1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483
|
ID CVPBR322 standard; circular DNA; SYN; 4361 BP.
XX
AC J01749; K00005; L08654; M10282; M10283; M10286; M10356; M10784;
AC M10785; M10786; M33694; V01119;
XX
DT 16-JUN-1990 (Rel. 24, Created)
DT 02-AUG-1995 (Rel. 44, Last updated, Version 20)
XX
DE Cloning vector pBR322, complete genome.
XX
KW ampicillin resistance; beta-lactamase; cloning vector;
KW drug resistance protein; origin of replication; plasmid;
KW tetracycline resistance.
XX
OS Cloning vector
OC Artificial sequences; Cloning vectors.
XX
RN [1]
RP 1-3, 3259-4361
RX MEDLINE; 79012484.
RA Sutcliffe J.G.;
RT "Nucleotide sequence of the ampicillin resistance gene of
RT Escherichia coli plasmid pBR322";
RL Proc. Natl. Acad. Sci. U.S.A. 75:3737-3741(1978).
XX
RN [2]
RP 1-4361
RX MEDLINE; 80002802.
RA Sutcliffe J.G.;
RT "Complete nucleotide sequence of the Escherichia coli plasmid
RT pBR322";
RL Cold Spring Harb. Symp. Quant. Biol. 43:77-90(1979).
XX
RN [3]
RP 1500-2300
RX MEDLINE; 80056597.
RA Reed R.R., Young R.A., Steitz J.A., Grindley N.D.F., Guyer M.;
RT "Transposition of the Escherichia coli insertion element gamma
RT generates a five-base-pair repeat";
RL Proc. Natl. Acad. Sci. U.S.A. 76:4882-4886(1979).
XX
RN [4]
RP 2207-2265
RX MEDLINE; 81213464.
RA Covarrubias L., Cervantes L., Covarrubias A., Soberon X.,
RA Vichido I., Blanco A., Kupersztoch-Portnoy Y.M., Bolivar F.;
RT "Construction and characterization of new cloning vehicles: V.
RT Mobilization and coding properties of pBR322 and several deletion
RT derivatives including pBR327 and pBR328";
RL Gene 13:25-35(1981).
XX
RN [5]
RP 2000-2500
RX MEDLINE; 82167416.
RA Marians K.J., Soeller W., Zipursky S.L.;
RT "Maximal limits of the Escherichia coli replication factor Y
RT effector site sequences in pBR322 DNA";
RL J. Biol. Chem. 257:5656-5662(1982).
XX
RN [6]
RP 1-80, 4151-4229, 4349-4361
RX MEDLINE; 82239419.
RA Brosius J., Cate R.L., Perlmutter A.P.;
RT "Precise location of two promoters for the beta-lactamase gene of
RT pBR322 : S1 mapping of ribonucleic acid isolated from Escherichia
RT coli or synthesized in vitro";
RL J. Biol. Chem. 257:9205-9210(1982).
XX
RN [7]
RP 4241-4343
RX MEDLINE; 83039392.
RA Van dyke M.W., Hertzberg R.P., Dervan P.B.;
RT "Map of distamycin, netropsin, and actinomycin binding sites on
RT heterogeneous DNA: Dna cleavage-inhibition patterns with
RT methidiumpropyl-EDTA.Fe(II)";
RL Proc. Natl. Acad. Sci. U.S.A. 79:5470-5474(1982).
XX
RN [8]
RP 584-709
RX MEDLINE; 83117649.
RA Peden K.W.C., Nathans D.;
RT "Local mutagenesis within deletion loops of DNA heteroduplexes";
RL Proc. Natl. Acad. Sci. U.S.A. 79:7214-7217(1982).
XX
RN [9]
RP 373-649
RX MEDLINE; 83263146.
RA Peden K.W.C.;
RT "Revised sequence of the tetracycline-resistance gene of pBR322";
RL Gene 22:277-280(1983).
XX
RN [10]
RP 132-181
RX MEDLINE; 83161053.
RA Watabe H.o., Iino T., Kaneko T., Shibata T., Ando T.;
RT "A new class of site-specific endo-deoxyribonucleases: Endo.Sce I
RT isolated from a eukaryote, Saccharomyces cerevisiae";
RL J. Biol. Chem. 258:4663-4665(1983).
XX
RN [11]
RP 368-581
RX MEDLINE; 83117828.
