----------------RIVQNIVKLLYTKDV-SCNVVLSMLIWQIC--H-GD
t85             EPDGAQQ-----------------RVVQNIVKLLYTKDV-SCNKVLSMLIWQIC--H-GD
t62             EPEGAQH-----------------RMVQNIVKLLYTKDV-SCNVVLSMLIWQIC--H-GD
t19             EPEGAKQ-----------------RMVQNIVKLLYTKDV-SCNVVLSMLIWQIC--H-GD
t77             EPEGAQQ-----------------RIVQNIVKLLYTKDI-SCNVVLSMLIWQIC--H-GD
t88             EPTQWMG-----------------TVTVNKIKLLYCKDC-SCNEVMKILSWWLCNSV-GD
t37             EPTQWVG-----------------TCTSNVIKLLYCKDC-SCNEVLKILAWWLCDSV-GD
t35             EPTQWVG-----------------TCTSNVIKLLYCKDC-SCNEVLKILAWWLCDSV-GD
t48             EPTQWVG-----------------TCTSNVIKLLYCKDC-SCNEVLKILAWWLCDSV-GD
t55             EPTQWVG-----------------TCTSNVIKLLYCKDC-SCNEVLKILAWWLCDSV-GD
t46             EPTQWVG-----------------TCTSNVIKLLYCKDC-SCNEVLKILAWWLCDSV-GD
t67             EPTQWVG-----------------TCTSNVIKLLYCKDC-SCNEVLKILAWWLCDSV-GD
t57             EPTQWVG-----------------TCTSNVIKLLYCKDC-SCNEVLKILAWWLCDSV-GD
t56             EPTQWED-----------------ICTANVIKLLYCKDC-SCNEVLRVLSWWLCDSV-GD
t13             EPHHIRN-----------------KFSENVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t5              EPHHIRN-----------------KFSENVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t38             EPQHIRN-----------------QFSENVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t33             EPQHIRN-----------------KFSENVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t100            EPQHIRN-----------------KFSENVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t34             EPQHIRN-----------------KFSENVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t84             EPQHIRN-----------------KFSENVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t92             EPQHIRN-----------------KFSENVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t3              EPHQIKN-----------------KFSVNVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t22             EPHQTCN-----------------KFRVNVIKLLYCKDC-SCNKVLKILKWQLCESV-DD
t64             EPHVIGD-----------------KVSVNVIKLLYCKDC-SCNQVLKILVWQLCESV-DD
t18             EPHVIGD-----------------KVSVNVIKLLYCKDC-SCNQVLKILIWQLCESV-DD
t68             EPVVIGD-----------------KVSVNVIKLLYCKDC-SCNQVLKILVWQLCESV-DD
t28             EPHQIRN-----------------KVSVNVIKLLYCKDC-SCNKMLKILVWQLCESV-DD
t82             EPHQIRN-----------------KVSVNVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t41             EPHQIRN-----------------KVSVNVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t71             EPHQIRN-----------------KISVNVIKLLYCKDC-SCNQVLKILVWQLCESV-DD
t94             EPHQIRN-----------------KISVNVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t99             EPHQIRN-----------------KVSVNVIKLLYCKDC-SCNKVLKILVWQLCDSVQDD
t40             EPHQIRN-----------------KVSTNVIKLLYCKDC-SCNKVLKILVWQLCDSV-DD
t90             EPHQIRN-----------------KVSTNVIKLLYCKDC-SCNKVLKILVWQLCDSV-DD
t4              EPHQIRN-----------------KVSVNVIKLLYCKDC-SCNKVLKILVWQLCESV-DD
t36             EQKPAVGEENPICKPWQFVIMNTTTFAKNIFRLLYVKDV-SCNGVLPLLKWQLCDSH-GD
t87             EQKPAVGEKNPICKPWQFVIMNTTTFAKNIFRLLYVKDV-SCNGVLPLLKWQLCDSH-GD
t89             EQRPAVGEKNPICKPWQFVIMNTTTFAKNIFRLLYVKDV-SCNGVLPLLKWQLCDSH-GD
t39             EQRPAVGEKNPICKPWQFVIMNTTTFAKNIFRLLYVKDV-SCNGVLPLLKWQLCDSH-GD
t8              EQKPAVGEKNPICKPWQFVIMNTTTFAKNIFRLLYVKDV-SCNGVLPLLKWQLCDSH-GD
t6              EQKPAVGEKNPICKPWQFVIMNTTTFAKNIFRLLYVKDV-SCNGVLPLLKWQLCDSH-GD
t58             EQKPAVGA-NPIVKPWQFVIMNTTTFAKNIFRLLYVKDV-SCNGVLPLLKWQLCDSH-GD
t54             EQKPAVGA-DPIVKPWQFVIMNTTTFAKNIFRLLYVKDV-SCNGVLPLLKWQLCDSH-GD
t65             EQRP-FGTQNPVCKPWRFVIMNTQTFAKNIIRLLYIKDI-SCNQVLQLLDWQLCDSH-GD
t29             EQRPVFGTHNPVCKPWRFVIMHTQTFSKNIIRLLYIKDI-SCNQVLQLLDWQLCDSH-GD
t98             EQRPVFGTQNPVCKPWRFVIMNTQTFSKNIIRLLYIKDI-SCNQVLQLLDWQLCDSH-GD
t83             EQRPVFGTQNPVCRPWRFVIMNMQTFSKNIIRLLYIKDI-SCNQVLQLLDWQLCDSH-GD
t95             EQRPVFGGQNPACKPWHFVIMNRQTFAKNMIRLLYIKDI-SCNEVLQLLDWQLCDSH-GD
t20             EQRPVFGGQNPACQPWHFVIMNTQTFAKNMIRLLYIKDI-SCNQVLQLLDWQLCDSH-GD
t69             EQRPVFGTQNPVCKPWRFVIMNTETFAKNIIRLLYVKDV-SCNQVLQLLDWQLCDSH-GD
t2              EQRPVFGTQNPVCKPWRFVIMNVETFAKNIIRLLYVKDV-SCNQVLQLLDWQLCDSH-GD
t10             EQRPVFGTQNPVCKPWRFVIMNVETFAKNIIRLLYVKDV-SCNQVLQLLDWQLCDSH-GD
t31             EQRPVFGMQNPACKPWRFVIMNTQTFAKNIIRLLYIKDV-SCNAVLQLLDWQLCYSH-GD
t15             EQRPVFGMRNPICKPWRFVIMNTQTFAKNIIRLLYVKDV-SCNAVLQLLDWQLCYSH-GD
t63             EQRPVFGVQNPVCKPWRFVIMNTQTFAANIIRLLYVKDV-SCNAVLQLLDWQLCYSH-ED
t50             EQRPVFGVQNPVCKPWRFVIMNTQT-AKNIIRLLYVKDV-SCNAVLQLLDWQLCYSH-GD
t25             EQRPVFGMQNPVCKPWRFVIMNTQTFAKNIIRLLYVKDV-SCNAVLQLLDWQLCYSH-GD
t51             EQRPVFGMQNPVCRPWRFVIMNTQTFAKNVIRLLYVKDV-SCNKVLQLLDWQLCYSH-GD
t9              EQKPASKFEHPVCGPWEFVIVNYQTSAKDIILLLYIKDV-GCNCVLELLNWQLCTSH-GD
t47             EQKPALKFKHPVCGPWEFVIVNYQTSAKDIILLLYIKDV-GCNCVLELLKWQLCTSH-GD
t60             EQKPAFKFKHPVCGPWEFVIVNYQTEAKDIILLLYIKDV-GCNCVLELLEWQLCTSH-GD
t30             EQKPAFKFKHPCCGPWEFVIVNYQTSAKDIILLLYIKDV-GCNCVLELLKWQLCTSH-GD
t70             EQKPVFGFKHPHCGPWEFVICNYQTVAKDIILLLYIKDV-GCNCVLELLAWQLCTSH-GD
t91             EQKPVFGFKHPHCGPWEFVICNYQTVAKDIILLLYIKDV-GCNCVLELLAWQLCTSH-GD
t49             EQKPVFGFKHPHCGPWEFVICNYQTMAKDIILLLYIKDV-GCNCVLELLAWQLCTSH-GD
t52             EQKPVFGFKHPHVGPWEFVICNYQTSAHDIILLLYIKDV-GCNCVLELLVWQLCTSH-GD
t43             EQRPVYGFKHPGCRPWQFVIANYQTSAKNIIMLLYVKDV-SCNGVLQLLNWHLCDSH-GD
t1              EQRPVYGFVHPRCRPWQFVIANYQTSAKNIIMLLYVKDV-SCNGVLQLLNWQLCDSH-GD
t86             EQRPVYGFQHPRCRPWQFVIANYQTFAKNIIMLLYVKDV-SCNRVLQLLNWQLCDSH-GD
t72             EQRPVYGFQHPRCRPWQFVIANYQSSAKNIIMLLYVKDV-SCNGVLQLLNWQLCDSH-GD
t96             EQRPVYGFQHPRCRPWQFVIGNYQTSAKNIIMLLYVKDV-SCNGVLQLLNWQLCDSH-GD
t44             EQCPVHGFKHPRCRPWQFVIADYQTSAKNIIMLLYVKDV-SCNGVLQLLNWQLCDSH-GD
t45             EQKPVYGFDHPRCRPWQFVIANYQTSAKNIIMLLYVKDV-SCNGVLQLLNWQLCDSH-GD
t74             EQKPVYGFDHPRCRPWQFVIANYQTSAKNIIMLLYVKDV-SCNGVLQLLNWQLCDSH-GD
t26             EQKPTHGFEHPRCRPWQFVIPVYQTGAKNIILLLYIKDV-SVNGVLQLLIWQLCDSH-GD
t61             EQKPVHGFEHPRCRPWQFVISVYRTGAKNINLLLYIKDV-SCNGVLQLLNWQLCDSH-GD
t97             EQKPVHEFQHPRCRPWQFVISVYRTGAKNINLLLYIKDV-SCNGVLQLLNWQLCDSH-GD
t17             EQKPVHGFEHPRCRPWQFVIANYQTGAKNIILLLYVKDV-SCNGVLQLLNWQLCDSH-GD
t11             EQKPVHGFEHPRCRPWQFVIANYQTGAKNIILLLYVKDV-SCNGVLQLLNWQLCDSH-GD
t23             EQKPFFGFAGPFPQPWQFVIVNPQTWAHNIIRLLYCKDV-SCNCVLTCLNWVLCDSH-GD
t76             -P---CS-----------------VEEVCYCKVCDSKDVRAVKNAYQDLQVPLSKLK-AP
t53             -P---CS-----------------VEEVCYCKVCDSKDVRAVKNAYQDLQVPLSKLK-AP
t16             -P---CS-----------------VEEVCYCKVCDSKDVRAVKNAYQDLQVPLSKLK-AP
t42             -P---CS-----------------VEEVAYCKNCDSKDVRAVQNAYQDLAVPLSKLK-AP
t24             -P---CS-----------------VEEVCYCKNCDSKDVRATQNAYQELAIPLSKLK-AP
                

t73             WESLIPQACWDAKKDLAVCAWKMELVPGL---NRNNENLAKVIYFGPDGH-------DEG
t66             WESLIPQACWDAKKDLAVCAWKMELVPGL---NRNNENLAKVIYFGPDGH-------DEG
t32             WESLIPQACWDAKKDLAVCAWKMELVPGL---NRNNENLAKVIYFGPDGH-------DEG
t75             WESLVPQACWGAKKDLAVCAWKMELVPGL---NRNNENLAKIIYFGPDGH-------DEG
t79             WEPLLPQACESARRDLAVCAWKRELVPGL---NHNNEFLAKIIYFGPDGH-------DEG
t27             WEPLLPQACEGARRDLAVCAWKRELVPGL---NHNNEFLAKIIYFGPDGH-------DEG
t93             WEPLLPQACEGARRDLAVCAWKRELVPGL---NHNNEFLAKIIYFGPDGH-------DEG
t59             WEPLLPQACESARRDLAVCAWKRELVPGL---NHNNEFLAKIIYFGPDGH-------DEG
t7              WEPLLPQACESARRDLAVCAWKRELVPGL---NHNNEFLAKIIYFGPDGH-------DEG
t78             WEPLLPQACESARRDLAVCAWKRELVPGL---NHNNEFLAKIIYFGPDGH-------DEG
t12             WEQLVPQACAGARSDLAVCAWKRELVPGL---NHNNENLAKVIYFGPDGH-------DEG
t81             WEPLIPQACQTAKKDLAVCAWKRELVPGL---NCNNEYLAKIIYFGPDGH-------DEG
t21             WEPLVPQACQTAKKDLAVCAWKRELVPGL---NCNNEYLAKIIYFGPDGH-------DEG
t80             WEPQIPKACSNARKDLAVCAWKRELVPGL---NHNNENLAKIMYFGHDGH-------DEG
t14             WEPQIPKACSNARKDLAVCAWKRELVPGL---NHNNENLAKIMYFGHDGH-------DEG
t85             WEPQIPKACNAARKDLAVCAWKRELVPGL---NHNNEDLAKIMYFGPDGH-------DEG
t62             WEPQIPKACDAARKDLAVCAWKRELVPGL---NHNDENLAKIMYFGPDGH-------DEG
t19             WEPQIPKACDAARKDLAVCAWKRELVPGL---NHNDENLAKIMYFGPDGH-------DEG
t77             WEPQLPKACDAARKDLAVCAWKRELVPGL---NHNDENLAKIMYFGPDGH-------DEG
t88             WQTLMSQACITADPNPPVCVWKRELVPGL---NRSVENLAKIIYFCPDEH-------DER
t37             WQTLMNDACRSANPNYPVCIWKRELVPGL---NRNVENLAKIIYFCPDEH-------DER
t35             WQTLMNDACRSANPNYPVCIWKRELVPGL---NRNVENLAKIIYFCPDEH-------DER
t48             WQTLMNDACRSANPNYPVCIWKRELVPGL---NRNVENLAKIIYFCPDEH-------DER
t55             WQTLMNDACRSANPNYPVCIWKRELVPGL---NRNVENLAKIIYFCPDEH-------DER
t46             WQSLMNDACRSANPNYPVCIWKRELVPGL---NRNVENLAKIIYFCPDEH-------DER
t67             WQTLMNDACSSANPNYPVCIWKRELVPGL---NRNVENLAKIIYFCPDEH-------DER
t57             WQTLMNDACSSANPNYPVCIWKRELVPGL---NRNVENLAKIIYFCPDEH-------DER
