1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515
|
[](https://travis-ci.org/tseemann/prokka)
[](https://www.gnu.org/licenses/gpl-3.0)
[](https://doi.org/10.1093/bioinformatics/btu153)

# Prokka: rapid prokaryotic genome annotation
## Introduction
Whole genome annotation is the process of identifying features of interest
in a set of genomic DNA sequences, and labelling them with useful
information. Prokka is a software tool to annotate bacterial, archaeal and
viral genomes quickly and produce standards-compliant output files.
## Installation
### Bioconda
If you use [Conda](https://conda.io/docs/install/quick.html)
you can use the [Bioconda channel](https://bioconda.github.io/):
```
conda install -c conda-forge -c bioconda -c defaults prokka
```
### Brew
If you are using the [MacOS Brew](http://brew.sh/)
or [LinuxBrew](http://brew.sh/linuxbrew/) packaging system:
```
brew install brewsci/bio/prokka
```
### Docker
Maintained by https://hub.docker.com/u/staphb
```
docker pull staphb/prokka:latest
docker run staphb/prokka:latest prokka -h
```
### Singularity
```
singularity build prokka.sif docker://staphb/prokka:latest
singularity exec prokka.sif prokka -h
```
### Ubuntu/Debian/Mint
```
sudo apt-get install libdatetime-perl libxml-simple-perl libdigest-md5-perl git default-jre bioperl
sudo cpan Bio::Perl
git clone https://github.com/tseemann/prokka.git $HOME/prokka
$HOME/prokka/bin/prokka --setupdb
```
### Centos/Fedora/RHEL
```
sudo yum install git perl-Time-Piece perl-XML-Simple perl-Digest-MD5 perl-App-cpanminus git java perl-CPAN perl-Module-Build
sudo cpanm Bio::Perl
git clone https://github.com/tseemann/prokka.git $HOME/prokka
$HOME/prokka/bin/prokka --setupdb
```
### MacOS
```
sudo cpan Time::Piece XML::Simple Digest::MD5 Bio::Perl
git clone https://github.com/tseemann/prokka.git $HOME/prokka
$HOME/prokka/bin/prokka --setupdb
```
## Test
* Type `prokka` and it should output its help screen.
* Type `prokka --version` and you should see an output like `prokka 1.x`
* Type `prokka --listdb` and it will show you what databases it has installed to use.
## Invoking Prokka
### Beginner
```
# Vanilla (but with free toppings)
% prokka contigs.fa
# Look for a folder called PROKKA_yyyymmdd (today's date) and look at stats
% cat PROKKA_yyyymmdd/*.txt
```
### Moderate
```
# Choose the names of the output files
% prokka --outdir mydir --prefix mygenome contigs.fa
# Visualize it in Artemis
% art mydir/mygenome.gff
```
### Specialist
```
# Have curated genomes I want to use to annotate from
% prokka --proteins MG1655.gbk --outdir mutant --prefix K12_mut contigs.fa
# Look at tabular features
% less -S mutant/K12_mut.tsv
```
### Expert
```
# It's not just for bacteria, people
% prokka --kingdom Archaea --outdir mydir --genus Pyrococcus --locustag PYCC
# Search for your favourite gene
% exonerate --bestn 1 zetatoxin.fasta mydir/PYCC_06072012.faa | less
```
### Wizard
```
# Watch and learn
% prokka --outdir mydir --locustag EHEC --proteins NewToxins.faa --evalue 0.001 --gram neg --addgenes contigs.fa
# Check to see if anything went really wrong
% less mydir/EHEC_06072012.err
# Add final details using Sequin
% sequin mydir/EHEC_0607201.sqn
```
### NCBI Genbank submitter
```
# Register your BioProject (e.g. PRJNA123456) and your locus_tag prefix (e.g. EHEC) first!
% prokka --compliant --centre UoN --outdir PRJNA123456 --locustag EHEC --prefix EHEC-Chr1 contigs.fa
