1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570
|
# Copyright (c) 2013-2020, SIB - Swiss Institute of Bioinformatics and
# Biozentrum - University of Basel
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""
Unit tests for modelling.
"""
import unittest
from promod3 import modelling
from ost import conop, seq, io, mol, geom
class ModellingTests(unittest.TestCase):
def setUp(self):
compound_lib = conop.CompoundLib.Load(
'data/compounds.chemlib')
conop.SetDefaultLib(compound_lib)
io.profiles['DEFAULT'].processor = conop.RuleBasedProcessor(
compound_lib)
#######################################################################
# HELPERs
#######################################################################
def checkModel(self, mhandle):
'''
Check if model residues are properly set (peptide_linking, protein,
torsion).
'''
# check residue properties
for r in mhandle.model.residues:
# check types
self.assertTrue(r.peptide_linking)
self.assertTrue(r.is_protein)
# check links
if r.next.IsValid() and (r.next.number - r.number) == 1:
self.assertTrue(mol.InSequence(r, r.next))
# check torsions
if r.prev.IsValid() and mol.InSequence(r.prev, r):
self.assertTrue(r.phi_torsion.IsValid())
self.assertTrue(r.omega_torsion.IsValid())
if r.next.IsValid() and mol.InSequence(r, r.next):
self.assertTrue(r.psi_torsion.IsValid())
#######################################################################
def testRaiseNoAttachedView(self):
# test that BuildRawModel throws exception when no view is attached
aln = seq.CreateAlignment(seq.CreateSequence('A', 'acdef'),
seq.CreateSequence('B', 'ac-ef'))
self.assertRaises(RuntimeError, modelling.BuildRawModel, aln)
def testRaiseInvalidChainNames(self):
tpl = io.LoadPDB('data/gly.pdb')
aln = io.LoadAlignment('data/seq.fasta')
aln.AttachView(1, tpl.CreateFullView())
# perform stuff that doesn't raise, i.e. do it correctly
result = modelling.BuildRawModel(aln)
result = modelling.BuildRawModel(aln, chain_names='cheese')
self.assertEqual(result.model.chains[0].GetName(), 'cheese')
aln_lst = seq.AlignmentList()
aln_lst.append(aln)
aln_lst.append(aln)
result = modelling.BuildRawModel(aln_lst)
result = modelling.BuildRawModel(aln_lst, ['cheese', 'steak'])
self.assertEqual(result.model.chains[0].GetName(), 'cheese')
self.assertEqual(result.model.chains[1].GetName(), 'steak')
result = modelling.BuildRawModel(aln_lst, 'ch')
self.assertEqual(result.model.chains[0].GetName(), 'c')
self.assertEqual(result.model.chains[1].GetName(), 'h')
result = modelling.BuildRawModel(aln_lst, 'cheese')
self.assertEqual(result.model.chains[0].GetName(), 'c')
self.assertEqual(result.model.chains[1].GetName(), 'h')
# we only accept a string as chain_names if aln is AlignmentHandle
self.assertRaises(RuntimeError, modelling.BuildRawModel, aln, 1)
self.assertRaises(RuntimeError, modelling.BuildRawModel, aln, ['A'])
# we only accept a list or str as chain_names if aln is AlignmentList
self.assertRaises(RuntimeError, modelling.BuildRawModel, aln_lst, 1)
# size also matters...
self.assertRaises(RuntimeError, modelling.BuildRawModel, aln_lst, ['A'])
self.assertRaises(RuntimeError, modelling.BuildRawModel, aln_lst, 'A')
# increase size of aln_list => at some point we should run out of
# default chain_names
aln_lst = 100*[aln]
self.assertRaises(RuntimeError, modelling.BuildRawModel, aln_lst)
def testModeledSequence(self):
# test if the model has the sequence we want.
tpl = io.LoadPDB('data/gly.pdb')
aln = io.LoadAlignment('data/seq.fasta')
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
seq1 = seq.SequenceFromChain('MODEL', result.model.chains[0])
self.assertEqual(len(result.gaps), 0)
self.assertEqual(seq1.string, aln.sequences[0].string)
def testDeletion(self):
# test if the result contains a "deletion" gap at the right spot.
tpl = io.LoadPDB('data/gly.pdb')
aln = io.LoadAlignment('data/del.fasta')
aln.AttachView(1, tpl.CreateFullView())
# disable aln_preprocessing to keep the deletion in the example aln
result = modelling.BuildRawModel(aln, aln_preprocessing=False)
residues = result.model.residues
self.assertEqual(len(result.gaps), 1)
self.assertEqual(result.gaps[0].before, residues[2])
self.assertEqual(result.gaps[0].after, residues[3])
self.assertEqual(result.gaps[0].seq, '')
def testInsertion(self):