RA Livneh Z.;
RT "Directed mutagenesis method for analysis of mutagen specificity:
RT Application to ultraviolet-induced mutagenesis";
RL Proc. Natl. Acad. Sci. U.S.A. 80:237-241(1983).
XX
RN [12]
RP 2627-2682, 2781-2828
RX MEDLINE; 84070716.
RA Mascharak P.K., Sugiura Y., Kuwahara J., Suzuki T., Lippard S.J.;
RT "Alteration and activation of sequence-specific cleavage of DNA by
RT bleomycin in the presence of the antitumor drug
RT cis-diamminedichloroplatinum(II)";
RL Proc. Natl. Acad. Sci. U.S.A. 80:6795-6798(1983).
XX
RN [13]
RP 4276-4336
RX MEDLINE; 84070724.
RA Schultz P.G., Dervan P.B.;
RT "Sequence-specific double-stranded cleavage of DNA by
RT penta-N-methylpyrrolecarboxamide-EDTA.Fe(II)";
RL Proc. Natl. Acad. Sci. U.S.A. 80:6834-6837(1983).
XX
RN [14]
RP 518-528
RA Sutcliffe J.G.;
RT ;
RL Unpublished.
XX
RN [15]
RP 2395-2495
RX MEDLINE; 85024881.
RA Fuller R.S., Funnell B.E., Kornberg A.;
RT "The dnaA protein complex with the E. coli chromosomal replication
RT origin (oriC) and other DNA sites";
RL Cell 38:889-900(1984).
XX
RN [16]
RP 2729-2731
RX MEDLINE; 84207440.
RA Lathe R., Kieny M.P., Skory S., Lecocoq J.P.;
RT "Laboratory methods linker tailing: Unphosphorylated linker
RT oligonucleotides for joining DNA termini";
RL DNA 3:173-182(1984).
XX
RN [17]
RC bases
RX MEDLINE; 84260952.
RA Heusterspreute M., Davison J.;
RT "Restriction site bank vectors. II. DNA sequence analysis of
RT plasmid pJRD158";
RL DNA 3:259-268(1984).
XX
RN [18]
RP 2113-2186, 2348-2415
RX MEDLINE; 85054885.
RA Abarzua P.I., Soeller W., Marians K.J.;
RT "Mutational analysis of the primosome assembly sites: I. Distinct
RT classes of mutants in the pBR322 Escherichia coli factor Y DNA
RT effector sequences";
RL J. Biol. Chem. 259:14286-14292(1984).
XX
RN [19]
RP 2348-2415
RX MEDLINE; 85054886.
RA Soeller W., Abarzua P.I., Marians K.J.;
RT "Mutational analysis of primosome assembly sites: II. Role of
RT secondary structure in the formation of active sites";
RL J. Biol. Chem. 259:14293-14300(1984).
XX
RN [20]
RP 1-4361
RX MEDLINE; 84300294.
RA Van Dyke M.M., Dervan P.B.;
RT "Echinomycin binding sites on DNA";
RL Science 225:1122-1127(1984).
XX
RN [21]
RA Pouwels P.H., Enger-Valk B.E., Brammar W.J.;
RT "Vector I-A-iv-1";
RL (in) Brammar W.J. (eds.);
RL CLONING VECTORS:1-1;
RL Elsevier Scientific Publishing, Amsterdam (1985)
XX
RN [22]
RP 1-4361
RX MEDLINE; 89108024.
RA Watson N.;
RT "A new revision of the sequence of plasmid pBR322";
RL Gene 70:399-403(1988).
XX
RN [23]
RA Gilbert W.;
RT "Obtained from VecBase 3.0";
RL Unpublished.
XX
CC The circular sequence is numbered such that 0 is the middle of the
CC unique EcoRI site and the count increases first through the tet
CC genes, the pMB1 material, and finally through the Tn3 region.