t56             WRTLMSDACALANPNPPVCVWKRELVPGL---NRNVENLAKIIYFCPDEH-------DER
t13             WQTLSSDACMHAEQNPPVCVWQRELVPQL---NRNIEDLARIIYFGPDEH-------DEG
t5              WQTLSSDACMHAEQNPPVCVWQRELVPQL---NRNIEDLARIIYFGPDEH-------DEG
t38             WQTLASDACVSAEPNPPVCVWQRELVPQL---NRNAEDLARIIYFGPDEH-------DEG
t33             WQTLASDACVSAEPNTPVCVWQRELVPQL---NRNAEDLARIIYFGPDEH-------DEG
t100            WQTLASDACVSAEPNPPVCVWQRELVPQL---NRNAEDLARIIYFGPDEH-------DEG
t34             WQTLASDACVSAEPNPPVCVWQRELVPQL---NRNAEDLARIIYFGPDEH-------DEG
t84             WQTLASDACVSAEHNPPVCVWQRELVPQL---NRNAEDLARIIYFGPDEH-------DEG
t92             WQTLASDACVSAEPNPPVCVWQRELVPQL---NRNAEDLARIIYFGPDEH-------DEG
t3              WVTLASDACLSAEPQPPVCVWQRELVPQL---NRNVEDLARVIYFGPDEH-------DEG
t22             WQTLASDACILAKPQPPVCVWQRELVPQL---NRNVEDLARVIYFGPDEH-------DEG
t64             WQTLTSDPCMSAQVNPPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t18             WQTLTSDPCMSAQVNPPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t68             WQTLTSDPCMSAQVNPPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t28             WQTLASDPCVSAEPNSPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t82             WQTLASDPCMSAEPNPPVCVWQRELVPQL---NRNVEDLARTIYFGPDEH-------DEG
t41             WQTLASDPCMSAEPNPPVCVWQRELVPQL---NRNVEDLARTIYFGPDEH-------DEG
t71             WQTLTSDPCVPAEPNPPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t94             WQTLTSDPCVPAEPNPPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t99             WQPLTSDPCVNAEPNPPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t40             WQTLTSDPCVSAEPNPPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t90             WQTLTSDPCVSAEPNPPVCVWQRELVPQL---NRNVEDLARIIYFGPDEH-------DEG
t4              WQTLTSDPCISAEPNPPVCVWQRELVPQL---NRNIEDLARIIYFGPDEH-------DEG
t36             WQSLYADSCPIA-VNAAVCGWKRELVPGL---NHSCEHLAKSVYFEPDGE-------GEG
t87             WQSLYADSCPIA-INAAVCGWKRELVPGL---NHSCEHLAKSVYFEPDGE-------GEG
t89             WQSLFPDSCPFA-LNAAVCGWKRELVPGL---NHSCEHLAKGVYFEPDGE-------DEG
t39             WQSLFPDSCPFA-LNAAVCGWKRELVPGL---NHSCEHLAKGVYFEPDGE-------DEG
t8              WQSLFPDSCPFA-LNAAVCGWKRELVPGL---NHSCEHLAKGVYFEPDGE-------DEG
t6              WQSLFPDSCPFA-LNAAVCGWKRELVPGL---NHSCEHLAKGVYFEPDGE-------DEG
t58             WQSLFADSCPTA-VNAAVCAWKRELVPGL---NHSCEHLAKSVYFEPDGE-------DEG
t54             WQSLFADSCPIA-VNAAVCAWKRELVPGL---NHSCEHLAKSVYFEPDGE-------DEG
t65             WQSLMADSCPNA-VNIAVCCWKRELMPGL---NHSCEHLAKSVYFKPDGE-------DEG
t29             WQSLMADSCPNA-VNIAVCCWKRELMPGL---NHSCEHLAKTVYFKPDGE-------DEG
t98             WQSLMADSCPPA-VNIAVCCWKRELMPGL---NHSCEHLAKTVYFKPDGE-------DEG
t83             WQSLMADSCPPA-VNIAVCCWKRELMPGL---NHSCEHLAKTVYFKPDGE-------DEG
t95             WQSLIADSCPNA-SNIAVCCWKRELMPGL---NFSCEHLAKTVYFKPDGE-------DEG
t20             WQSLIADSCPNA-VNIAVCCWKRELMPGL---NFSCEHLAKTVYFKPDGE-------DEG
t69             WQSLVADSCPNA-VNIAVCCWKRELMPGL---NHSCQHLAKTVYFKPDGE-------DEG
t2              WQSMVADSCHNA-VNIAVCCWKRELMPGL---NHSCQHLAKTVYFKPDGE-------DEG
t10             WQSMVADSCHNA-VNIAVCCWKRELMPGL---NHSCQHLAKTVYFKPDGE-------DEG
t31             WQSLIADSCPTA-ANIAVCCWKRELMPGL---NHSCEHLAKTVYFKPDGE-------DEG
t15             WQSLIADSCSTA-ANIAVCCWKRELMPGL---NHSCEHLAKTVYFKPDGE-------DEG
t63             WQSLIADACPTA-VNIAVCCWKRELMPGL---NHSCEHLAKSVYFKPDGE-------DEG
t50             WQSLIADACSTA-VNIAVCCWKRELMPGL---NHSVEHLAKSVYFKPDGE-------DEG
t25             WQSLIADACPTA-VNIAVCCWKRELMPGL---NHSCEHLAKSVYFKPDGE-------DEG
t51             WQSLIADACPAA-VNIAVCCWKRELMPGL---NHSCEHLAKTVYFKPDGE-------DEG
t9              WQSLVADSCVWA-HNVAVCAWKRELVPGL---NHSCERLAKHIYFQPDGE-------DEG
t47             WQSLVADSCVWA-HNVAVCAWKRELVPGL---NHSCDRLAKHIYFQPDGE-------DEG
t60             WQSLVADSCVWA-HNVAVCAWKRELVPGL---NHSCERLAKHIYFQPDGE-------DEG
t30             WQSLVADSCVWA-HNVAVCEWKRELVPGL---NHSCERLAKHIYFQPDGE-------DEG
t70             WQSLVADSCIWA-HNVAVCAWKRELVPGL---NHSCEHLAKHIYFQPDGE-------DEG
t91             WQSLVADSCIWA-HNVAVCAWKRELVPGL---NHSCEHLAKHIYFQPDGE-------DEG
t49             WQSLVADSCIWA-HNVAVCAWKRELVPGL---NHSCEHLAKHIYFQPDGE-------DEG
t52             WQSLVADSCVWA-HNVAVCAWKRELVPGL---NHSCERLAKHIYFQPDGE-------DEG
t43             WQSLVADSCCWA-HNVAVCGWKRELVPGL---NHSCEMLAKTVYFEPDGE-------DEG
t1              WQSLVADSCVWA-HNVAVCGWKRELVPGL---NHSCEMLAKTVYFEPDGE-------DEG
t86             WQSLVADSCVWA-HNVAVCGWKRELVPGL---NHSCEMLAKTVYFEPDGE-------DEG
t72             WQSLVADSCVWA-HNVAVCGWKRELVPGL---NHSCEMLAKTVYFEPDGE-------DEG
t96             WQSLVADSCMWA-HNVAVCGWKRELVPGL---NHSCEMLAKTVYFEPDGE-------DEG
t44             WQSLVADSCVWA-HNVAVCGWKRELVPGL---NHSCEMLAKTVYFEPDGE-------DEG
t45             WQSLVADSCVWA-HNVAVCGWKRELVPGL---NHSCEMLAKTVYFEPDGE-------DEG
t74             WQSLVADSCVWA-HNVAVCGWKRELVPGL---NHSCEMLAKTVYFEPDGE-------DEG
t26             WQSLVADSCAWA-VNVAVCGWKRELVPGL---NHACEMLAKTVYFEPDGE-------DEG
t61             WQSLVADSCAWA-VNVAVCGWKRELVPGL---NHACEMLAKSVYFEPDGE-------DEG
t97             WQSLVADSCAWA-VNLAVCGWKRELVPGL---NHACEMLAKSVYFEPDGE-------DEG
t17             WQSLSADSCAWA-HNVAVCGWKRELVPGL---NHACEMLAKTVYFEPDGE-------DEG
t11             WQSLSADSCAWA-HNVAVCGWKRELVPGL---NHACEMLAKTVYFEPDGE-------DEG
t23             WHSLIADACPCA-HNVAVCGWKRELVPGL---NHSNEHMAKTIYFEPDGH-------DEG
t76             WLSMGHCECWEEDINNILSVVKHELVDDVDRMNRLTEVAAKMAYFGPDGFHWDVELWEEN
t53             WLSMGHCECWEEDINNILSVVKHELVDDVDRMNRLTEVAAKMAYFGPDGFHWDVELWEEN
t16             WLSMGHCECWEEDINNILSVVKHELVDDVDRMNRLTEVAAKMAYFGPDGFHWDVELWEEN
t42             WLSMGHCECWEEDINNILSMVKHELVVDQDMVNRSPEVAAKMAYFGPDGFHWDVELCEES
t24             WLSMGHCECWEEGINNILSMVKHELVVDQDMVNRSPEVAAKMAYFGPDGFHWDIELCEEN
                

t73             PMQAKIVTLHW-EMDVSHRG-SSVDDNVV-VVMLAFAVSFCHPWGHYIQGLGD-QHKLAR
t66             PMQAKIVTLHW-EMDVSHRG-SSVDDNVV-VVMLAFAVSFCHPWGHYIQGLGD-QHKLAR
t32             PMQAKIVTLHW-EMDVSHRG-SSVDDNVV-VVMLAFAVSFCHPWGHYIQGLGD-QHKLAR
t75             NMQAKIVTLHW-EMDVSHRG-SSVDDNVV-VVMLAFQASFCDPWGHYIQGLGD-QYKLAR
t79             PMGQKIVDLHW-EMEASHRE-SSVRDNMI-VIMLPFNINSIDPWRHYILGLND-QIQLTR
t27             PMGQKIVDLHW-EMEASHRE-SSVRDNMI-VIMLPFSINSIDPWRHYILGLND-QIQLTR
t93             PMGQKIVDLHW-EMEASHRE-SSVRDNMI-VIMLPFSINSIDPWRHYILGLND-QIQLTR
t59             PMGQKIVDLHW-EMEASHRE-SSVRDNMI-VIMLPFSINSIDPWRHYILGLND-QIQLTR
t7              PMGQKIVDLHW-EMEASHRE-SSVRDNMI-VIMLPFSINSIDPWRHYILGLND-QIQLTR
t78             PMGQKIVDLHW-EMEASHRE-SSVRDNMI-VIMLPFSINSIDPWRHYILGLND-QIQLTR
t12             PMGRKIVDLHW-EMEASHRD-SSVRDNML-VIMLPFLVNNLDPWRHYILGLND-QIQLTR
t81             PMGRKIVDLHW-EMEASHRD-SSVRDNYI-VIMLPFKINSRDPWRHYILGIND-QVCLNR
t21             PMGRKIIQLHW-EMEASHRD-SSVRDNII-VIMLPFKINSRDPWRHYILGLND-QVCLTR
t80             PMGRKIVTLHV-EMEVSHRE-SSVKDNMIRVIMLPFSNSSVDPWRHVILGLND-QIKLTR
t14             PMGRKIVTLHV-EMEVSHRE-SSVKDNMIRVIMLPFPSSSVDPWRHVILGLND-QIKLTR
t85             PMGRKIVNLHV-EMEVSHRE-SSVKDNMIRVVMLPFDNNSWDPWRHVILGLND-QIKLTR
t62             PMGEKIVNLHV-EMEASHRE-SSVKDNMIRVIMLPFSNNSWDPWRHVILGLND-KIKLTR
t19             PMGEKIVNLHV-EMEASHRE-SSVKDNMIRVIMLPFSNNSWDPWRHVILGLND-QIKLTR
t77             PMGEKIVNLHV-EMEASHRE-SSVKDNMIRVIMLPFGENSWDPWRHVILGLND-QIKLTR
t88             KMWGKIFALEW-EMDISHRH-SSVDDNHC-VEMLPFMCQRVDPWGHYVQILAD-RQDLAR
t37             RMWGKIFALEW-EMDISHRH-SSVDDNQC-VELLPYVCQRMDPWGHYVQILAD-RLDLTR
t35             RMWGKIFALEW-EMDISHRH-SSVDDNQC-VELLPYVCQRMDPWGHYVQILAD-RLDLTR
t48             RMWGKIFALEW-EMDISHRH-SSVDDNQC-VELLPYVCQRMDPWGHYVQILAD-RLDLTR
t55             RMWGKIFALEW-EMDISHRH-SSVDDNQC-VELLPYNCQRMDPWGHYVQILAD-RLDLTR
t46             RMWGKIFALEW-EMDISHRH-SSVDDNQC-VELLPYVCQRMDPWGHYVQVLAD-RLDLTR
t67             RMWGKIFALEW-EMDISHRM-SSVDDNQC-VELLPYVCQRMDPWGHYVQILAD-RLVLTR
t57             RMWGKIFALEW-EMDISHRV-SSVDDNQC-VELLPYLCQRMDPWGHYVQILAD-RLNLTR
t56             KMWGKIFCLEW-EMDISHRH-SSVDDNVC-VEMLPFVCQKMDPWGHYVQILAD-RLDLTR
t13             KMMNKIFALEW-EMDMSHRV-SSVDDNYI-IEMLPFVCDRVGPWGHYAQVLAD-QLHLTR
t5              KMMNKIFALEW-EMDMSHRV-SSVDDNYI-IEMLPFVCDRVGPWGHYAQVLAD-QLHLTR
t38             KMMCKIFALEW-EMDMSHRM-SSVDDNYI-IEMLPFVCDRVGPWGHYAQILAD-QLNLTR
t33             KMMCKIFALEW-EMDMSHRM-SSVDDNYI-IEMLPFVCDRVGPWGHYAQILAD-QLNLTR
t100            KMMCKIFALEW-EMDMSHRM-SSVDDNYI-IEMLPFVCDRVGPWGHYAQILAD-QLNLTR
t34             KMMCKIFALEW-EMDMSHRM-SSVDDNYI-IEMLPFVCDRIGPWGHYAQILAD-QLNLTR
t84             KMMCKIFALEW-EMDMSHRM-SSVDDNYI-IEMLPFVCDRIGPWGHYAQILAD-QLNLTR
t92             KMMCKIFALEW-EMDMSHRM-SSVDDNYI-IEMLPFVCDRIGPWGHYAQILAD-QLNLTR
t3              KMMPKIFKLAW-EMDMSHRA-SSVDDNYV-IEMLPFVCHRVGPWGHYAQVQAD-QQNLTR
t22             KMMSKIFNLEW-EMDMSHRT-SSVDDNYV-IDMLPFICHRVGPWGHYAQVLAD-QINLTR
t64             KMMSKIFALEW-EMDMSHRV-SSVDDNFV-IEMLPFVCHRIGPWGHYAQMLAD-QIVLTR
t18             KMMFKIFALEW-EMDMSHRV-SSVDDNFV-IEMLPFVCHRIGPWGHYAQMLAD-QIVLTR
t68             KMMSKIFALEW-EMDMSHRV-SSVDDNFV-IEMLPFVCHRIGPWGHYAQMLAD-QIVLTR
t28             KMMSKIFALEW-EMDMSHRI-SSVDYNYV-IEMLPFVYHRVGPWGHYAQMLSD-QIVLTR
