File: test.fasta

package info (click to toggle)
metastudent 2.0.1-8
  • links: PTS, VCS
  • area: main
  • in suites: bullseye, sid
  • size: 95,636 kB
  • sloc: java: 3,287; perl: 2,089; python: 1,423; ruby: 242; sh: 39; makefile: 19
file content (6 lines) | stat: -rw-r--r-- 1,501 bytes parent folder | download | duplicates (3)
1
2
3
4
5
6
>0000 bla
MATAEIEEIPALLKPGQTVAGLDLGTKTIGLAVSDLGLSFAHPRPVIKRVKFTIDAQVLLKALETDKVGVIMIGLPMNMDGTAGPRVQATRAFVRTMQPLTDLPFVFWDERLSTVAAERALIGMDVSRGKRADRIDSAAAAFILQGALDRLHMMRRNDYDAG
>0001 blubb
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAEREDSDGQGNHRENSPFLCPLDASRGNDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGGRRRAAKAPSMGTLMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVVPAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFYPSGTHDMSSATLNNMRVYGTIFLTLMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIFDPPVFPVCMLGNRTLSRDQFDICAKTVVVDNETVATRLWTFFCHSPNLTADSCDPYFLLNNVTEIPGIPGAAAGVLQENLWSAYLEKGEVVEKHGLPSTDTLGLKESLSLYVVADIATSFTVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIEGVVLRDKYGDGVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHGKANGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKYYHWTLSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKAGKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMDIEKVKGFCQVVVASKVREGLAHLIQSCGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHERYLDGHIDVWWIVHDGGMLMLLPFLLRQHKVWKKCRMRIFTVAQMDDNSIQMKKDLAIFLYHLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRLTKTERDREAQLVKDRHSALRLESLYSDEEEESVAGADKIQMTWTRDKYMAEPWDPSHAPDNFRELVHIKPDQSNVRRMHTAVKLNEVIVTRSHDARLVLLNMPGPPKNSEGDENYMEFLEVLTEGLERVLLVRGGGREVITIYS
>0002 adsdj jsjdha sdhjska hdjh asjkhd js khdj hasjkdhasjkhd jhasdjh akjshd kja dh
MTESTKIKYCRADSGSGSKPLSAETKTRLMADGKKIDEEKKDGTAVRRVLFWFAVLVIRFALLMAMHYYHDVTSSRCDGARAGGARTGRSALSRVRGRRRGGGTPDTRPYCDSGTACLDFRKGGCNHGDACEFAHGVFDNSSADLA