CC Plasmid pBR322 contains ampicillin and tetracycline resistance
CC genes. The ampicillin resistance gene (amp-r) is a penicillin
CC beta-lactamase. Promoters P1 and P3 are for the beta-lactamase
CC gene. P3 is the natural promoter, and P1 is artificially created by
CC the ligation of two different DNA fragments to create pBR322. P2 is
CC in the same region as P1, but it is on the opposite strand and
CC initiates transcription in the direction of the tetracycline
CC resistance gene. Mutational studies in the primosome assembly sites
CC indicate four types of mutations: Class I having no effect on the
CC activities elicited by the DNA site and the bases involved are
CC probably spacers; Class II requiring higher Mg-2+ concentrations
CC than the wild-type to be fully activated as factor Y ATPase
CC effectors; Class III co-inactivating both the ATPase effector and
CC DNA replication template activity of the site, indicating that they
CC probably represent essential contact points between factor Y and
CC the DNA; Class IV having a replication template activity
CC intermediate that of class III and class II mutant DNAs. Specific
CC sites within or near the origins of replication are recognized by
CC dnaA protein. Without dnaA binding to the origin of replication
CC chromosomal replication is not possible [15]. pBR322 DNA contains
CC two separate regions on opposite strands and close to the origin of
CC replication which, when in single-stranded form, can act as
CC effectors for the ATPase activity of E.coli replication factor Y
CC [5]. Small fragments of DNA containing these sites when cloned in
CC an f1 phage vector act as origins of DNA replication allowing the
CC formation of complementary double-stranded DNA in
CC rifampicin-resistant, dna[B,G,C]-dependent fashion in vitro [5].
CC The biological activity of echinomycin is thought to be related to
CC the formation of complexes by intercalating with cellular DNA [20].
CC Complete source information: Plasmid pBR322 from E.coli
CC [2],[1],[3],[6],[11],[8],[5],[7],[12],
CC [13],[10],[9],[14],[18],[19],[15],[20],[16]; pBR322 DNA in pXf3
CC [4]. The following data and their annotation were supplied by Will
CC Gilbert under the auspices of the Curator Program. CROSSREFERENCE
CC #parent GenBank(50):pSC101C, GenBank(50):Trn3 #offspring
CC VecBase(3):pBR325, VecBase(3):pBR327, VecBase(3): pBR328,
CC VecBase(3):pAT153, VecBase(3):pUC7, VecBase(3): pJRD158,
CC VecBase(3):PiVX, VecBase(3):PiAN7, VecBase(3): pSP64,
CC VecBase(3):pSP65, VecBase(3):pGEM1, VecBase(3): pGEM2,
CC VecBase(3):pGEM3, VecBase(3):pGEM4, VecBase(3): pKK223,
CC VecBase(3):pLBU3, VecBase(3):pTrS3, VecBase(3): pRSVNeo,
CC VecBase(3):pSV2Cat, VecBase(3):M13mp9, VecBase(3): pHC79,
CC VecBase(3):pV34, VecBase(3):pKTH601, VecBase(3): pKTH604,
CC VecBase(3):pKTH605, VecBase(3):pKTH606, VecBase(3):YEp24,
CC VecBase(3):YIp5, VecBase(3):YRp17, VecBase(3): pSP18,
CC VecBase(3):pSP19, VecBase(3):pSP6T3, VecBase(3):pSP6T719,
CC VecBase(3):pT712, VecBase(3):pT713, VecBase(3):pT7T318, VecBase(3):
CC pT7T319, VecBase(3):pT7T3A18, VecBase(3):pT7T3A19, VecBase(3):pEX1,
CC VecBase(3):pEX2, VecBase(3):pEX3, VecBase(3): pCKSP6,
CC VecBase(3):pACYC177, VecBase(3):pKO1, VecBase(3): pKO2,
CC VecBase(3):pKM1, VecBase(3):pKM2, VecBase(3):pMBL1, VecBase(3):
CC pMBL604, VecBase(3):pMC1511, VecBase(3):pMC1871, VecBase(3):pAA37X,