t82             KMMSKIYALEW-EMDMSHRV-SSVDYNYV-IEMLPFVYHRVGPWGHYAQMLAD-QIVLTR
t41             KMMSKIYALEW-EMDMSHRV-SSVDYNYV-IEMLPFVYHRVGPWGHYAQMLAD-QIVLTR
t71             KMMRKIFALEW-EMDMSHRD-SSVDDNYV-IEMLPFMCHRVGPWGHYAQQLAD-RLVLTR
t94             KMMRKIFALEW-EMDMSHRD-SSVDDNYV-IEMLPFMCHRVGPWGHYAQQLAD-KLVLTR
t99             KMMNKIFALEW-EMDMSHRDSSSVDDNYI-IEMLPFVCHRVGPWGHYAQQLAD-RLVLTR
t40             KMMRKIFALEW-EMDMSHRN-SSVDDNYV-IEMLPFMCHRVGPWGHYAQQLAD-RLVLTR
t90             KMMRKIFALEW-EMDMSHRN-SSVDDNYV-IEMLPFMCHRVGPWGHYAQQLAD-RLVLTR
t4              KMMGKIFALEW-EHDMSHRD-SSVDDNYV-IEMLPFMCHRVGPWGHYAQQLAD-RLVLTR
t36             KVMLKIFGLDWCEVERSHEH-SSVDDNYN-VNMLPFQNSRKDPVGHYVQDLED-ARRLIR
t87             KVMLKIFGLDWCEVERSHEH-SSVDDNYN-VNMLPFQNSRKDPVGHYVQDLED-ARRLIR
t89             KMMLKIFGLEWCEVERSHEH-SSIDDNYT-VNMLEFPNSRKDPVGHYVQNLED-AIRLIR
t39             KMMLKIFGLEWCEVERSHEH-SSIDDNYT-VNMLEFPNSRKDPVGHYVQNLED-AIRLIR
t8              KMMLKIFGLEWCEVERSHEH-SSIDDNYT-VNMLPFPNSRKDPVGHYVQDLED-AIRLIR
t6              KMMLKIFGLEWCEVERSHER-SSIDDNYT-VNMLPFPNSRKDPVGHYVQDLED-AIRLIR
t58             KMMLKIFGLDWCEVERSHEH-SSVDDNYN-VNMLPFPNSRQDPVGHYVQDLED-LLRLIR
t54             KMMLKIFGLDWCEVERSHEH-SSVDDNYN-VNMLPFPNSRKDPVGHYVQDLED-LLRLIR
t65             QMTMKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFMQSHGDPVGHYVQELED-ALRLIR
t29             QMSQKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFMQSHGDPVGHYVQELEDSALRLIR
t98             QMTMKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFMQSHGDPVGHYVQELED-ALRLIR
t83             QMTMKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFMQSHGDPVGHYVQELED-ALRLIR
t95             QMIMKIFNLDWCEVEKSHEK-SSVDDNYD-VNMLPFMQSHGDPVGHYVQGLED-ALRLIR
t20             QMIMKIFNLDWCEVEKSHEK-SSVDDNYD-VNMLPFMQSHGDPVGHYVQGLED-ALRLIR
t69             QMIVKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFMQSHGDPVGHYVQGLED-ALRLIR
t2              QMMVKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFMQSHGDPVGHYVQGLED-ALRLIR
t10             QMMVKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFMQSHGDPVGHYVQGLED-ALRLIR
t31             QMIMKIFNLDWCEVEKSHEK-SSVDDNYH-VNMLPFAQSNRDPVGHYVQGLED-ALRLIR
t15             QMIVKIFHLDWCEVEKSHEK-SSVDDNYH-VNMLPFAQSNGDPVGHYVQGLED-ALRLIR
t63             QMFMKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFVQSNGDPVGHYVQGLED-ALLLIR
t50             QMIMKIFNLDWCEVEKSHEK-SSVDDNYN-VNMLPFVQSNGDPVGHYVQGLED-ALLLIR
t25             QMIMKIFNLDWCEVEKSHEK-SSVDDNYD-VNMLPFVQSNGDPVGHYVQGLED-ALLLIR
t51             QMIMKIFGLDWCEVEKSHEE-SSVDDNYN-VNMLPFVSSNGDPVGHYVQGLED-ALRLIR
t9              KMVLKIFGLDWCEMEKSHQR-SGVDDNYQ-VNMLPFNHSKNNPVGHYVQGLED-ALNLIR
t47             KMILKIFGLDWCEMEKSHQR-SGVDDNVQ-VNMLPFNHSKHNPVGHYVQGLED-ELNLIR
t60             KMILKIFGLDWCEMEKSHQR-SGVDDNYQ-VNMLPFNHSKHNPVGHYVQGLED-ALNLIR
t30             KMILKIFGLDWCEMEKSHQR-SGVDDNYQ-VNMLPFKHSKHNPVGHYVQGLED-ALNLIR
t70             KMILKIFGLDWCEVERSHQR-SGVDDNYK-VNMLPFSHSKHNPVGHYVQGLGD-ALRLIR
t91             KMILKIFGLDWCEVERSHQR-SGVDDNYK-VNMLPFSHSKHNPVGHYVQGLGD-ALRLIR
t49             KMIIKIFGLDWCEVEKSHQR-SGVDDNYK-VNMLPFSHSNHNPVGHYVQGLGD-ALRLIR
t52             KMILKIFELNWCEVEKSHQH-SGVDDNYQ-VNMLPFDHCKHNPVGHYVQGLED-ALGLIR
t43             KMVLKIFELDWVEMEKSHQQ-SSVDDNYL-VNMLPFLHSRQNPVGHYVQGLED-PMHLIR
t1              KMVLKIFELDWVEMEKSHQQ-SSVDDNYL-VNMLPFMQSRENPVGHYVQGLED-PMHLIR
t86             KMVLKIFELDWVEMEKSHQQ-SSVDDNYL-VNMLPFIHSRDNPVGHYVQGLED-PMHLIR
t72             QMVLKIFELDWVEMEKSHQQ-SSVDDNYL-VNMLPFIHSRENPVGHYVQGLED-PMHLIR
t96             KMVLKIFELDWVEMEKSHQQ-SSVDDNYL-VNMLPFIRSRENPVGHYVQGLED-PMHLIR
t44             KMVLKIFELDWVEMEKSHQQ-SSVDDNYL-VNMLPFMHSRENPVGHYVQGLED-PMHLIR
t45             KMVHKIFELDWVEMEKSHQQ-SSVDDNYL-VNMLPFFHSRENPVGHYVQGLED-PMHLIR
t74             KMVHKIFELDWVEMEKSHQQ-SSVDDNYL-VNMLPFFHSRENPVGHYVQGLED-PMHLIR
t26             KMVIKIFGLDWCEIEKSHQQ-SSVDDNYL-VNMLPFTHSRETPVGHYVQGLED-PMHLMR
t61             KMVLKIFGLDWCEIEKSHQQ-SSVDDNYL-VNMLPFAHSRQTPVGHYVQGLED-PMHLMR
t97             KMNLKIFGLDWCEIEKSHQQ-SSVDDNYL-VNMLPFTHSRETPVGHYVQDLED-PMHLMR
t17             KMVIKIFGLDWCEMEKAHQQ-SSVDDNYL-VNMLPFTHSRENPVGHYVQGLED-PMHLIR
t11             KMVIKIFGLDWCEMEKAHQQ-SSVDDNYL-VNMLPFTHSRENPVGHYVQGLED-PMHLIR
t23             KMILNIFGLDWCEVETSHQE-SSSDDNHL-VNMLPFGVSRDDPVGHYMLGLED-AIRLYR
t76             DLNCDDFELGW-NLKH-------EDDHPL-LCIGSFSVHKYVSVMVYPLPMND-CVRMSQ
t53             DLNCDDFELGW-NLKP-------EDDHPL-LCIGSFSVHKYVSVMVYPLPMND-CVRMSQ
t16             DLNCDDFELGW-NLKP-------EDDHPL-LCIGSFSVHKYVSVMVYPLPMND-CVRMSQ
t42             DLTVDDFELGW-VLKP-------EDDHPL-ICIGSFSVHKQFSVMVYPLPMND-AIRMSQ
t24             DLTCDDFELGW-VLKP-------EDDHPL-ICIGSFSVHKQFSVMVYPLPMND-AIRMSQ
                

t73             PNT---AQKLSILT---VFHFSGGFRDKPM-ERSQLHS-TYSED----KKDQKVLIHAMK
t66             PNT---AQKLSILT---VFHFSGGFRDKPM-ERSQLHS-TYSED----KKDQKVLIHAMK
t32             PNT---AQKLSILT---VFHFSGGFRDKPM-ERSQLHS-TYSED----KKDQKVLIHAMK
t75             PNT---ARQLSILV---VMHFSGGFRDKPI-ERSQLHC-TYSEN----KKDQKVVIRAMK
t79             PNT---ARRLSILH---VMHYSGEFHDKSA-ERSQLHS-RYSEH----KNDHKCVILASK
t27             PNT---ARRLSILH---VMHYSGAFHDKSA-ERSQLHS-RYSEH----KNDHKCVILASK
t93             PNT---ARRLSILH---VMHYSGAFHDKSA-ERSQLHS-RYSEH----KNDHKCVILASK
t59             PNT---ACRLSILH---VMHYSGEFHDKSA-ERSQLHS-RYSEH----KNDHKCVILASK
t7              PNT---ACRLSILH---VMHYSGEFHDKSA-ERSQLHS-RYSEH----KNDHKCVILASK
t78             PNT---ACRLSILH---VMHYSGEFHDKSA-ERSQLHS-RYSEH----KNDHKCVILASK
t12             PNT---ARRLSILM---VMHYSGEFHDKSP-ERSQLHFDSYSEH----KNDHKCVILASK
t81             PET---ARRLSILA---VMHYSGEFHDKSP-ERSHLHF-RYSEM----KNDVKCVI---K
t21             PET---ARRLSILV---VMHYSGEFHDKSP-ERSHLHY-RYSEV----KNDVKCVILASK
t80             PNT---AHRLSILV---VTHYSGGFHDKSA-ERSQHHF-IYNEV----KDDHKCVILASK
t14             PNT---AHRLSILV---VTHYSGGFHDKSA-ERSQHHF-IYNEV----KDDHKCVILASK
t85             PNT---AHRLSILV---VMHYSGGFHDKSS-ERSQHHF-IYNEV----KNDHKCVILASK
t62             PNT---AHRLSILV---VMHYSGGFHDKSA-ERSQHHF-IYNEI----KNDHKCVILASK
t19             PNT---AHRLSILV---VMHYSGGFHDKSA-ERSQHHF-IYNEI----KNDHKCVILASK
t77             PNT---AHRLSILV---VMHYSGGFHDNSA-ERSQHHF-IYNEV----KNDHKCVILASK
t88             PVT---LQALSILP---CPHASGKEQDGAV-ERSQHYV-VYAEL----QVDHKCTIAAHK
t37             PVT---LQGLSILP---CPHASGKEQDGAV-ERSQHYG-VYQEL----QNDHKSTIDANK
t35             PVT---LQGLSILP---CPHASGKEQDGAV-ERSQHYG-VYQEL----QNDHKSTIDANK
t48             PVT---LQGLSILP---CPHASGKEQDGAV-ERSQHYG-VYQEL----QNDHKSTIDANK
t55             PVT---LQGLSILP---CPHASGKEQDGAV-ERSQHYG-VYQEL----QNDHKSTIDANK
t46             PVT---LQGLSILP---CPHASGKEQDGAV-ERSQHYG-VYQEL----QNDHKSTIDANK
t67             PVT---LHGLSILP---CPHASGKEQDGAE-ERSQHYG-VYQEL----QNDAKSTIDANK
t57             PVT---LQGLSILP---CPHASGKEQDGAV-ERSQHYG-VYQEL----QNDAKSTIDANK
t56             PVT---LQGLGILV---CPHASGKEQDGAM-ERSQHYV-VYAEL----QNDHKNTINANK
t13             PHT---LRDLYILAC--CPVASGKEQDGNK-ERSQHYT-IYAEI----QNDHKNPISANN
t5              PHT---LRDLYILAC--CPVASGKEQDGNK-ERSQHYT-IYAEI----QNDHKNPISANN
t38             PHT---LRELYILA---CPVASGKEQDGAQ-ERSQCYT-IYAEL----QNDHKSLISANH
t33             PHT---LRELYILA---CPVASGKEQDGAK-ERSQCYT-IYAEL----QNDHKSLISANH
t100            PHT---LRELYILA---CPVASGKEQDGAQ-ERSQCYT-IYAEL----QNDHKSLISANH
t34             PHT---LRELYILA---CPVASGKEQDGAQ-ERSQCYT-IYAEL----QNDHKSLISANH
t84             PHT---LRELYILA---CPVASGKEQDGAK-ERSQCYT-IYAEL----QNDHKSLIAANH
t92             PHT---LRELYILA---CPVASGKEQDGAQ-ERSQCYT-IYAEL----QNDHKSLISANH
t3              PHT---LADLFILS---CPVASGKEQDGAT-ERSQYYV-VYAEL----QNDHKSPISANK
t22             PHT---LRDLFILA---CPVASGKEQDGAT-ERSQHYV-VYAEL----QNDHKSPISANK
t64             PHT---LRDLFILS---CPVASGGEQDGNT-ERSQHYI-VYAEL----QNDHKSPISANK
t18             PHT---LRDLFILS---CPVASGGEQDGNT-ERSQHYI-VYAEL----QNDHKSPISANK
t68             PHT---LRDLFILS---CPVASGGEQDGNT-ERSQHYI-VYAEL----QNDHKSPISANK
t28             PHT---LRDLFILA---CRVASGGEVDGNT-ERSQHYI-VYAEL----QNDHKSPISANK
t82             PHT---LRDLFILA---CPVASGGEQDGNA-ERSQHYI-VYAEL----VNDHKSPISANK
t41             PHT---LRDLFILA---CPVASGGEQDGNA-ERSQHYI-VYAEL----VNDHKSPISANK
t71             PHT---LRDLFILA---CPVASGGEQDGNT-ERSQHYI-VYAEL----QNDHKSPISANK
t94             PHT---LRDLFILA---CYVASGGEQDGNT-ERSQHYI-VYAEL----QNDHKSPILANK
t99             PHT---LRDIFILA---CPVASGGEQDGNT-ERSQHYI-VYAEL----QDDHKSPISANK
t40             PHT---LRNIFILA---CPVASGGEQDENT-ERSQHYI-VYAEL----QNDHKSPIHANK
t90             PHT---LRNIFILA---CPVASGGEQDENT-ERSQHYI-VYAEL----QNDHKSPINANK
t4              PHT---LRDIFILA---CPVASGGEQDAVT-ERSQHYI-VYAEL----QNDHKSPISASK
t36             PGT---ARSLTILF-YGCQYYSGEFQDCEI-ERSQLYN-VYCEH----KQDHKSAIIANK
t87             PGT---ARSLTILF-YGCQYYSGEFQDCEI-ERSQLYN-VYCEH----KQDHKSAIIANK
t89             PGT---ARSLTILL-YGCQYYSGEFQDCEV-ERSQCYN-VYCEL----KQDHKSAIIANK
t39             PGT---ARSLTILL-YGCQYYSGEFQDCEV-ERSQCYN-VYCEL----KQDHKSAIIANK
t8              PGT---ARSLTILL-YGCQYYSGEFQDCEV-ERSQCYN-VYCEL----KQDHKSAIIANK
t6              PGT---ARSLTILL-YGCQYYSGEFQDCEV-ERSQCYN-IYCEL----KQDHKSAIIANK