# Check to see if anything went really wrong
% less PRJNA123456/EHEC-Chr1.err
# Add final details using Sequin
% sequin PRJNA123456/EHEC-Chr1.sqn
```
### European Nucleotide Archive (ENA) submitter
```
# Register your BioProject (e.g. PRJEB12345) and your locus_tag (e.g. EHEC) prefix first!
% prokka --compliant --centre UoN --outdir PRJEB12345 --locustag EHEC --prefix EHEC-Chr1 contigs.fa
# Check to see if anything went really wrong
% less PRJNA123456/EHEC-Chr1.err
# Install and run Sanger Pathogen group's Prokka GFF3 to EMBL converter
# available from https://github.com/sanger-pathogens/gff3toembl
# Find the closest NCBI taxonomy id (e.g. 562 for Escherichia coli)
% gff3_to_embl -i "Submitter, A." \
-m "Escherichia coli EHEC annotated using Prokka." \
-g linear -c PROK -n 11 -f PRJEB12345/EHEC-Chr1.embl \
"Escherichia coli" 562 PRJEB12345 "Escherichia coli strain EHEC" PRJEB12345/EHEC-Chr1.gff
# Download and run the latest EMBL validator prior to submitting the EMBL flat file
# from http://central.maven.org/maven2/uk/ac/ebi/ena/sequence/embl-api-validator/
# which at the time of writing is v1.1.129
% curl -L -O http://central.maven.org/maven2/uk/ac/ebi/ena/sequence/embl-api-validator/1.1.129/embl-api-validator-1.1.129.jar
% java -jar embl-api-validator-1.1.129.jar -r PRJEB12345/EHEC-Chr1.embl
# Compress the file ready to upload to ENA, and calculate MD5 checksum
% gzip PRJEB12345/EHEC-Chr1.embl
% md5sum PRJEB12345/EHEC-Chr1.embl.gz
```
### Crazy Person
```
# No stinking Perl script is going to control me
% prokka \
--outdir $HOME/genomes/Ec_POO247 --force \
--prefix Ec_POO247 --addgenes --locustag ECPOOp \
--increment 10 --gffver 2 --centre CDC --compliant \
--genus Escherichia --species coli --strain POO247 --plasmid pECPOO247 \
--kingdom Bacteria --gcode 11 --usegenus \
--proteins /opt/prokka/db/trusted/Ecocyc-17.6 \
--evalue 1e-9 --rfam \
plasmid-closed.fna
```
## Output Files
| Extension | Description |
| --------- | ----------- |
| .gff | This is the master annotation in GFF3 format, containing both sequences and annotations. It can be viewed directly in Artemis or IGV. |
| .gbk | This is a standard Genbank file derived from the master .gff. If the input to prokka was a multi-FASTA, then this will be a multi-Genbank, with one record for each sequence. |
| .fna | Nucleotide FASTA file of the input contig sequences. |
| .faa | Protein FASTA file of the translated CDS sequences. |
| .ffn | Nucleotide FASTA file of all the prediction transcripts (CDS, rRNA, tRNA, tmRNA, misc_RNA) |
| .sqn | An ASN1 format "Sequin" file for submission to Genbank. It needs to be edited to set the correct taxonomy, authors, related publication etc. |
| .fsa | Nucleotide FASTA file of the input contig sequences, used by "tbl2asn" to create the .sqn file. It is mostly the same as the .fna file, but with extra Sequin tags in the sequence description lines. |
| .tbl | Feature Table file, used by "tbl2asn" to create the .sqn file. |
| .err | Unacceptable annotations - the NCBI discrepancy report. |
| .log | Contains all the output that Prokka produced during its run. This is a record of what settings you used, even if the --quiet option was enabled. |
| .txt | Statistics relating to the annotated features found. |
| .tsv | Tab-separated file of all features: locus_tag,ftype,len_bp,gene,EC_number,COG,product |
## Command line options
General:
--help This help
--version Print version and exit
--citation Print citation for referencing Prokka
--quiet No screen output (default OFF)
--debug Debug mode: keep all temporary files (default OFF)
Setup:
--listdb List all configured databases
--setupdb Index all installed databases
--cleandb Remove all database indices
--depends List all software dependencies
Outputs:
--outdir [X] Output folder [auto] (default '')
--force Force overwriting existing output folder (default OFF)
--prefix [X] Filename output prefix [auto] (default '')
--addgenes Add 'gene' features for each 'CDS' feature (default OFF)
--locustag [X] Locus tag prefix (default 'PROKKA')
--increment [N] Locus tag counter increment (default '1')
--gffver [N] GFF version (default '3')
--compliant Force Genbank/ENA/DDJB compliance: --genes --mincontiglen 200 --centre XXX (default OFF)
--centre [X] Sequencing centre ID. (default '')
Organism details:
--genus [X] Genus name (default 'Genus')
--species [X] Species name (default 'species')
--strain [X] Strain name (default 'strain')