CC VecBase(3):pUR278, VecBase(3):pUR288, VecBase(3): pUR289,
CC VecBase(3):pUR290, VecBase(3):pUR291, VecBase(3): pUR292,
CC VecBase(3):pUR222. NCBI gi: 208958
XX
FH Key Location/Qualifiers
FH
FT source 1..4361
FT /organism="Cloning vector"
FT /sub_species="Cloning vector pBR322"
FT /sequenced_mol="DNA"
FT /tissue_lib="ATCC 31344, ATCC 37017"
FT misc_feature 1..1643
FT /note="from pSC101 (bp 1-1643)"
FT misc_binding 24..27
FT /bound_moiety="echinomycin"
FT promoter complement(27..33)
FT /note="promoter P1 [6]"
FT misc_binding 39..42
FT /bound_moiety="echinomycin"
FT promoter 43..49
FT /note="promoter P2 [6]"
FT misc_binding 53..56
FT /bound_moiety="echinomycin"
FT misc_binding 67..70
FT /bound_moiety="echinomycin"
FT misc_binding 80..83
FT /bound_moiety="echinomycin"
FT CDS 86..1276
FT /gene="tet"
FT /note="NCBI gi: 208959"
FT /codon_start=1
FT /product="tetracycline resistance protein"
FT /db_xref="PID:g208959"
FT /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
FT GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
FT VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
FT LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
FT QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
FT AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
FT AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
FT misc_feature complement(141..142)
FT /note="Endo.Sce I cleavage site coordinated with site at
FT base 146 [10]"
FT misc_feature 146..147
FT /note="Endo.Sce I cleavage site coordinated with site at
FT base 142 [10]"
FT misc_binding 411..414
FT /bound_moiety="echinomycin"
FT conflict replace(426,"")
FT /citation=[11]
FT misc_binding 469..472
FT /bound_moiety="echinomycin"
FT old_sequence 526..528
FT /citation=[17]
FT repeat_unit complement(1515..1519)
FT /note="gamma-delta insertion target sequence"
FT /rpt_type=DIRECT
FT misc_feature 1636..1762
FT /note="from pSC101 (bp 1860-1986)"
FT misc_feature 1763..3147
FT /note="from pMB1"
FT repeat_unit complement(1788..1792)
FT /note="gamma-delta insertion target sequence"
FT /rpt_type=DIRECT
FT conflict replace(1891..1892,"att")
FT /citation=[23]
FT old_sequence 1892..1893
FT /citation=[2]
FT /citation=[22]
FT RBS 1905..1910
FT RBS 1905..1909
FT /note="Shine-Dalgarno sequence"
FT conflict replace(1913..1914,"caa")
FT /citation=[23]
FT old_sequence 1914..1915
FT /citation=[17]
FT CDS 1915..2106
FT /note="NCBI gi: 456436"
FT /codon_start=1
FT /product="ROP protein"
FT /db_xref="PID:g456436"
FT /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
FT DELYRSCLARFGDDGENL"
FT CDS 1915..2106
FT /note="NCBI gi: 506846"
FT /codon_start=1
FT /product="ROP protein"
FT /db_xref="PID:g506846"
FT /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
FT DELYRSCLARFGDDGENL"
FT misc_feature 2011..2167
FT /note="H-strand Y effector site [5]"
FT repeat_unit complement(2245..2249)
FT /note="gamma-delta insertion target sequence"
FT /rpt_type=DIRECT
FT misc_feature complement(2351..2414)
FT /note="L-strand Y effector site [5]"
FT misc_binding 2439..2447
FT /bound_moiety="dnaA"
FT rep_origin 2535
FT old_sequence replace(2729..2730,"at")
FT /note="revision according to [17]"
FT /citation=[17]
FT /citation=[2]
FT old_sequence 2729
FT /citation=[17]
FT old_sequence replace(2730,"t")
FT /note="revision according to [16]"
FT /citation=[2]
FT /citation=[16]