t58             PGT---ARSLTVLF-YGCQYYSGQFQDCEI-ERSQLYN-VYCEL----KQDHKSAIMANK
t54             PGT---ARSLTVLF-YGCQYYSGEFQDCEI-ERSQLYN-VYCEL----KQDHKSAIMANK
t65             PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDYKSAIIANQ
t29             PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDYKSAIIANQ
t98             PGT---ARALVILF-YGCQYYSGKFQDSEMFERSQLYR-VYCEI----KKDYKSAIIANQ
t83             PGT---ARALVILF-YGCQYYSGKFQDSDMFERSQLYR-VYCEI----KKDYKSAIIANQ
t95             PGT---ARALIILF-YGCQYYSGKFQDSELFERSQLYR-MYCEI----KKDHKSAIIANQ
t20             PGT---ARALIILF-YGCQYYSGKFQDSELFERSQLYR-MYCEI----KKDHKSAIIANQ
t69             PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDHNSAIIANQ
t2              PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDHNSAIIANQ
t10             PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDHNSAIIANQ
t31             PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDHKSAIIANQ
t15             PGT---ARALVILS-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDHKSAIVANQ
t63             PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDHKSAIIANQ
t50             PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDHKSAIMANQ
t25             PGT---ARALVILF-YGCQYYSGKFQDSELFERSQLYR-VYCEI----KKDHKSTIIANQ
t51             PGT---ARALVILF-YGCQFYSGKFQDSELFERSQLYR-VYCEI----KKDHKSAIIANQ
t9              PGT---ARALNILF-YGCEVYSGEFQDSES-ERSWIYN-VYCEI----KKDHKSAIIAHK
t47             PGT---ARALNILF-YGCEYYSGEFQDSES-ERSWIYN-VYCEI----KKDHKSAIMACK
t60             PGT---ARALNILF-YGCEYYSGEFQDSES-ERSWIYN-VYCEI----KKDHKSAIMAYK
t30             PGT---ARALNILF-YGCEYYSGEFQDSES-ERSWIYN-VYCEI----KKDHKSAIMAYK
t70             PGT---ARALNILF-YGCQYCSGEFQDSEE-ERSWIYN-VYCEI----KKDHKSAILAHK
t91             PGT---ARALNILF-YGCQYCSGEFQDSEE-ERSWIYN-VYCEI----KKDHKSAILAHK
t49             PGT---ARALNILF-YGCEYYSGEFQDSEE-ERSWIYN-VYCEI----KKDHKSAIMAHK
t52             PGT---ARALNILF-YGCQYYSGEFQDSEA-ERSWIYN-VYCEI----KKDHKSGIMAHK
t43             PGT---ARKLNILF-YGCEYYSGQFPDGEA-ERSWIYD-VYCEM----KKDHKSAVIAHK
t1              PGT---ARKLNILF-YGCEYYSGQFPDGEA-ERSWIYD-VYCEM----KKDHKSAVVAHK
t86             PGT---ARKLNILF-YGCEYYSGQFPDGEA-ERSWIYP-VYCEM----KKDHKSAVVAHK
t72             PGT---ARKLNILF-YGCEYYSGQFPDGEA-ERSWIYD-VYCEM----KKDHKSAVVAHK
t96             PGT---ARKLNILF-YGCEYYSGQFPDAEA-ERSWIYD-VYCEM----KKDHKSAVYAHK
t44             PGT---ARKLNILF-YGCEYYSGQFPDCEA-ERSWIYD-VYCEM----KKDHKSAVVAHK
t45             PGT---ARKLNILF-YGCQYYSGQFPDGEA-ERSWIYD-VYCEM----KKDHKSAVVAHK
t74             PGT---ARKLNILF-YGCQYYSGQFPDGEA-ERSWIYD-VYCEM----KKDHKSAVVAHK
t26             PGT---ARALNILF-YGCEYYSGQFPDGEP-ERSWIYD-VYCEL----KKDHKNAIVAVK
t61             PGT---ARALNILF-YGCEYYSGHFPDGEA-ERSWIYD-MYCEL----KKDHKSAIVAVK
t97             PGT---ARALNILF-YGCEYYSGHFPDGEP-ERSWIYD-MYCEL----KKDHKSAIVAVK
t17             PGT---ARALNILF-YGCEYYSGQFPDGEP-ERSWIYD-VYCEL----KKDHKSAIVAVK
t11             PGT---ARALNILF-YGCEYYSGQFPDGEP-ERSWIYD-VYCEL----KKDHKSAIVAVK
t23             PGT---ARALNILF---VNYYSGDFQDPEL-ERSQLYN-VYCEQ----KQDHRNAIRASK
t76             PCHAAHAQDIPTEQ---TRYQIHTFLDDSI-RRDLCNQ-GCHEENMVWRDDLKDPISTEV
t53             PCHAAHAQDIPTEQ---TRYQIHTFLDDSI-RRDLCNQ-GCHEENMVWRDDLKDPISTEV
t16             PCHAAHAQDIPTEQ---TRYQIHTFLDDSI-RRDLCNQ-GCHEENMVWRDDLKDPISTEV
t42             PCHAAHAQDIHTDQ---DRYDVRTFLGHSI-KCHMCNQ-ACHEENIVWRDDLKDPITTEV
t24             PCYAAHAQDIHTDQ---DRYDIRTFLEHSI-RCHLCNQ-ACHEENIVWRDDLKDPITTEV
                

t73             -RNKGLDWHAGND-MKGGPK-IIYLGMLFY-------AENNVAKQKAHFVVFL-ISDATR
t66             -RNKGLDWHAGND-MKGGPK-IIYLGMLFY-------AENNVAKQKAHFVVFL-ISDATR
t32             -RNKGLDWHAGND-MKGGPK-IIYLGMLFY-------AENNVAKQKAHFVVFL-LSDATR
t75             -RNKGCDWHAGKD-MAGGPK-IIYVGMLFY-------AESNWAKQKAHFVVFL-ISDATR
t79             -HNKDHDWATGKDEMKGGAK-IMNPGALFY-------AEQNWVRPKNHFVIFL-ICDAVR
t27             -VNKDHDWITGKDEMKGGAK-IMNPGALFY-------AEQNWVRPKNHFVIFL-ICDAVR
t93             -VNKDHDWITGKDEMKGGAK-IMNPGALFY-------AEQNWVRPKNHFVIFL-ICDAVR
t59             -HNKDHDWATGKDEMKGGAK-IMNPGALFY-------AEQNWVRPKNHFVIFL-ICDAVR
t7              -HNKDHDWATGKDEMKGGAK-IMNPGALFY-------AEQNWVRPKNHFVIFL-ICDAVR
t78             -HNKDHDWATGKDEMKGGAK-IMNPGALFY-------AEQNWVRPKNHFVIFL-ICDAVR
t12             -HNKGLDWATGKDDMKGGAK-IMMSGALFY-------AEQNWIRARNHFVIFL-ICDAVR
t81             -SNKGLDWTAGKDGMKGEAK-AMMNGALFY-------AEQNWFRKKNHFVIFV-FCDAVR
t21             -SNKGLDWTAGKDGMKGENK-AMMNGTLFY-------AEQNWFRQKNHFVIFV-ICDAVR
t80             -CNKGLDWAAGKD-MKGGAK-VMMNGALFY-------AERNWIRQKHHFVIFV-VCDAVR
t14             -CNKGLDWAAGKD-MKGGAK-IMMNGALFY-------AERNWIRQKHHFVIFV-VCDAVR
t85             -SNKGLDWAAGKD-MKGGAK-MMANGALFY-------EERNWIRQKNHFVIFV-VCDAVR
t62             -ANKPLDWAAGKD-MKGGAK-MMANGALFY-------AERNWIRQKNHFVIFI-ICDAVR
t19             -ANKGLDWAAGKD-MKGGAK-MMVNGALFY-------AERNWIRQKNHFVIFV-ICDAVR
t77             -ANKGLDWAAGKD-MKGGAK-MMVNGALFY-------AERNWIRQKNHFVIFV-ICDAVR
t88             YQDKMKDWDTGKN-MDEGAK-MYVEIHLFY-------AENNIRRQNDHSVIFW-ISDAKK
t37             NDNKMLDWDTGKN-MDKGAK-MFYKIVLFY-------AENNLRKQNEHSVTFV-ISDAQK
t35             NDNKMLDWDTGKN-MDKGAK-MFYKIVLFY-------AENNLRKQNEHSVTFV-ISDAQK
t48             NDNKMLDWDTGKN-MDKGAK-MFYKIVLFY-------AENNLIKQNEHSVTFV-ISDAQK
t55             NDNKMLDWDTGKN-MDKGAK-MFYKIVLFY-------AENNLRKQNEHSVTFV-ISDAQK
t46             NDNKMLDWDTGKN-MDKGAK-MFYKIVLFY-------AENNIRKQNEHSVTFV-ISDAQK
t67             NPNKMLDWDTGKN-MDKGAK-MFYKIVLFY-------AENNIRKLNEHSVTFV-ISDAQK
t57             NPNKMLDWDTGKN-MDKGAK-MFYKIVLFY-------AENNIRKQNEHSVTFV-ISDAQK
t56             VPRKMLDWDTGKN-MDKGAKGMYHEIVLFF-------AENNVKKQVEHSVIFI-IADAQK
t13             QPNKMLDWDTGKT-MDRGAA-MCGEIKLFY-------AEPNVWNQNDHSVMFI-ISDAQN
t5              QPNKMLDWDTGKT-MDRGAA-MCGEIKLFY-------AEPNVWNQNDHSVMFI-ISDAQN
t38             VPNKMLDWDTGKT-MDRGAA-MCAEIKLFY-------AEPNVWKQNDHSVMFI-ISDAQN
t33             VPNKMLDWDTGKT-MDRGAA-MCAEIKLFY-------AEPNVWKQNDHSVMFI-ISDAQN
t100            VPNKMLDWDTGKT-MDRGAA-MCAEIKLFY-------AEPNVWKQNDHSVMFI-ISDAQN
t34             VPNKMLDWDTGKT-MDRGAA-MCAEIKLFY-------AEPNVWKQNDHSVMFI-ISDAQN
t84             VPNKMLDWDTGKT-MDRGAA-MCAEIKLFY-------AEPNVWKQNDHSVMFI-ISDAQN
t92             VPNKMLDWDTGKT-MDRGAA-MCAEIKLFY-------AEPNVWKQNDHSVMFI-ISDAQN
t3              HPDKMLDWDTGKS-MDRGAA-MCREIKLFY-------AEPNVWKQNDHSVVFI-ISDAVN
t22             HPNKLLDWDTGKT-MDRGAA-MCHEIKLFH-------AEPNVWRQNDHSVMFI-ISDASN
t64             HLNKMLDWDTGKT-MDREAT-MCREMKLFY-------AETNLWKQNDHSVMFI-ISDAQN
t18             HLNKMLDWDTGKT-MDREAT-MCREMKLFY-------AETNLWKQNDHSVMFI-ISDAQN
t68             HLNKMLDWDTGKT-MDREAT-MCREMKLFY-------AETNLWKQNDHSVMFI-ISDAQN
t28             VLNKMLDWDTGKT-MDREAA-MCREIKLFY-------AETNVWKQNDHSVMFI-ISDAQN
t82             VLNKMLDWDTGKT-MDREAA-MCRDIKLFY-------AETNVWKQNDHSVMFI-ISDAQN
t41             VLNKMLDWDTGKT-MDREAA-MCRDIKLFY-------AETNVWKQNDHSVMFI-ISDAQN
t71             HMNKMLDWDTGKT-MDFEAA-MCREIKLFY-------AETNVWKINDHSVMFI-VSDAQN
t94             VVNKMLDWDMGKT-MDFEAA-MCREIKLFY-------AETNVWKQNNHSVMFI-VSDAHN
t99             HMRKMLDWDTGKT-MDREAA-VCREIKLFY-------AETNCWKQNDHSVMFI-VSDAQN
t40             VMNKMLDWDTGKT-MDREAA-MCREIKLFV-------AETNVWKQNDHSVMFIVISDAQN
t90             VMNKMLDWDTGKT-MDREAA-MCREIKLFV-------AETNVWKQNDHSVMFIVISDAQN
t4              HMNKMLDWDTGKT-MDREAA-MCREIKLFY-------AETNVWKQNDHSVMFI-ISDAQN
t36             QEQKGMDWNTGKE-MEQGPK-IILHGSLFF-------AEPNIVRQPGVSHIFI-GNDARR
t87             QEQKGMDWNTGKE-MEQGPK-VILHGTLFF-------AESNIVRQPGVSHIFI-GNDARR
t89             QEQKGMDWNTGKE-MEQGPK-IILHGCLFF-------AEPNIVRQPGVSHIFT-ENDARR
t39             QEQKGMDWNTGKE-MEQGPK-IILHGCLFF-------AEPNIVRQPGVSHIFT-ENDARR
t8              QEQKGMDWNTGKE-MEQGPK-IILHGCLFF-------AEPNIVRQPGVSHIFT-ENDARR
t6              QEQKGMDWNTGKE-MEQGPK-IILHGCLFF-------AEPNIVRQPGVSHIFI-ENDARR
t58             QEQKGMDWNTGKE-MEQGPK-IILHGVLFF-------AEPNVVRQPGVSHIFV-GNDARR
t54             QEQKGMDWNTGKE-MEQGPK-IILHGVLFF-------AEPNVVRQPGVSHIFV-GNDARR
t65             QEHKGMEWDTGKE-MQQGPK-VVVHLALFYAPSNVLAAEPNIIGQPQVSHVFV-GNDARR
t29             QDHKGMEWDTGKE-MQQGPK-VVVHLALFYMPSNVLAAEPNIIGQPQVSHWFV-GNDARR
t98             QEHKGMEWDTGKE-MQQGPK-IVVHLGLFYMPSNVLAAEPNIIGQPQVSHVFV-ANDARR
t83             QEHKGMEWDTGKE-MQQGPQ-IEVHLALFYMPSNVLPAEPNIIGQPQVSHVFV-GNDARR
t95             QEHKGMEWDTGKE-MQQGPK-VVLHHALFYAPSNVLAAEPNIIGQPQVSHVFV-GNDARR
t20             QEHKGMEWDTGKE-MQQGPK-VVLHHALFYAPSNVLAAEPNIIGQPQVSHVFV-GDDARR
t69             QEHKGMDWDTGKE-MQQGPK-IVVVLALFYQPSNVLAAEPNIMGQPQVSVVFV-GNDGRR
t2              QEHKGMDWDTGKE-MQQGPK-IVVVLALFYQPSNVLAAEPNIMGQPQVSVVFV-GNDARR
t10             QEHKGMDWDTGKE-MQQGPK-IVVVLALFYQPSNVLAAEPNIMGQPQVSVVFV-GNDARR
t31             HEVKGMDWNTGKE-MQQGPK-IVVHLALFYAPSNVLAAEPNIVGQPQVSHVFV-GNDARR
t15             QEVKGMDWDTGKE-MQQGPK-IVVHLALFYAPSNVLAAEPNIVGQPQVSHVFV-GNDARR
t63             QGVKGMDWDTGKE-MQQGPK-IVVHLALFYAPSNVLAAEPNIIGQPQVSHVFV-DNDARR
t50             QGVKGMDWDTGKE-MQQGPK-IVMHLALFYAPSNVLAAEPNIIGQPQVSHVFV-DNDARR
t25             QGVKGMDWDTGKE-MQQGPK-IVVHLTLFYAPSNVLAAEPNIFGQPQVSHVFV-DNDARR