--plasmid [X] Plasmid name or identifier (default '')
Annotations:
--kingdom [X] Annotation mode: Archaea|Bacteria|Mitochondria|Viruses (default 'Bacteria')
--gcode [N] Genetic code / Translation table (set if --kingdom is set) (default '0')
--prodigaltf [X] Prodigal training file (default '')
--gram [X] Gram: -/neg +/pos (default '')
--usegenus Use genus-specific BLAST databases (needs --genus) (default OFF)
--proteins [X] Fasta file of trusted proteins to first annotate from (default '')
--hmms [X] Trusted HMM to first annotate from (default '')
--metagenome Improve gene predictions for highly fragmented genomes (default OFF)
--rawproduct Do not clean up /product annotation (default OFF)
Computation:
--fast Fast mode - skip CDS /product searching (default OFF)
--cpus [N] Number of CPUs to use [0=all] (default '8')
--mincontiglen [N] Minimum contig size [NCBI needs 200] (default '1')
--evalue [n.n] Similarity e-value cut-off (default '1e-06')
--rfam Enable searching for ncRNAs with Infernal+Rfam (SLOW!) (default '0')
--norrna Don't run rRNA search (default OFF)
--notrna Don't run tRNA search (default OFF)
--rnammer Prefer RNAmmer over Barrnap for rRNA prediction (default OFF)
### Option: --proteins
The `--proteins` option is recommended when you have good quality reference genomes
and want to ensure gene naming is consistent. Some species use specific terminology
which will be often lost if you rely on the default Swiss-Prot database included
with Prokka.
If you have Genbank or Protein FASTA file(s) that you want to annotate genes from
as the first priority, use the `--proteins myfile.gbk`. Please make sure it has a
recognisable file extension like `.gb` or `.gbk` or auto-detect will fail. The
use of Genbank is recommended over FASTA, because it will provide `/gene`
and `/EC_number` annotations that a typical `.faa` file will not provide, unless
you have specially formatted it for Prokka.
### Option: --prodigaltf
Instead of letting `prodigal` train its gene model on the contigs you
provide, you can pre-train it on some good closed reference genomes first
using the `prodigal -t` option. Once you've done that, provide `prokka`
the training file using the `--prodgialtf` option.
### Option: --rawproduct
Prokka annotates proteins by using sequence similarity to other proteins in its database,
or the databses the user provides via `--proteins`. By default, Prokka tries to "cleans" the
`/product` names to ensure they are compliant with Genbank/ENA conventions.
Some of the main things it does is:
* set vague names to `hypothetical protein`
* consistifies terms like `possible`, `probable`, `predicted`, ... to `putative`
* removes EC, COG and locus_tag identifiers
Full details can be found in the `cleanup_product()` function in the `prokka` script.
If you feel your annotations are being ruined, try using the `--rawproduct` option,
and please [file an issue](https://github.com/tseemann/prokka/issues/) if you find
an example of where it is "behaving badly" and I will fix it.
## Databases
### The Core (BLAST+) Databases
Prokka uses a variety of databases when trying to assign function to the
predicted CDS features. It takes a hierarchial approach to make it fast.
A small, core set of well characterized proteins are first searched using
BLAST+. This combination of small database and fast search typically
completes about 70% of the workload. Then a series of slower but more
sensitive HMM databases are searched using HMMER3.
The three core databases, applied in order, are:
1. [ISfinder](https://isfinder.biotoul.fr/):
Only the tranposase (protein) sequences; the whole transposon is not annotated.
2. [NCBI Bacterial Antimicrobial Resistance Reference Gene Database](https://www.ncbi.nlm.nih.gov/bioproject/313047):
Antimicrobial resistance genes curated by NCBI.
3. [UniProtKB (SwissProt)](https://www.uniprot.org/uniprot/?query=reviewed:yes):
For each `--kingdom` we include curated proteins with evidence that
(i) from Bacteria (or Archaea or Viruses);
(ii) not be "Fragment" entries;
and (iii) have an evidence level ("PE") of 2 or lower, which
corresponds to experimental mRNA or proteomics evidence.
#### Making a Core Databases
If you want to modify these core databases, the included script
`prokka-uniprot_to_fasta_db`, along with the official `uniprot_sprot.dat`,
can be used to generate a new database to put in `/opt/prokka/db/kingdom/`.