FT old_sequence 2730
FT /citation=[17]
FT misc_feature 3148..4361
FT /note="from Tn3 (bp 4957-3742)"
FT repeat_region 3148..3185
FT /note="corresponds to one of the 38bp repeats found in Tn3
FT (bp 1-38 and complement (4920-4957))"
FT /rpt_type=INVERTED
FT CDS complement(3293..4153)
FT /gene="bla"
FT /note="E-286; NCBI gi: 455370"
FT /codon_start=1
FT /product="beta-lactamase"
FT /db_xref="PID:g455370"
FT /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
FT ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
FT PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
FT EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
FT LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
FT LIKHW"
FT mat_peptide complement(3296..4084)
FT /gene="bla"
FT /codon_start=1
FT /product="beta-lactamase"
FT sig_peptide complement(4085..4153)
FT /gene="bla"
FT /codon_start=1
FT RBS complement(4161..4165)
FT /note="Shine-Dalgarno sequence"
FT promoter complement(4188..4194)
FT /note="promoter P3 [6]"
FT misc_binding complement(4268..4271)
FT /bound_moiety="echinomycin"
FT misc_binding complement(4280..4283)
FT /bound_moiety="echinomycin"
FT misc_binding complement(4285..4288)
FT /bound_moiety="echinomycin"
FT misc_binding complement(4296..4299)
FT /bound_moiety="echinomycin"
FT misc_binding complement(4311..4314)
FT /bound_moiety="echinomycin"
FT misc_binding complement(4317..4320)
FT /bound_moiety="echinomycin"
FT misc_binding complement(4331..4334)
FT /bound_moiety="echinomycin"
XX
SQ Sequence 4361 BP; 983 A; 1210 C; 1134 G; 1034 T; 0 other;
ttctcatgtt tgacagctta tcatcgataa gctttaatgc ggtagtttat cacagttaaa 60
ttgctaacgc agtcaggcac cgtgtatgaa atctaacaat gcgctcatcg tcatcctcgg 120
caccgtcacc ctggatgctg taggcatagg cttggttatg ccggtactgc cgggcctctt 180
gcgggatatc gtccattccg acagcatcgc cagtcactat ggcgtgctgc tagcgctata 240
tgcgttgatg caatttctat gcgcacccgt tctcggagca ctgtccgacc gctttggccg 300
ccgcccagtc ctgctcgctt cgctacttgg agccactatc gactacgcga tcatggcgac 360
cacacccgtc ctgtggatcc tctacgccgg acgcatcgtg gccggcatca ccggcgccac 420
aggtgcggtt gctggcgcct atatcgccga catcaccgat ggggaagatc gggctcgcca 480
cttcgggctc atgagcgctt gtttcggcgt gggtatggtg gcaggccccg tggccggggg 540
actgttgggc gccatctcct tgcatgcacc attccttgcg gcggcggtgc tcaacggcct 600
caacctacta ctgggctgct tcctaatgca ggagtcgcat aagggagagc gtcgaccgat 660
gcccttgaga gccttcaacc cagtcagctc cttccggtgg gcgcggggca tgactatcgt 720
cgccgcactt atgactgtct tctttatcat gcaactcgta ggacaggtgc cggcagcgct 780
ctgggtcatt ttcggcgagg accgctttcg ctggagcgcg acgatgatcg gcctgtcgct 840
tgcggtattc ggaatcttgc acgccctcgc tcaagccttc gtcactggtc ccgccaccaa 900
acgtttcggc gagaagcagg ccattatcgc cggcatggcg gccgacgcgc tgggctacgt 960
cttgctggcg ttcgcgacgc gaggctggat ggccttcccc attatgattc ttctcgcttc 1020
cggcggcatc gggatgcccg cgttgcaggc catgctgtcc aggcaggtag atgacgacca 1080
tcagggacag cttcaaggat cgctcgcggc tcttaccagc ctaacttcga tcactggacc 1140
gctgatcgtc acggcgattt atgccgcctc ggcgagcaca tggaacgggt tggcatggat 1200
tgtaggcgcc gccctatacc ttgtctgcct ccccgcgttg cgtcgcggtg catggagccg 1260
ggccacctcg acctgaatgg aagccggcgg cacctcgcta acggattcac cactccaaga 1320
attggagcca atcaattctt gcggagaact gtgaatgcgc aaaccaaccc ttggcagaac 1380
atatccatcg cgtccgccat ctccagcagc cgcacgcggc gcatctcggg cagcgttggg 1440
tcctggccac gggtgcgcat gatcgtgctc ctgtcgttga ggacccggct aggctggcgg 1500
ggttgcctta ctggttagca gaatgaatca ccgatacgcg agcgaacgtg aagcgactgc 1560