t51             QGVKGMDWDTGKE-MQQGPK-IVVHLALFYAPSNVLAAEPNIIGQPQVSHVFV-DNDIRR
t9              YEHKGMDWDTGKE-AQQGPE-VVHHNLLFF-------AEPNIHGQPGVGHIFV-GNDARR
t47             YRHKGMDWDTGKE-AEQGPE-VVHHNLLFF-------AEPNIQGQPGVGHIFV-GNDARR
t60             FEHKGMDWDTGKE-AEQGPE-VVHHNLLFF-------AEPNIQGQPGVGHIFV-GNDARR
t30             YEHKGMDWDTGKE-AEQGPE-VVHHNLLFF-------AEPNIHGQPGVGHIFV-GNDARR
t70             YKHKGMDWDTGKE-MEQGPK-VVNYNLLFY-------AEPNIHGQPRVGHIFV-GNDAHR
t91             YKHKGMDWDTGKE-MEQGPK-VVNYNLLFY-------AEPNIHGQPRVGHIFV-GNDAHR
t49             YEHKGMDWDTGKE-MEQGPK-VVHHNILFY-------AEPNIHGQPRVGHIFV-GNDAVR
t52             YDHKGVDWDTGKE-MEQGPK-VLHHNLLFY-------AEPNIHGQPTVGHIFV-GNDARR
t43             HEHKGMDWDTGKE-MNQGPK-IVLHGVLFN-------AEPNIHGQPGVSHVFM-GNDATR
t1              VEHKGMDWDTGKE-MNQGPK-IVLHGVLFN-------AEPNIHGQPGVSHVFM-GNDATR
t86             AEHKGMDWDTGKE-MNQGPK-IVLHGVLFN-------AEPNIHGQPGVSHVFM-GNDATR
t72             VEHKGMDWDTGKE-MNQGPK-IVLHGVLFN-------AEPNIHGQPGVSHVFM-GNDATR
t96             VEHKGMDWDTGKE-MNQGPK-IVLHGVLFN-------AEPNIHGQPGVSHVFM-GNDATR
t44             HEHKGMDWDTGKE-MNQGPK-VVMHGVLFN-------AEPNIHGQPGVSHVFM-GNDATR
t45             HQHKGMDWDTGKE-MNQGPK-VVLHGVLFN-------AEPNIHGQPGVSHVFM-GNDATR
t74             HQHKGMDWDTGKE-MNQGPK-VVLHGVLFN-------AEPNIHGQPGVSHVFM-GNDATR
t26             HEHKGMDWDTGKE-MNHGPK-VIVHGVLFH-------AEPNIGGQPGVSHVFV-GNDATR
t61             HCHKGMDWDTGKE-MNHGPK-VIIHGLLFH-------AEPNIGGQPGVSHVFV-GNDATR
t97             HCHKGMDWDTGKE-MNHGPK-VIIHGVLFH-------AEPNIGGQPGVSHVFV-GNDATR
t17             HEHKGMDWDTGKE-MNQGPK-VIIHGVLFH-------AEVNIHGQPGVSHVFV-GNDATR
t11             HEHKGMDWDTGKE-MNQGPK-VIIHGILFH-------AEVNIHGQPGVSHVFV-GNDATR
t23             NDHKGMAWDTAKD-MEQGPK-MVEHQVLFY-------AEPNMHGQPEVIHIFI-GNDAMC
t76             IADKLHEWPTNVN-KENSAD----HRQLFH-------ANSSALDKHQHNVVMN-GSPCIR
t53             IADKLHEWPTNQN-KENSAD----HRQLFH-------ANSSALDKHQHNVVMN-GSPCIR
t16             IADKLHEWPTNQN-KENSAD----HRQLFH-------ANSSALDKHQHNVVMN-GSPCIR
t42             IAEKLQEWPTNQN-KENVAD----HRQLFH-------ANSSALDKHRHNVMMN-GSACIR
t24             IADKLQEWPTNQN-AENVAD----HRQLFH-------ANSSCLDRHRHNVMMN-GSSCIR
                

t73             LLIVHEGCMIDYTFMEFACHPFFAELFMEHMVARYQYYSNVDIKIFDTCFRSAVYAVDNS
t66             LLIVHEGCMIDYTFMEFACHPFFAELFMEHMVARYQYYSNVDIKIFDTCFRSAVYAVDNS
t32             LLIVHEGCMIDYTFMEFACHPFFAELFMEHMVARYQYYSNVDIKIFDTCFRSAVYAVDNS
t75             LLIHHVGCMIEYTFMEFACHPFFAELFMEHMVIRYQYYNNVDIKIFDTCFRGAVYAEDNS
t79             ILILHHGCMTDHTFMEFACNPFFSELFMEHVYIRYQYINNHDIKIKDTVFRLAVYAWDNF
t27             ILILHHGCMTDHTFMEFACNPFFSELFMEHVYIRYQYVNNHDIKIKDTVFRLAVYAWENF
t93             ILILHHGCMTDHTFMEFACNPFFSELFMEHVYIRYQYVNNHDIKIKDTVFRLAVYAWENF
t59             ILILHHGCMTDHTFMEFACNPFFAELFMEHVYIRYQYVNNHDIKIKDTVFRLAVYAWENF
t7              ILILHHGCMTDRTFMEFACNPFFAELFMEHVYIRYQYVNNHDIKIKDTVFRLAVYAWENF
t78             ILILHHGCMTDRTFMEFACNPFFAELFMEHVYIRYQYVNNHDIKIKDTVFRLAVYAWENF
t12             ILIVLHGCMTAWTFMEFACNPFFAELFMEHVYIRYQYVNNHDIKIKDTEFRLAVYAWENS
t81             ILIMHSGVMIGYTFMEFACNPFFAELFMEHVMVRYQYESNHDIKIKDTCFRLAVYAWENS
t21             ILIVHSGVMTGFTFMEFACNPFFAELFMEHVYIRYQYQANHDIKIKDTCFRLAVYAWENS
t80             ILIVHYGCMIGYTFMDFACNPFFAELFMDHVFIRYVYMNNHDIKIMDTCFRVAVYTWENS
t14             ILIVHYRCMIGYTFMDFACNPFFAELFMDHVFIRYQYMNNHDIKIMDTCFRVAVYTWENS
t85             ILIVHYGCMVPYTFMAFACNPFFAELFMEHVFIRYQYVNNHDIKIMDTCFRVAVYTWENS
t62             ILIVHYGCMVGDTFMDFACNPFFAELFMEHVFIRYQYIPNHDIKIMDTCFRVAVYTWENS
t19             ILIVHYGCMVGDTFMDFACNPFFAELFMEHVFIRYQYIPNHDIKIMDTCFRVAVYTWENS
t77             ILIVHYGCMVGDTFMDFACNPFFAELFMEHVVIRYQYIPNHDIKIMDTCFRVAVYTWENS
t88             RLICGMSSMCLVTFMTLACNPLFAKLFMEVVPMRYDYLTNHDIKI------MEVYAPENS
t37             RLICGVSSMVMRTFMTLACNPFFAKLFMEVVPMSYDYVPNHDIKI------IEVYAPENS
t35             RLICGVSSMAMRTFMTLACNPFFAKLFMEVVPMSYDYVPNHDIKI------IEVYAPENS
t48             RLICGVSSMVMRTFMTLACNPFFAKLFMEVVPMSYDYVPNHDIKI------IEVYAPENS
t55             RLICGVSSMCMRTFMTLACNPFFAKLFMEVVPMSYDYVPNHDIKI------IEVYAPENS
t46             RLICGVSSMCMRTFMTLACNPFFAKLFMEVVPMSYDYVPNHDIKI------IEVYAPDNS
t67             RLICGVSSMCMRTFMTLACNPFFAKLFMEVVPMSYDYVPNHDIKI------IEVYAPENS
t57             RLICGVSSMCMRTFMTLACNPFFAKLFMEVVPMSYDYVPNHDIKI------IEVYAPENS
t56             RLICGVSSMCLQTFMNLACNPFFAKLFMEVIPMRYDYQTNHDIKI------KEVYAPENS
t13             RLIVANSIMVGQTFMAMACNPHFSKLFMEVVCMRYNYTSNHSIKI------FEVYADENS
t5              RLIVANSIMVGQTFMAMACNPHFSKLFMEVVCMRYNYTSNHSIKI------FEVYADENS
t38             KLIVANSIMVGQTFMAMACNPHFAKLFMEVVVMRYDYCSNHSIKI------FEVYADENS
t33             RLIVANSIMVGQTFMAMACNPHFAKLFMEVVVMRYDYCSNHSIKI------FEVYADENS
t100            RLIVANSIMVGQTFMAMACNPHFAKLFMEVVVMRYDYCSNHSIKI------FEVYADENS
t34             RLIVANSIMVGQTFMAMACNPHFAKLFMEVVVMRYDYCSNHSIKI------LEVYADENS
t84             RLIVANSIMVGQTFMAMACNPHFAKLFMEVVVMRYDYCSNHSIKI------LEVYADENS
t92             RLIVANSIMVGQTFMAMACNPHFAKLFMEVVVMRYDYCSNHSIKI------LEVYADENS
t3              RLICANSIMCGLTFMAMACNPHFAKLFMEVVCMRYDYFSNHSIKI------FEVYAEDDS
t22             RLICANSIMCGLTFMAMACNPHFAKLFMEVVCMRYEYFSNHSIKI------FEVYAEENS
t64             RLICGNSIMCGLTFMAMACNPHFAKLFMEVVCVHYDYGANHDIKI------FEVYAAENS
t18             RLICGNSIMCGLTFMAMACNPHFAKLFMEVVCVHYDYGANHDIKI------FEVYAAENS
t68             RLICGNSIMCGLTFMAMACNPHFAKLFMEVVCVHYDYGANHDIKI------FEVYAVENS
t28             RLICGNSIMCGITFMAMACNPHFAKLFMEVACMRYDYFANPDIKI------FEVYAAENS
t82             RLICGNSIMCGLTFMAMACNPHFAKLFMEVACMRYDYFANPDIKI------FEVYADENS
t41             RLICGNSIMCGLTFMAMACNPHFAKLFMEVACMRYDYFANPDIKI------FEVYADENS
t71             RLICGNSIMCGLTFMAMACNPHFAKLFMEGVCMRYDYSANHDIKI------FEVYADENS
t94             RLICGNSIMCALTFMAMACNPHFAKLFMEAVCMRYDYSANHDIKI------VEVYADENS
t99             RLICGSSIMCRLTFMAMAVNPHFAKLFMEDVCMRYDYSPNHDIKI------FEVYADENS
t40             RLICGSSIMCRLTFMAMAVNPHFAKLFMEESCVRYDYSANHDIKI------FEVYANENS
t90             RLICGSSIMCGLTFMAMAVNPHFAKLFMEESCVRYDYSRNHDIKI------FEVYANENS
t4              RLICGSSIMCGLTFMATACNPHFAKLFMEEVCMRYDYAANHDIKI------SEVYAEENS
t36             VLICGKSMMPGHRFMREACVPFFHKLFMAVNQMRYDYMMNYDIKIYETHWRMGVYALDNS
t87             VLICGLSMMPGHRFMREACVPFFHKLFMAVNQMRYDYMVNYDIKIYETHWRMGVYALDNS
t89             MLICGNSMMPRHRFMREACVPFFHKLFMAVNQMRYDYVTNYDIKIYETHWRVGVYAIDNS
t39             MLICGNSMMPRHRFMREACVPFFHKLFMAVNQMRYDYVTNYDIKIYETHWRVGVYAIDNS
t8              MLICGNSMMPRHRFMREACVPFFHKLFMAANQMRYDYVTNYDIKIYETHWRVGVYAIDNS
t6              MLICGNSMMPRHRFMREACVPFFHKLFMAVNQMRYDYMTNYDIKIYETHWRVGVYAIDNS
t58             MLICGLSMMPGHRFMKEACVPFFHKLFMAVRRMRYDYMSNYDIKIYETHWRPGVYALDNS
t54             MLICGLSMMPGHRFMKEACVPFFHKLFMAVRRMRYDYMTNYDIKIYETHWRPGVYALDNS
t65             MLIVGVSMMPAYKFMREACVPFFRKLFMAENQVRYDYMWNYDIKIYETHFRMGVYAVDNS
t29             MLIVGVSMMPAYKFMREACVPFFRKLFMADNQVRYDYMWNYDIKIYETHFRMGVYAVDNS
t98             MLIVGVSMMPAYKFMREACVPFFRKLFMAENQVRYDYVWNYDIKIYETHFRMGVYAVDNS
t83             MLIVGVSLMPAYKFMREACVPFFRKLFMAENQVRYDYMWNYDIKIYETHFRMGVYAVDNS
t95             MLITGVSMMPAYKFMREACVPFFRKLFMAENQVRYDYVWNYDIKIYETHYRMGVYAVDNS
t20             MLITGVSMMPAYKFMREACVPFFRKLFMAENQVRYDYVWNYDIKIYETHYRMGVYAVDNS
t69             MLIVGCSMMPDYKFMREACVPFFRKLFMAEVQDRYDYAWNYNIKIYETHFRDGVYAVDNS
t2              MLIVGCSMMPDYKFMREACVPFFRKLFMAEVQDRYDYNWNYNIKIYETHFRVGVYAVDNS
t10             MLIVGCSMMPDYKFMREACVPFFRKLFMAEVQDRYDYNWNYNIKIYETHFRVGVYAVDNS
t31             MLIVGVSVMPSYKFMREACVPFFHKLFMADNQVRHEYMWNYDIKIYETHFRMGVYAVDNS
t15             MLIVGVSVMPAYKFMREACVPFFHKLFMAENQVRHDYMWNYDIKIYETHFRMGVYAVDNS
t63             MLIVGQSVMPPYKFMREACVPFFHKLFMAENQVRHDYVWNYDIKIYETHFRMGVYAIDNS
t50             MLIVGQSVMPAYKFMREACVPFFHKLFMAENQVRHDYVWNYDIKIYETHFRMGVYAVDNS
t25             MLIVGQSVMPAYKFMREACVPFFHKLFMAENQVRHDYVWNYDIKIYETHFRMGVYAVDNS
t51             MLIVGVSVMPAYKFMREACVPFFHKLFMAENQVRHDYVWNYDIKIYETHFRMGVYAVDNS
t9              KLIAGVSFMSMVKFMCEACVPFFRKLFMAVGQMRYDYVNNYDIKIWETVFRGGVYAIENS
t47             KLIAGLSFMAMMKFMCEACVPFFRKLFMAVGHMRYDYVSNYDIKIWETVFRGGVYAIENS
t60             KLIAGVSFMAVMKFMCEACVPFFRKLFMAVGQMRYDYMNNYDIKIWETFFRGGVYAIENS
t30             HLIAGVSFMAVVKFMCEACVPFFRKLFMAVGQMRYDYVNNYDIKIWETVFRGGVYAIENS
t70             KLIAGVSFMSIMKFMCEACVPFFRKLFMAVRQMRYMYMNNYDIKIWETAFRGGVYAIENS
t91             KLIAGVSFMSIMKFMCEACVPFFRKLFMAVRQMRYMYMNNYDIKIWETAFRGGVYAIENS
t49             NLIAGVSFMSIMKFMCEACVPFFRKLFMAVRQMRYMYMNNYDIKIWETAFRGGVYAMENS
t52             KLIAGVSFMSVVKFMCEACVPFFRKLFMAFRQMRYDYVNNYDIKIWETVFRGGVYAIENS
t43             KLITGVSVMPTYKFMCGACVPFFHKLFMAVRNMRYDYNVNYDIKIWETHIRHGVYAVENS
t1              KLITGVSVMPTYKFMCGACVQFFHKLFMAVRNMRYDYTVNYDIKIWETHIRQGVYAVENS
t86             KLITGVSVMPTYKFMCGACVPFFHKLFMAVRNMRYDYTVNYDIKIWETHIRHGVYAVENS
t72             KLITGFSIMPTYKFMCGACVPFFHKLFMAVRNMRYDYTVNYDIKIWETHIRHGVYAVENS
t96             KLISGVSVMPTYKFMCGACVPFFHKLFMAVRNMRYDYTVNYDVKIWETHIRHGVYAVENS
t44             KLITGVSVMPTYKFMCNACVPFFHKLFMAVRNMRYDYTVNYDIKIWETHMRHGVYAVENS
t45             KLIPGVSVMHDYKFMCGACVPFFHKLFMAVRNMRYDYTVNYDIKIWETHLRHGVYAVENS