If you add new ones, the command `prokka --listdb` will show you whether it
has been detected properly.
#### The Genus Databases
:warning: This is no longer recommended. Please use `--proteins` instead.
If you enable `--usegenus` and also provide a Genus via `--genus` then it
will first use a BLAST database which is Genus specific. Prokka comes with
a set of databases for the most common Bacterial genera; type prokka
`--listdb` to see what they are.
#### Adding a Genus Databases
If you have a set of Genbank files and want to create a new Genus database,
Prokka comes with a tool called `prokka-genbank_to_fasta_db` to help. For
example, if you had four annotated "Coccus" genomes, you could do the
following:
```
% prokka-genbank_to_fasta_db Coccus1.gbk Coccus2.gbk Coccus3.gbk Coccus4.gbk > Coccus.faa
% cd-hit -i Coccus.faa -o Coccus -T 0 -M 0 -g 1 -s 0.8 -c 0.9
% rm -fv Coccus.faa Coccus.bak.clstr Coccus.clstr
% makeblastdb -dbtype prot -in Coccus
% mv Coccus.p* /path/to/prokka/db/genus/
```
### The HMM Databases
Prokka comes with a bunch of HMM libraries for HMMER3. They are mostly
Bacteria-specific. They are searched after the core and genus databases.
You can add more simply by putting them in `/opt/prokka/db/hmm`. Type
`prokka --listdb` to confirm they are recognised.
### FASTA database format
Prokka understands two annotation tag formats, a plain one and a detailed one.
The plain one is a standard FASTA-like line with the ID after the `>` sign, and the protein `/product`
after the ID (the "description" part of the line):
```
>SeqID product
```
The detailed one consists of a special encoded three-part description line. The parts are the `/EC_number`,
the `/gene` code, then the `/product` - and they are separated by a special "~~~" sequence:
```
>SeqID EC_number~~~gene~~~product~~~COG
```
Here are some examples. Note that not all parts need to be present, but the "~~~" should still be there:
```
>YP_492693.1 2.1.1.48~~~ermC~~~rRNA adenine N-6-methyltransferase~~~COG1234
MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEI
DHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIFGNIPYNISTDIIRKIVF*
>YP_492697.1 ~~~traB~~~transfer complex protein TraB~~~
MIKKFSLTTVYVAFLSIVLSNITLGAENPGPKIEQGLQQVQTFLTGLIVAVGICAGVWIV
LKKLPGIDDPMVKNEMFRGVGMVLAGVAVGAALVWLVPWVYNLFQ*
>YP_492694.1 ~~~~~~transposase~~~
MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRGRGVNVHHSTVYRWVQEYAPILYQ
QSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEISIMLAS*
```
The same description lines apply to HMM models, except the "NAME" and "DESC" fields are used:
```
NAME PRK00001
ACC PRK00001
DESC 2.1.1.48~~~ermC~~~rRNA adenine N-6-methyltransferase~~~COG1234
LENG 284
```
## FAQ
* __Where does the name "Prokka" come from?__
Prokka is a contraction of "prokaryotic annotation". It's also relatively
unique within Google, and also rhymes with a native Australian marsupial
called the quokka.
* __Can I annotate by eukaryote genome with Prokka?__
No. Prokka is specifically designed for Bacteria, Archaea and Viruses. It
can't handle multi-exon gene models; I would recommend using MAKER 2 for
that purpose.
* __Why does Prokka keeps on crashing when it gets to tge "tbl2asn" stage?__
It seems that the tbl2asn program from NCBI "expires" after 6-12 months, and
refuses to run. Unfortunately you need to install a newer version which you
can download from [here](http://www.ncbi.nlm.nih.gov/genbank/tbl2asn2/).
* __The hmmscan step seems to hang and do nothing?__
The problem here is GNU Parallel. It seems the Debian package for hmmer has
modified it to require the `--gnu` option to behave in the 'default' way.
There is no clear reason for this. The only way to restore normal behaviour
is to edit the prokka script and change `parallel` to `parallel --gnu`.