tgctgcaaaa cgtctgcgac ctgagcaaca acatgaatgg tcttcggttt ccgtgtttcg 1620
taaagtctgg aaacgcggaa gtcagcgccc tgcaccatta tgttccggat ctgcatcgca 1680
ggatgctgct ggctaccctg tggaacacct acatctgtat taacgaagcg ctggcattga 1740
ccctgagtga tttttctctg gtcccgccgc atccataccg ccagttgttt accctcacaa 1800
cgttccagta accgggcatg ttcatcatca gtaacccgta tcgtgagcat cctctctcgt 1860
ttcatcggta tcattacccc catgaacaga aatccccctt acacggaggc atcagtgacc 1920
aaacaggaaa aaaccgccct taacatggcc cgctttatca gaagccagac attaacgctt 1980
ctggagaaac tcaacgagct ggacgcggat gaacaggcag acatctgtga atcgcttcac 2040
gaccacgctg atgagcttta ccgcagctgc ctcgcgcgtt tcggtgatga cggtgaaaac 2100
ctctgacaca tgcagctccc ggagacggtc acagcttgtc tgtaagcgga tgccgggagc 2160
agacaagccc gtcagggcgc gtcagcgggt gttggcgggt gtcggggcgc agccatgacc 2220
cagtcacgta gcgatagcgg agtgtatact ggcttaacta tgcggcatca gagcagattg 2280
tactgagagt gcaccatatg cggtgtgaaa taccgcacag atgcgtaagg agaaaatacc 2340
gcatcaggcg ctcttccgct tcctcgctca ctgactcgct gcgctcggtc gttcggctgc 2400
ggcgagcggt atcagctcac tcaaaggcgg taatacggtt atccacagaa tcaggggata 2460
acgcaggaaa gaacatgtga gcaaaaggcc agcaaaaggc caggaaccgt aaaaaggccg 2520
cgttgctggc gtttttccat aggctccgcc cccctgacga gcatcacaaa aatcgacgct 2580
caagtcagag gtggcgaaac ccgacaggac tataaagata ccaggcgttt ccccctggaa 2640
gctccctcgt gcgctctcct gttccgaccc tgccgcttac cggatacctg tccgcctttc 2700
tcccttcggg aagcgtggcg ctttctcata gctcacgctg taggtatctc agttcggtgt 2760
aggtcgttcg ctccaagctg ggctgtgtgc acgaaccccc cgttcagccc gaccgctgcg 2820
ccttatccgg taactatcgt cttgagtcca acccggtaag acacgactta tcgccactgg 2880
cagcagccac tggtaacagg attagcagag cgaggtatgt aggcggtgct acagagttct 2940
tgaagtggtg gcctaactac ggctacacta gaaggacagt atttggtatc tgcgctctgc 3000
tgaagccagt taccttcgga aaaagagttg gtagctcttg atccggcaaa caaaccaccg 3060
ctggtagcgg tggttttttt gtttgcaagc agcagattac gcgcagaaaa aaaggatctc 3120
aagaagatcc tttgatcttt tctacggggt ctgacgctca gtggaacgaa aactcacgtt 3180
aagggatttt ggtcatgaga ttatcaaaaa ggatcttcac ctagatcctt ttaaattaaa 3240
aatgaagttt taaatcaatc taaagtatat atgagtaaac ttggtctgac agttaccaat 3300
gcttaatcag tgaggcacct atctcagcga tctgtctatt tcgttcatcc atagttgcct 3360
gactccccgt cgtgtagata actacgatac gggagggctt accatctggc cccagtgctg 3420
caatgatacc gcgagaccca cgctcaccgg ctccagattt atcagcaata aaccagccag 3480
ccggaagggc cgagcgcaga agtggtcctg caactttatc cgcctccatc cagtctatta 3540
attgttgccg ggaagctaga gtaagtagtt cgccagttaa tagtttgcgc aacgttgttg 3600
ccattgctgc aggcatcgtg gtgtcacgct cgtcgtttgg tatggcttca ttcagctccg 3660
gttcccaacg atcaaggcga gttacatgat cccccatgtt gtgcaaaaaa gcggttagct 3720
ccttcggtcc tccgatcgtt gtcagaagta agttggccgc agtgttatca ctcatggtta 3780
tggcagcact gcataattct cttactgtca tgccatccgt aagatgcttt tctgtgactg 3840
gtgagtactc aaccaagtca ttctgagaat agtgtatgcg gcgaccgagt tgctcttgcc 3900
cggcgtcaac acgggataat accgcgccac atagcagaac tttaaaagtg ctcatcattg 3960
gaaaacgttc ttcggggcga aaactctcaa ggatcttacc gctgttgaga tccagttcga 4020
tgtaacccac tcgtgcaccc aactgatctt cagcatcttt tactttcacc agcgtttctg 4080
ggtgagcaaa aacaggaagg caaaatgccg caaaaaaggg aataagggcg acacggaaat 4140
gttgaatact catactcttc ctttttcaat attattgaag catttatcag ggttattgtc 4200
tcatgagcgg atacatattt gaatgtattt agaaaaataa acaaataggg gttccgcgca 4260
catttccccg aaaagtgcca cctgacgtct aagaaaccat tattatcatg acattaacct 4320
ataaaaatag gcgtatcacg aggccctttc gtcttcaaga a 4361
//
|