t74             KLIPGVSVMHDYKFMCGACVPFFHKLFMAVRNMRYDYTVNYDIKIWETHLRHGVYAVENS
t26             KLIAGVSVMPIVKFMCGACVPFFRKLFMALRNMRYDYASNYDIKIVETHLREGVYAVENS
t61             KLIAGASVMFIVKFMCGACVPFFRKLFMALRNMRYDYSQNYDIKIVETHLREGVYAIENS
t97             KLIAGVSVMPIVKFMCGACVPFFRKLFMALRNMRYDYSQNYDIKIVETHLREGVYAVENS
t17             KLIAGVSVMPFVKFMCGACVPFFRKLFMALRNMRYDYTSNYDIKIIETHLRNGVYAVENS
t11             KLIAGVSVMPFVKFMCGACVPFFRKLFMALRNMRYDYTSNYDIKIMETHLRNGVYAVENS
t23             MLIPGMSVMVHHKFMRAACMPFFNKLFMAVRYMRYDYVDNYDIKIDETRYRDGVYARRNS
t76             ALIIGGSSVGVNHFMMGPCQEFFTDLFMMYEGLQYACVCAMNITIQCLHTGEGVMCNVKC
t53             ALIIGGSSVGVNHFMMGPCQEFFTDLFMMYEGLQYACVCAMNITIQCLHTGEGVVCNVKC
t16             ALIIGGSSVGVNHFMMGPCQEFFTDLFMMYEGLQYACVCAMNITIQCLHTGEGVVCNVKC
t42             TLIIGGSIVGVNVFMMEPCQEFFTDLFMVYEGLQYAVVCAVNIIIQCLHTNEGVVCNVKC
t24             TLIIGGSIVGVNVFMMGPCQEFFTDLFMVYEGLQYAVVCAINIIIQVLHTNEGVVCNVKC
                

t73             WETLCDY-EMLSGYFGAEINHNPRLPEQVC-PPCTITVSGLKGKLHNRWPVLTQITRTMR
t66             WETLCDY-EMLSGYFGAEINHNPRLPEQVC-PPCTITVSGLKGKLHNRWPVLTQITRTMR
t32             WETLCDY-EMLSGYFGAEINHNPRLPEQVC-PPCTITVSGLKGKLHNRWPVLTQITRTMR
t75             WETLCGY-EMLSGYFGAEINHNPRLPEQVC-PPCTITVSGLKGKLHNRWPVLTQITRTMR
t79             WETLCKC-EMLSGHVGAKINHNPRLFEQVC-PPVELTVSGLKGKV-NGWPYLTDITRTPL
t27             WETLCNC-EMLSGHVGAKINHNPRLFEQVC-PPVELTVSGLKGKV-NGWPYLTDITRTPL
t93             WETLCNC-EMLSGHVGAKINHNPRLFEQVC-PPVELTVSGLKGKV-NGWPYLTDITRTPL
t59             WETLCNC-EMLSGHVGAKINHNPRLFEQVC-PPVELTVSGLKGKV-NGWPYLTDITRTPL
t7              WETLCNC-EMLSGHVGAKINHNPRLFEQVC-PPVELTVSGLKGKV-NGWPYLTDITRTPL
t78             WETLCNC-EMLSGHVGAKINHNPRLFEQVC-PPVELTVSGLKGKV-NGWPYLTDITRTPL
t12             WETLCNC-EMLSGHIGAKINHNPRLFEQVC-PPCELTVSGLKGKH-VGWPYLTDITRTPL
t81             WETLCNV-EMLSGHFGAKINHVPRLPEQVC-PPCDLTVSGLKGKQ-NGLPYLTDITRTPL
t21             WETLCNV-EMLSGHFGAKINHVPRLPEQVC-PPCDLTVSGLKGKQ-NGWPYLTDITRTPL
t80             WETCFNR-EMLSGTFGAKISHNPRLPEQVI-PPCELTVSGLKGKH-NGWPYLTDITRTPL
t14             WETCCNR-EMLSGTFGAKISHNPRLPEQVI-PPCELTVSGLKGKH-NGWPYLTEITRTPL
t85             WETCCNR-EMLSGTFGAKISHNPRLPEQVI-PPCDLTVSGLKGKH-NGWPYLTDITRTPL
t62             WETCCNR-EMLSGTFGARISHVPRLPEQVI-PPCELTVSGLKGKH-NGWPYLTDITRTPL
t19             WETCCNR-EMLSGTFGARISHVPRLPEQVI-PPCELTVSGLKGKH-NGWPYLTDITRTPL
t77             WETCCNR-EMLSGTFGARISHVPRLPEQVI-PPCELTVSGLKGKH-NGWPYLTDITRTPL
t88             WETIKNV-EMVSGKEGAEINHTPQLPEQVI-PPCNLTVSNLKGMI-PPCPALTEITRTV-
t37             WETTKVV-EMVSGKSGAQINHTPQLPEQVI-PPCCLTVSNLKGMI-PPVPALTEITRTP-
t35             WETTKVV-EMVSGKSGAQINHTPQLPEQVI-PPCCLTVSNLKGMI-PPCPALTEITRTP-
t48             WETTKVV-EMVSGKSGAQINHTPQLPEQVI-PPCCLTVSNLKGMI-PPCPALTEITRTP-
t55             WETTKVV-EMVSGKSGAQINHTPQLPEQVI-PPCCLTVSNLKGMI-PPCPALTEITRTP-
t46             WETTKVV-EMVSGKSGAQINHTPQLPEQVI-PPCCLTVSNLKGMI-PPCPALTEITRTP-
t67             WETTKVV-EMVSGKSGAQINHTPQLPEQVI-PPCCLTVSNLKGMI-PPVPALTEITRTP-
t57             WETTKVV-EMVSGKSGAQINHTPQLPEQVI-PPCCLTVSNLKGMI-PPVPALTEITRTP-
t56             WETIKNV-EMVSGKAGKQINHEPQLPEQVI-PPCSLTVSNLKGMM-PPCPAMTEITRTV-
t13             WENVRNF-EMVSGRAGAHINHIPQLPEQAY-PPCKLTVSNLKGVA-ASCPAITEITRTA-
t5              WENVRNF-EMVSGRAGAHINHIPQLPEQAY-PPCVLTVSNLKGVA-ASCPAITEITRTA-
t38             WENIRNF-EMVSGRAGAYINHIPQLPEQAV-PPCHLTVSNLKGVA-ASCPAITEITRTA-
t33             WENIRNF-EMVSGRAGAHINHIPQLPEQAC-PPCVLTVSNLKGVA-ASCPAITEITRTA-
t100            WENIRNF-EMVSGRAGAHINHIPQLPEQAC-PPCVLTVSNLKGVA-ASCPAITEITRTA-
t34             WENIRNF-EMVSGRAGAHINHIPQLPEQAC-PPCVLTVSNLKGVA-ASCPAMTEITRTA-
t84             WENIRNF-EMVSGRAGAHINHIPQLPEQAC-PPCVLTVSNLKGVA-ASCPAMTEITRTA-
t92             WENIRNF-EMVSGRAGAHINHIPQLPEQAC-PPCVLTVSNLKGVA-ASCPAMTEITRTA-
t3              WENICNF-EMMSGRTGAQINHIPQLPEQVC-PPCHLTVSNLKGCC-ASVPAITEITRTV-
t22             WENVCNF-EMMSGRAGAQINHIPQLPEQVC-PPCVLTVSNLKGCC-ASCPANTEITRTV-
t64             WENARNF-EMMSGRAGAEINH-PQLPEQVC-PPCHLTVSNLKGVC-ASCPAITEITRTV-
t18             WENARNF-EMMSGRAGAEINH-PQLPEQVC-PPCHLTVSNLKGVC-ASCPAITEITRTV-
t68             WENARNF-EMMSGRAGAEINH-PQLPEQVC-PPCHLTVSNLKGVC-ASCPAITEITRTV-
t28             WENVRNF-EMMSGRAGAQINH-PQLPEQVC-PPCHLTVSNLKGVC-ASCPDITEITRTV-
t82             WENVRNF-EMMSGRAGAQINH-PQLPEQVC-PPCHLTVSNLKGVC-ASCPDITEITRTV-
t41             WENVRNF-EMMSGRAGAQINH-PQLPEQVC-PPCHLTVSNLKGVC-ASCPDITEITRTV-
t71             WENVRNF-EMMSGRAGAQINH-PQLPEQVCNPPCHLTVSNLKGVC-ASCPAITEITRTV-
t94             WENVRNF-EMMSGRAGAQINH-PQLPEQVCNPPCHLTVSNLKGVC-ASCPAITEITRTV-
t99             WENVRNF-EMMSGRAGAQINH-PQLPEQVC-PPCHLTVSNLKGVC-ASCPAITEITRTV-
t40             WENVRNF-EMMSGRAGAQINH-PQLPEQVC-PPCHLTVSNLKGVC-ASVPAITEITRTV-
t90             WENVRNF-EMMSGRAGAQINH-PQLPEQVC-PPCHLTVSNLKGVC-ASVPAITEITRTV-
t4              WENVRNF-EMMSGRAGAQINH-PQLPEQVV-PPCHLTVSNLKGVC-ASCPAITEITRTV-
t36             WETLNVS-EMTSGRIGAKINHLPRLPEQVI-PPCMLTVSGLKDTM-AGMKQETEITKTPD
t87             WETLNVS-EMTSGRIGAKINHLPRLPEQVI-PPCMLTVSGLKDTM-AGMKQETEITKTPD
t89             WETLNVS-EMTSGRMGAKINHLPRLPEQVI-PPCMLTVSGLKDTM-AGMKQETEITKTPD
t39             WETLNVS-EMTSGRMGAKINHLPRLPEQVI-PPCMLTVSGLKDTM-AGMKQETEITKTPD
t8              WETLNVS-EMTSGRMGAKINHLPRLPEHVI-PPCMLTVSGLKDTM-AGMKQETEITKTPD
t6              WETLNVS-EMTSGRMGAKINHLPRLPEQVI-PPCMLTVSGLKDTM-AGMKQETEITKTPD
t58             WETLNVS-EMTSGRIGAKINHLPRLPETVI-PPCVLTVSGLKDTM-AGMKHGTEITKTPD
t54             WETLNVS-EMTSGRIGAKINHLPRLPETVI-PPCVLTVSGLKDTM-AGMKHGTEITKTPD
t65             WETLVYC-EMTSGRIGAKINHLPRLPEQVT-PPCILTVSGLKRTV-AGAPDETEITKSPV
t29             WETLVYC-EMTSGRIGAKINHLPRLPEQVT-PPCILTVSGLKRTV-AGAPDETEITKSPV
t98             WETLVYC-EMTSGRIGAKINHLPRLPEQVT-PPCDLTVSGLKRTV-AGPPDETEITKSPV
t83             WETLVYC-EMTSGRIGAKINHLPRLPEQVT-PPCILTVSGLKRTI-AGAPDETEITKSPV
t95             WETLVYC-EMTSGRIGAKVNHLPRLPEQVT-PPWVLTVSGLKRTV-AGAPDETEITKSPI
t20             WETLVYC-EMTSGRIGAKINHLPRLPEQVT-PPWVLTVSGLKRTV-AGAPDETEITKSPI
t69             WETLVYV-EMASGRIGAKINHQPRLPEQVI-PPCILTVSGLKRTI-ADEPDETEITKTPI
t2              WETLVYV-EMASGRIGAKINHMPRLPEQVI-PPCILTVSGLKRTI-ADEPDETEITKTPI
t10             WETLVYV-EMASGRIGAKINHMPRLPEQVI-PPCILTVSGLKRTI-ADEPDETEITKTPI
t31             WETLVYC-EMTSGRIGANINHLPRLPEQVV-PPCILTVSGLKRTI-AGSPDETEITKTLI
t15             WETLVYC-EMTSGRIGAKINHLPRLPEQVV-PPCILTVSGLKRTI-AGAPDETEITKTLI
t63             WETLVYC-EMTSGRIGAKINHQPRLPEQVV-PPCVLTVSGLKRTI-AGAPDETEITKTLI
t50             WETLVYC-EMTSGRIGAKINHQPRLPEQVV-PPCILTVSGLKRTI-AGAPDETEITKTLI
t25             WEALVYC-EMTSGRTGAKINHQPRLPEQVV-PPCILTVSGLKRTI-AGAPDETEITKTLI
t51             WETLVYC-EMTSGRIGAKINHLPRLPEQVF-PPCILTVSGLKRTI-AGAPDETEITKTLI
t9              WETLVLC-EMTSGRCGAKMNHLPRLFEQVC-PPCILTVSGLKETK-AGLIDGTEITKTPD
t47             WETLVLC-EMTSGRCGAKMNHLPRLFEQVC-PPCILTVSGLKETK-AGIIDGTEITKTPE
t60             WETLVLC-EMTSGRCGAKMNHLPRLFEQVC-PPCILTVSGLKETR-AGIIEGTEITKTPD
t30             WETLVLC-EMTSGRCGAKMNHLPRLFEQVC-PPCILTVSGLKETR-AGIIDGTEITKTPD
t70             WETLVLC-EMTSGRSGAKMNHLPRLFEQVC-PPCLLTVSGLKETV-AGIIDGTEITKTPE
t91             WETLVLC-EMTSGRSGAKMNHLPRLFEQVC-PPCLLTVSGLKETV-AGIIDGTEITKTPE
t49             WETLVLC-EMTSGRVGARMNHLPRLFEQVC-PPCILTVSGLKETV-AGVIDGTEITKTPE
t52             WETLILC-EMTSGRCGAKMNHMPRLFEQVC-PPCILTVSGLKETM-AGVIDGTEITKTPD
t43             WETLVTC-EMTSGRIGAKINHLPRLPEQVI-PPCVLTVSGLKQPM-AGYNDQTEITKTPD
t1              WETLITC-EMTSGRIGAKINHLPRLPEQVV-PPCILTVSGLKQPM-AGYNDETQITKTPD
t86             WETLVTC-EMTSGRIGAKINHLPRLPEQVI-PPCILTVSGLKQPM-AGYNDETQITKTPD
t72             WETLVTC-EMTSGRIGAKINHLPRLPEQVI-PPCILTVSGLKQPV-AGYNDETQITKTPD
t96             WETLVTC-EMTSGRIGAKINHLPRLPEQVI-PPCILTVSGLKQPM-AGYNMETQITKTPD
t44             WETLVTC-EMTSGRIGAKINHLPRLPEQVI-PPCILTVSGLKQPM-AGYNDETEITKTPD
t45             WETLVTC-EMTSGRIGAKINHLPRLPEQVI-PPCILTVSGLKQPM-AGFVDETEITKTPD
t74             WETLVTC-EMTSGRIGAKINHLPRLPEQVI-PPCILTVSGLKQPM-AGFVDETEITKTPD
t26             WETLVVC-EMTSGRIGAKINHLPRLPEQVI-PPCILTVSGLKQSV-SGYNDETEITKTPD
t61             WETLVVC-EMTSGRMGAKINHLPRLPEQVI-PPCILTVSGLKRAV-NGYNDETEITKTPD
t97             WETLVVC-EMTSGRIGAKINHLPRLPEQVI-PPCILTVSGLKQAV-NDCNDETEITKTPD
t17             WETLVVC-EMTSGRIGAKINHLPRLPEQVI-PPCMLTVSGLKQAM-AGVNDETEITKTPD
t11             WETLVVC-EMTSGRIGAKINHLPRLPEQVI-PPCMLTVSGLKQAM-AGVNDETEITKTPD
t23             WETANVC-EMSSGRSGAKINHNPRLPEQVT-PPRSLTVSGLKDTM-PGHPDVTEITKTPV
t76             KEFLQREDEMKAGLIGIICNHLSRMIMVIL-VHCLLTHAGLKSME-IGFDR-TGVVRMPL
t53             KEFLQREDEMKAGLIGIICNHLSRMIMVIL-VHCLLTHAGLKSME-IGFDR-TGVVRMPL
t16             KEFLQREDEMKAGLIGIICNHLSRMIMVIL-VHCLLTHAGLKSME-IGFDR-TGVVRMPL
t42             KEFLQREEDMKSGLIGIICNHISRMCMHIL-VVCLLTHCGLKAME-IPFDI-TGVVRGPL
t24             KEFLQREDDMKSGLIGIICNHISRMCMHIL-VHCLLTHCGLKAME-IPFDR-TGVVRGPL
                

t73             IQIAIRVSGSE-SENVVLQYCLYYEENKSIR-----------QNNTGSADLPK-------
t66             IQIAIRVSGSE-SENVVLQYCLYYEENKSIR-----------QNNTGSADLPK-------
t32             IQIAIRVSGSE-SENVVLQYCLYYEENKSIR-----------QNNTGSADLPK-------
t75             IQIPIRISGSE-SENVVLQYCLYYEENKSIR-----------QNNTGSAVLPK-------