* __Why does prokka fail when it gets to hmmscan?__
Unfortunately HMMER keeps changing its database format, and they aren't
upward compatible. If you upgraded HMMER (from 3.0 to 3.1 say) then you
need to "re-press" the files. This can be done as follows:
```
cd /path/to/prokka/db/hmm
mkdir new
for D in *.hmm ; do hmmconvert $D > new/$D ; done
cd new
for D in *.hmm ; do hmmpress $D ; done
mv * ..
rmdir new
```
* __Why can't I load Prokka .GBK files into Mauve?__
Mauve uses BioJava to parse GenBank files, and it is very picky about Genbank files.
It does not like long contig names,
like those from Velvet or Spades. One solution is to use `--centre XXX`
in Prokka and it will rename all your contigs to be NCBI (and Mauve)
compliant. It does not like the ACCESSION and VERSION strings that Prokka
produces via the "tbl2asn" tool. The following Unix command will fix them:
`egrep -v '^(ACCESSION|VERSION)' prokka.gbk > mauve.gbk`
* __How can I make my GFF not have the contig sequences in it?__
```
sed '/^##FASTA/Q' prokka.gff > nosequence.gff
```
## Bugs
Submit problems or requests to the [Issue Tracker](https://github.com/tseemann/prokka/issues).
## Changes
* Read the [release notes](https://github.com/tseemann/prokka/releases)
* Read the [ChangeLog.txt](https://raw.githubusercontent.com/tseemann/prokka/master/doc/ChangeLog.txt)
* Look at the [Github commits](https://github.com/tseemann/prokka/commits/master)
## Citation
Seemann T.
*Prokka: rapid prokaryotic genome annotation*
**Bioinformatics** 2014 Jul 15;30(14):2068-9.
[PMID:24642063](http://www.ncbi.nlm.nih.gov/pubmed/24642063)
## Dependencies
### Mandatory
* __BioPerl__
Used for input/output of various file formats
_Stajich et al, The Bioperl toolkit: Perl modules for the life sciences. Genome Res. 2002 Oct;12(10):1611-8._
* __GNU Parallel__
A shell tool for executing jobs in parallel using one or more computers
_O. Tange, GNU Parallel - The Command-Line Power Tool, ;login: The USENIX Magazine, Feb 2011:42-47._
* __BLAST+__
Used for similarity searching against protein sequence libraries
_Camacho C et al. BLAST+: architecture and applications. BMC Bioinformatics. 2009 Dec 15;10:421._
* __Prodigal__
Finds protein-coding features (CDS)
_Hyatt D et al. Prodigal: prokaryotic gene recognition and translation initiation site identification. BMC Bioinformatics. 2010 Mar 8;11:119._
* __TBL2ASN__
Prepare sequence records for Genbank submission
[Tbl2asn home page](https://www.ncbi.nlm.nih.gov/genbank/tbl2asn2/)
### Recommended
* __Aragorn__
Finds transfer RNA features (tRNA)
_Laslett D, Canback B. ARAGORN, a program to detect tRNA genes and tmRNA genes in nucleotide sequences. Nucleic Acids Res. 2004 Jan 2;32(1):11-6._
* __Barrnap__
Used to predict ribosomal RNA features (rRNA). My licence-free replacement for RNAmmmer.
_Manuscript under preparation._
* __HMMER3__
Used for similarity searching against protein family profiles
_Finn RD et al. HMMER web server: interactive sequence similarity searching. Nucleic Acids Res. 2011 Jul;39(Web Server issue):W29-37._
### Optional
* __minced__
Finds CRISPR arrays
[Minced home page](https://github.com/ctSkennerton/minced)
* __RNAmmer__
Finds ribosomal RNA features (rRNA)
_Lagesen K et al. RNAmmer: consistent and rapid annotation of ribosomal RNA genes. Nucleic Acids Res. 2007;35(9):3100-8._
* __SignalP__
Finds signal peptide features in CDS (sig_peptide)
_Petersen TN et al. SignalP 4.0: discriminating signal peptides from transmembrane regions. Nat Methods. 2011 Sep 29;8(10):785-6._
* __Infernal__
Used for similarity searching against ncRNA family profiles
_D. L. Kolbe, S. R. Eddy. Fast Filtering for RNA Homology Search. Bioinformatics, 27:3102-3109, 2011._
# Licence
[GPL v3](https://raw.githubusercontent.com/tseemann/prokka/master/doc/LICENSE.Prokka)
## Author
* Torsten Seemann
* Web: https://tseemann.github.io/
* Twitter: [@torstenseemann](https://twitter.com/torstenseemann)
* Blog: [The Genome Factory](https://thegenomefactory.blogspot.com/)
|