t79             IRIKIREPGSE-SENTVVMYVIYYKERKSIR-----------QNNTGCAKLPQ-------
t27             IRIKIREPGSE-SENTVVMYVIYYKERKSIR-----------QNNTGCAKLPQ-------
t93             IRIKIREPGSE-SENTVVMYVIYYKERKSIR-----------QNNTGCAKLPQ-------
t59             IGIKIREPGSQ-SENTVVMYVIYYKERKSIR-----------QNNTGCAKLPQ-------
t7              IGIKIREPGSQ-SENTVVMYVIYYKERKSIR-----------QNNTGCAKLPQ-------
t78             IGIKIREPGSQ-SENTVVMYVIYYKERKSIR-----------QNNTGCAKLPQ-------
t12             IRIQIREPGSE-CENSVVMYVIYYKERKSIR-----------QNNTGCAKLPQ-------
t81             IRIQIRVPGSE-SENVVVMYMVYYKERKSIR-----------QNNTGCANLPQ-------
t21             IRIQIRVPGSE-SENITVMYMVYYKERKSIR-----------QNNTGCANLPQ-------
t80             IKIHIRVPGSQ-SENHVVMYCVYYKEHKSIR-----------QNNTGCANLPQ-------
t14             IKIHIRVPGSQ-SENHVVMYCVYYKEHKSIR-----------QNNTGCANLPQ-------
t85             IKIHIRIPGSQ-SENHVVMYCVYYKEHKSIR-----------QNNTGCANLPQ-------
t62             IRIHIRVPGSE-SENHVVMYCVYYKEHKSIR-----------QNNTGCANLPQ-------
t19             IRIHIRVPGSE-SENHVVMYCVYYKEHKSIR-----------QNNTGCANLPQ-------
t77             IRIHIRVPGSE-SENHVVMYCVYYKEHKSIR-----------QNNTGCANLPQ-------
t88             -FIV--MYYAI-LRNKIMQYCFYYKENRSVR-----------LNNTGRAELPK-------
t37             -FIV--MYVAI-LRNDIMQYCFYYKENRSVR-----------LNNTGRAELPK-------
t35             -FIV--MYVAI-LRNDIMQYCFYYKENRSVR-----------LNNTGRAELPK-------
t48             -FIV--MYVAI-LRNDIMQYCFYYKENRSVR-----------LNNTGRAELPK-------
t55             -FIV--MYVAI-LRNDIMQYCFYYKENRSVR-----------LNNTGRAELPK-------
t46             -FIM--MYVAM-LRNDIMQYCFYYKENRSVR-----------LNNTGRAELPK-------
t67             -FIV--MYVAI-LRNDIMQYCFYYKENRSVR-----------LNNTGRAELPK-------
t57             -FIV--MYVAI-LRNDIMQYCFYYKENRSVR-----------LNNTGRAELPK-------
t56             -III--MYYAI-LRNEIMQYCFYYKENRSVR-----------INNTGQAELPK-------
t13             -VIV--MYGSI-LRNDVMQYVFYYRENRSVR-----------QNNTGNAELPK-------
t5              -VIV--MYGSI-LRNDVMQYVFYYRENRSVR-----------QNNTGNAELPK-------
t38             -VIV--MYVSI-LRNDVMQYVFYYRENRIVR-----------QNNTGVAELPK-------
t33             -VIV--MYVSI-LRNDVMQYVFYYRENRIVR-----------QNNTGVAELPK-------
t100            -VIV--MYVSI-LRNDVMQYVFYYRENRIVR-----------QNNTGVAELPK-------
t34             -VIV--MYVSI-LRNDVMRYVFYYRENRIAR-----------QNNTGVAELPK-------
t84             -VIV--MYVSI-LRNDVMRYVFYYRENRIAR-----------QNNTGVAELPK-------
t92             -VIV--MYVSI-LRNDVMRYVFYYRENRIAR-----------QNNTGVAELPK-------
t3              -VIC--MYVSI-LCNVVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t22             -VIC--MYVSI-LRNVVMQYVFYYKENRSVR-----------QNNTGAAELPK-------
t64             -VIC--MYVSI-LRNDVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t18             -VIC--MYVSI-LRNDVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t68             -VIC--MYVSI-LRNDVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t28             -VIC--MYVSI-LRNDVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t82             -VIC--MYISI-LRNDVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t41             -VIC--MYISI-LRNDVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t71             -VIV--MWISI-LRNDVMQYVVYYKENRSVR-----------QNNTGKAELPR-------
t94             -VIV--MWISI-LRNDVMQYVFYYKENRSVR-----------QNNTGKAELPR-------
t99             -VIC--MYVSI-LRNDVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t40             -VIC--MYISI-LRNNVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t90             -VIC--MYISI-LRNNVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t4              -VIC--MYVSI-LRNVVMQYVFYYKENRSVR-----------QNNTGKAELPK-------
t36             IKIY--MWGTINFKNRVMQYCNYYKENRSVR-----------INNTGLAELPK-------
t87             IKIY--MWGTICFKNRVMQYCNYYKENRSVR-----------INNTGLAELPK-------
t89             IEIY--MWGTINFKNQVMQYCNYYKENRSVR-----------INNTGGAELPK-------
t39             IEIY--MWGTINFKNQVMQYCNYYKENRSVR-----------INNTGGAELPK-------
t8              IEIY--MWGTINFKNQVMQYCNYYKENRSVR-----------INNTGGAELPK-------
t6              IEIY--MWGTINFKNQVMQYCNYYKENRSVR-----------INNTGGAELPK-------
t58             IKIH--MWGTINFKNKVMQYCTYYKENRSVR-----------INNTGGAELPK-------
t54             IKIH--MWGTINFKNKVMQYCTYYKENRSVR-----------INNTGGAELPK-------
t65             IHIV--MWADIMFKNCVMQYCTYYKENRSVR-----------ANNTGGAELPK-------
t29             IHIV--MWADIMFKNCVMQYCTYYKENRSVR-----------ANNTGGAELPK-------
t98             IHIV--MWADIVFKNCVMQYCTYYKENRSVR-----------ANNTGGAELPK-------
t83             IHIV--MWADIMFKNCVMQYCTYYKENRSVR-----------ANNTGGAELPK-------
t95             IHII--MWEEIMFKNCVMQYCTYYKENRSVR-----------ANNTGGAELPK-------
t20             IHII--MWEDIMFKNCVMQYCTYYKENRSVR-----------ANNTGGAELPK-------
t69             IHIV--MWADIMFKNCVMQYCNYYKENRSVR-----------VNNTGGAELPK-------
t2              IHIV--MWADIMFKNCVMQYCNYYKENRSVR-----------VNNTGGAELPK-------
t10             IHIV--MWADIMFKNCVMQYCNYYKENRSVR-----------VNNTGGAELPK-------
t31             YHIV--MWADIMFKNCVMQYSTYYKENRSVR-----------ANNTGGAELPK-------
t15             YHIV--MWADIMFKNCVMQYSTYYKENRSVR-----------GNNTGGAELPK-------
t63             YHIV--MWADIMFKNCVMQYSTYYKENRSVR-----------VNNTGGAELPK-------
t50             YHIV--MWADIMFKNCVMQYSTYYKENRSVR-----------VNNTGGAELPK-------
t25             YHIV--MWADIMFKNCVMQYSTYYKENRSVR-----------VNNTGGAELPK-------
t51             YHIV--MWADIMFKNCVMQYATYYKENRSVR-----------VNNTGGAELPK-------
t9              IGIC--MWETIHFKNPVMQYCCYYKENRSVR-----------VNNTGGAALPK-------
t47             IGIC--MWDTIEFKNPVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t60             IGIC--MWDTIHFKNPVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t30             IGIC--MWDTIHFKNPVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t70             IGIC--MWDTIHFKNPVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t91             IGIC--MWDTIHFKNPVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t49             IGIC--MWDTIHFKNPVMQYCCYYKEPRSVR-----------VNNTGGAELPK-------
t52             IGIG--MWDSIHFKNPVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t43             ICIC--TWGTIHFKNFVMQYCVYYKENRSVR-----------VNNTGGAELPQ-------
t1              ICIC--TWGTIHFKNSVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t86             ICIC--GVGTIHFKNLVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t72             ICIC--TWGTIHFKNSVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t96             ICIC--TWGTIHFKNSVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t44             ICIC--TWGTIHFKNSVMQYCCYYKENRSVR-----------VNNTGGAELPK-------
t45             ICIC--TWGTIHFKNSVVQYCCYYKENRSVR-----------VNNTGGAELPK-------
t74             ICIC--TWGTIHFKNSVVQYCCYYKENRSVR-----------VNNTGGAELPK-------
t26             IKIC--TWGTIHFKNSVMQYCCYYKENRSVR-----------LNNTGGAELPK-------
t61             IKIC--TWGTIHFKNSVMQYCCYYKENRSVR-----------FNNTGGAELPK-------
t97             IKIC--TWPTIHFKNGMMQYCCYYKENRSVR-----------FNNTGGAELPK-------
t17             IKIC--TWGTIHFKNFVMQYCVYYKENRSVR-----------FNNTGGAELPK-------
t11             IKIC--TWGTIHFKNFVMQYCVYYKENRSVR-----------FNNTGGAELPK-------
t23             IAIV--MWGTINLKNHVMQYCCYYKETRSVR-----------VNNTGGAELPK-------
t76             IAEP--LYLVI-YVNAVEPYTDAYKKPKSMHQFQFDDCQIRYRTNTGFEETPVGATHLTH
t53             IAEP--LYLVI-YVNAVEPYTDAYKKPKSMHQFQFDDCQIRYRTNTGFEETPMGATHLTH
t16             IAEP--LYLVI-YVNAVEPYTDAYKKPKSMHQFQFDDCQIRYRTNTGFEETPMGATHLTH
t42             ITEP--LYLII-YVNAVEPYTDAYKKPKSMHQFQFDDVQIRYRTNTGFEENPKLATHLVH
t24             IAEP--LYLII-YVNAVEPYTDAYKKPKSMHQFQFDDVQIRYRTNTGFEENPKLATHLVH
                

t73             --------------DRLVNSFVD-ELYNSI---YTAAPKKK--RHL-GIGDNGGMELVRE
t66             --------------DRLVNSFVD-ELYNSI---YTAAPKKK--RHL-GIGDNGGMELVRE
t32             --------------DRLVNSFVD-ELYNSI---YTAAPKKK--RHL-GIGDNGGMELVRE
t75             --------------DRLVNNFVD-ELYNSV---YTAAPKKK--RHL-GIGDNGGMELVRE
t79             --------------ARLVNKVVD-ELYNNV---YHAIPKKE--MNQ-GVGDSGGVEMVQE
t27             --------------ARLVNKVVD-ELYNNV---YHAIPKKD--MNQ-GVGDSGGVEMVQE
t93             --------------ARLVNKVVD-ELYNNV---YHAIPKKD--MNQ-GVGDSGGVEMVQE
t59             --------------HRLVNKVVD-ELYNNV---YHAIPKKD--MNQ-GVGDSGGVEMVQE
t7              --------------HRLVNKVVD-ELYNNP---YHAIPKKD--MNQ-GVGDSGGIEMVQE
t78             --------------HRLVNKVVD-ELYNNP---YHAIPKKD--MNQ-GVGDSGGIEMVQE
t12             --------------HRLVNKVVD-ELYNNV---YHAIPKKD--INV-GVGDSGGMEVVQE
t81             --------------HRLVVKVAD-ELYNNI---YHAIPKKD--GVLLGIGDSGGMEMVQE
t21             --------------HRLVVKVAD-ELYNNI---YHAIPKKD--GVLLGIGDSGGMEMAQE
t80             --------------HRLVDQVVD-ELYSKF---YHAIPKKP--GNM-GVGDSGGMEMVQE
t14             --------------HRLVDQVVD-ELYSKF---YHAIPKKP--GNM-GVGDSGGMEMVQE
t85             --------------HRLVDKVVD-ELYSKF---YHAIPKKP--GNM-GIGDSGGMEMVQE
t62             --------------HRLVDRVVD-ELYSKF---YHAIPKKP--GNM-DVGDSGGMEMVME
t19             --------------HRLVDKVVD-ELYSKF---YHAIPKKP--GNM-DVGDSGGMEMVME
t77             --------------HRLVDKVVD-ELYSKF---YHAIPKKP--GNM-DVGDSGGMEMVME
t88             --------------HHMQNIFID-ELYPGG---YHAAPKKE--EMV-GPGDNGGVEDIKE
t37             --------------HHMQNIFID-ELYPGP---YHAAPKKE--ELM-SPGDNGGVEAIRE
t35             --------------HHMQNIFID-ELYPGP---YHAAPKKE--ELM-SPGDNGGVEAIRE
t48             --------------HHMQNIFID-ELYPGP---YHAAPKKE--ELM-SPGDNGGVEAIRE
t55             --------------HHMQNIFID-ELYPGP---YHAAPKKE--ELM-SPGDNGGVEAIRE
t46             --------------HHMQNIFID-ELYPGP---YHAAPKKE--ELM-APGDNGGVEAIRE
t67             --------------HHMQNIFID-ELYPGP---YHAAPKKE--ELM-APGDNGGVEAIRE
t57             --------------HHMQNIFID-ELYPGP---YHAAPKKE--ELM-APGDNGGVEAIRE
t56             --------------HHVQNVFID-ELYPGH---YHAAPKKN--ENV-GPGDNGGVEGIKE
t13             --------------HHMQDVFID-ELYLGP---YHASPKKD--RFC-NPGDNGGMETYQE
t5              --------------HHMQDVFID-ELYLGP---YHASPKKD--RFC-NPGDNGGMDTYQE
t38             --------------HHMQDVFID-ELYLGP---YHASPKKE--RFC-NVGDNGGMETIQE
t33             --------------HHMQDVFID-ELYLGP---YHASPKKE--RFC-NPGDNGGMETIQE
t100            --------------HHMQDVFID-ELYLGP---YHASPKKE--RFC-NPGDNGGMETIQE
t34             --------------HHMQDIFID-ELYLGP---YHASPKKQ--RFC-NPGENGGMETIRE
t84             --------------HHMQDIFID-ELYLGP---YHASPKKE--RFC-NPGENGGMETIRE
t92             --------------HHMQDIFID-ELYLGP---YHASPKKE--RFC-NPGENGGMETIRE
t3              --------------HHMQDIFID-ELYPGQ---YHASPKKK--KIC-GPGDNGGMETIEE
t22             --------------HHMQDIFID-ELYPGL---YHASPKKK--KVC-GPGDNGGMETIQE
t64             --------------HHMQDIVID-ELYPGP---YHATPKKH--RFC-GTGDNGGMQAIQE
t18             --------------HHMQDIFID-ELYPGP---YHATPKKH--RFC-GTGDNGGMQAIQE
t68             --------------HHMQDIFID-ELYPGP---DHATPKKH--RFC-GTGDNGGMQTIQE
t28             --------------HHMQDIFID-ELYPGH---YHATPKKN--RYC-GPGDNGGMQVIEE
t82             --------------HHMQDIFID-ELYPGH---YHATPKKN--RFC-GPGDNGGMQVIEE
t41             --------------HHMQDIFID-ELYPGH---YHATPKKN--RFC-GPGDNGGMQVIEE
t71             --------------HPMQEIFID-ELYPGH---YHATPKKN--RFC-GPGDNGGMQSMQE
t94             --------------HPVQDIFID-ELYPGH---YHATPKKV--RFC-GPGDNGGMQAIQE
t99             --------------HHMQDIFID-ELYPGR---YHATPKKN--RYC-GPGDNGGMQPIQE
t40             --------------HHMQDIFID-ELYPGH---YQATPKKD--KFC-GPGDNGGMQTIQE
t90             --------------HHMQDIFID-ELYPGH---YHATPKKD--KFC-GPGDNGGMQTIQE
t4              --------------HHMQDIFID-ELYPGH---YHATPKKN--RCC-GPGDNGGMQTVQE
t36             --------------YHHQNILID-ELYSNV---YPAAPKKH--QYM-GVGDVGGYEVICE
t87             --------------YHHQNILID-ELYSNV---YPAAPKKH--QYM-GVGDVGGYEMICE
t89             --------------YHHQNILID-ELYNNI---YPAAPKKH--KFL-GVGDVGGYEIICE
t39             --------------YHHQNILID-ELYNNI---YPAAPKKH--KFL-GVGDVGGYEIICE
t8              --------------YHHQNILID-ELYNDI---YPAAPKKH--KFL-GVGDVGGYEIICE
t6              --------------YHHQNILID-ELYNNI---YPAAPKKH--KFL-GVGDVGGYEIICE
t58             --------------YHHQNILID-ELYSNI---YPATPKKH--QYM-GVGDVGGYEVICE
t54             --------------YHHQNILID-ELYSNI---YPATPKKH--QYM-GVGDVGGYEVICE
t65             --------------YHQQNILTD-ELYSDV---YPAAQKKY--QVM-GVGDIGGYELICE
t29             --------------YHQQNILTD-ELYSDL---YPAAPKKY--QEM-GVGDIGGYELIVE
t98             --------------YHQQNLLTD-ELYSDI---YPAAPKKY--QVM-GVGDIGGYELIVE
t83             --------------YHQQNLLTD-ELYSDI---YPAAPKKY--QVM-GVGDIGGYELIVE
t95             --------------YHQQNILTD-ELYSDI---YPAAPKKY--QVM-GVGDIGGYELICE
t20             --------------YHQQNILTD-ELYSDI---YPAAPKKY--QVM-GVGDIGGYELICE
t69             --------------YHQQNILTD-ELYSDI---YPAAPKKY--QIM-GVGDIGGYELICE
t2              --------------YHQQNILTD-ELYSDI---YPAAPKKY--QIM-GVGDIGGYELICE
t10             --------------YHQQNILTD-ELYSDI---YPAAPKKY--QIM-GVGDIGGYELICE
t31             --------------YHQQNILTD-ELYSDM---YPAAPKKYVIRVM-GVGDIGGYEMICE
t15             --------------YHQQNILTD-ELYSDV---YPTAPKKYVIRVM-GVGDIGGYELICE
t63             --------------YHQQNILTD-ELYSDM---YPAAPKKYVIRQM-GMGDIGGYELICE
t50             --------------YHQQNILTD-ELYSDM---YPAAPKKYVIRQM-GMGDIGGYELICE
t25             --------------YHQQNILTD-ELYSDM---YPAAPKKYVIRQM-GMGDIGGYELICE
t51             --------------YHQQNILTD-ELYSDM---YPAAPKKYVIREM-GVGDIGGYELICE
t9              --------------YHHQNTLVD-ELYSDV---YPAAPKKK--VCM-GVGDVGGYEVMGE
t47             --------------YHHQNTLVD-ELYSDI---YPAAPKKK--VCM-GVGDVGGYEVMGE
t60             --------------YHHQNTLVD-ELYSDI---YPAAPKKK--VCM-GVGEVGGYEVMGE
t30             --------------YHDQNTLVD-ELYSDV---YPAAPKKK--VCM-GVGDVGGYEVMGE
t70             --------------YHNQNTLVD-ELYSDV---YPAAPKKQ--HYM-GVGDVGGYEVMGE
t91             --------------YHNQNTLVD-ELYSDV---YPAAPKKQ--HYM-GVGDVGGYEVMGE
t49             --------------YHNFNALVD-ELYSDV---YPAAPKKK--HYM-GVGDVGGYEVMGE
t52             --------------YHHQNSLVD-ELYSDV---YPAAPKKK--HYM-GVGDVGGYEVMGE
t43             --------------YHHQNILVD-ELYSDM---YPAAPKKK--HYV-GAGDVGGYEVMSE
t1              --------------YHHQNILVD-ELYSDM---YPAAPKKK--HYV-GAGDVGGYEVMSE
t86             --------------YHHQNILVD-ELYSDM---YPAAPKKK--HYV-GAGDVGGYEVMSE
t72             --------------YHHQNILVD-ELYSDM---YPAAPKKK--HYV-GAGDVGGYEVMSE
t96             --------------YHHQNILVD-ELYSDV---YPAAPKKK--HYV-GAGDVGGYEVMSE
t44             --------------YHHQNMLVD-ELYSDM---YPAAPKKK--VYV-GAGDVGGYEVMSE
t45             --------------YHHQNILVD-ELYSDM---YPAAPKKK--HYV-GAGDVGGYEVMSE
t74             --------------YHHQNILVD-ELYSDM---YPAAPKKK--HYV-GAGDVGGYEVMSE
t26             --------------YHHQNVLVD-ELYGEA---YPAAPKKK--HYM-GAGDVGGYEVMSE
t61             --------------YHHQNVLVD-ELYSEL---YPAAPKKA--HYM-GAGDIGGYEVMSE
t97             --------------YHHQNVLVD-ELYSEV---YPAAPKKA--FYM-GAGDIGGYEVMSE
t17             --------------YHHQNALVD-ELYSDV---YPAAPKKK--HYM-GEGDVGGYEVMSE
t11             --------------YHHQNVLVD-ELYSDG---YPAAPKKK--HYM-GEGDVGGYEVMSE
t23             --------------YHYQNILVD-ELYSND---YPAAPKKA--QFM-GVGDVGGYEIVCE
t76             VCVCVPHPWTKGKSEILQNMGSA-VLYNDVIRDHNASEQKE--AHV-PMGDEGRISRAKD
t53             VCVCVPHPWTKGKSEILQNMGSA-VLYNDVIRDHNASEQKE--AHV-PMGDQGRISRAKD
t16             VCVCVPHPWTKGKSEILQNMGSA-VLYNDVIRDYNASEQKE--AHV-PMGDQGRISRAKD
t42             VCVVVPHPWTKGKSEILQNMESA-HLYNAVIRDNNASEQKE--AHV-PVGDEGRISRAKN
t24             VCVVVPHPWTKGKSEILQNMESARHLYNAVIRDNNASHQKE--AHV-PAGDQGRISRAKN
                

t73             DIFQILVCV
t66             DIFQILVCV
t32             DIFQILVCV
t75             DIFQILVCV
t79             DVFQILVCI
t27             DVFQILVCI
t93             DVFQILVCI
t59             DVFQILVCI
t7              DVFQILVCI
t78             DVFQILVCI
t12             DVFQILVCI
t81             DLFQILVCA
t21             DLFQILVCV
t80             DVFQILVCL
t14             DVFQILVCL
t85             DLFQILVCI
t62             DVFQILVCV
t19             DVFQILVCV
t77             DVFQILVCA
t88             DMFQVLVCR
t37             DMFQVLVCK
t35             DMFQVLVCK
t48             DMFQVLVCK
t55             DMFQVLVCK
t46             DMFQVLVCK
t67             DMFQVLVCK
t57             DMFQVLVCK
t56             DMFQVLVCQ
t13             DMFQVLVCV
t5              DMFQVLVCV
t38             DMFQVLVCI
t33             DMFQVLVCV
t100            DMFQVLVCV
t34             DMFQVLVCV
t84             DMFQVLVCV
t92             DMFQVLVCV
t3              DMFQVLVCV
t22             DMFQVLVCV
t64             DMFQVLVCV
t18             DMFQVLVCV
t68             DMFQVLVCV
t28             DMFQVLVYV
t82             DMFQVLVYV
t41             DMFQVLVYV
t71             DVFQVLVCV
t94             DVFQVLVCV
t99             DMFQVLVCV
t40             DMFQVLVCV
t90             DMFQVLVCV
t4              DMFQVLVCV
t36             NLFQILVVE
t87             NLFQILVVE
t89             NLFQILVVE
t39             NLFQILVVE
t8              NLFQILVVE
t6              NLFQILVVE
t58             NLFQILVVE
t54             NLFQILVVE
t65             DLFQILVCQ
t29             DLFQILVCE
t98             DLFQILVCE
t83             DLFQILVCE
t95             DLFQILVCE
t20             DLFQILVCE
t69             DLFQILVCE
t2              DLFQILVCE
t10             DLFQILVCE
t31             DLFQILVCE
t15             DLFQILVCQ
t63             DLFQILVCE
t50             DLFQILVCE
t25             DLFQILVCE
t51             DLFQILVCE
t9              DLFQILVCE
t47             DLFQILVCE
t60             DLFQILVCE
t30             DLFQILVCE
t70             DLFQILVCE
t91             DLFQILVCE
t49             DLFQILVCE
t52             DLFQILVCE
t43             DLFQILVHE
t1              DLFQILVHE
t86             DLFQILVHE
t72             DLFQILVHE
t96             DLFQILVHG
t44             DLFQILVHA
t45             DLFQILVHE
t74             DLFQILVHE
t26             DLFQILVHE
t61             DLFQILVHE
t97             DLFQILVHK
t17             DLFQILVHA
t11             DLFQILVHA
t23             DIFQILVCD
t76             EIMYIRDLE
t53             EIMYIRDLE
t16             EIMYIRDLE
t42             EILYIRDLE
t24             EILYIRDLE