# test if the result contains an "insertion" gap at the right spot.
tpl = io.LoadPDB('data/gly.pdb')
aln = io.LoadAlignment('data/ins.fasta')
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
residues = result.model.residues
self.assertEqual(len(result.gaps), 1)
self.assertEqual(result.gaps[0].before, residues[1])
self.assertEqual(result.gaps[0].after, residues[2])
self.assertEqual(result.gaps[0].seq, 'AV')
def testNonFeasiblePeptideBond(self):
# test if the result contains a gap when two residues cannot be
# connected with a feasible peptide bond
tpl = io.LoadPDB('data/gly_shifted_nter.pdb')
aln = io.LoadAlignment('data/seq.fasta')
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
residues = result.model.residues
self.assertEqual(len(result.gaps), 1)
self.assertEqual(result.gaps[0].before, residues[1])
self.assertEqual(result.gaps[0].after, residues[2])
self.assertEqual(result.gaps[0].seq, '')
def testTer(self):
# test if the result contains two terminal gaps, one at the beginning,
# one at the end
tpl = io.LoadPDB('data/gly.pdb')
aln = io.LoadAlignment('data/ter.fasta')
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
residues = result.model.residues
self.assertEqual(len(result.gaps), 2)
self.assertEqual(result.gaps[0].before, mol.ResidueHandle())
self.assertEqual(result.gaps[0].after, residues[0])
self.assertEqual(result.gaps[0].seq, 'G')
self.assertEqual(result.gaps[1].before, residues[-1])
self.assertEqual(result.gaps[1].after, mol.ResidueHandle())
self.assertEqual(result.gaps[1].seq, 'G')
def testTerTrg(self):
# test if raw model ignores terminal gaps in target sequence
tpl = io.LoadPDB('data/gly.pdb')
aln = seq.CreateAlignment(
seq.CreateSequence('trg', '--GG--'),
seq.CreateSequence('tpl', 'GGGGGG'))
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
self.assertEqual(len(result.gaps), 0)
def testModified(self):
# test if we correctly strip off modifications
tpl = io.LoadPDB('data/sep.pdb')
aln = io.LoadAlignment('data/sep.fasta')
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
residues = result.model.residues
self.assertEqual(len(residues), 1)
self.assertEqual(len(residues[0].atoms), 6)
self.assertTrue(residues[0].FindAtom("N"))
self.assertTrue(residues[0].FindAtom("CA"))
self.assertTrue(residues[0].FindAtom("C"))
self.assertTrue(residues[0].FindAtom("O"))
self.assertTrue(residues[0].FindAtom("CB"))
self.assertTrue(residues[0].FindAtom("OG"))
def testModifiedMismatch(self):
# test if we allow OLC mismatch for modified AA
tpl = io.LoadPDB('data/sep.pdb')
aln = seq.CreateAlignment(
seq.CreateSequence('trg', 'S'),
seq.CreateSequence('tpl', 'X'))
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
residues = result.model.residues
# same as before as OLC of SEP is 'S' (i.e. matches)
self.assertEqual(len(residues), 1)
self.assertEqual(len(residues[0].atoms), 6)
self.assertTrue(residues[0].FindAtom("N"))
self.assertTrue(residues[0].FindAtom("CA"))
self.assertTrue(residues[0].FindAtom("C"))
self.assertTrue(residues[0].FindAtom("O"))
self.assertTrue(residues[0].FindAtom("CB"))
self.assertTrue(residues[0].FindAtom("OG"))
# NOTE: relevant seq-vs-str mismatch tested in testOffset
# See OST's nonstandard.cc for additional tests of handling modified
# residues. Code duplication will be removed in SCHWED-3569.
def testInsertCBeta(self):
# test if the dst residues contain cbeta, unless they are glycines
tpl = io.LoadPDB('data/cbeta.pdb')
aln = io.LoadAlignment('data/cbeta.fasta')
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
residues = result.model.residues
self.assertFalse(residues[0].FindAtom("CB").IsValid())
self.assertFalse(residues[1].FindAtom("CB").IsValid())
self.assertTrue(residues[2].FindAtom("CB").IsValid())
self.assertTrue(residues[3].FindAtom("CB").IsValid())
def testOffset(self):
# test if we can construct a raw model with an offset
tpl = io.LoadPDB('data/2jlp-1.pdb')
aln = io.LoadAlignment('data/2jlp-1.fasta')
aln.AttachView(1, tpl.Select("cname=A").CreateFullView())
# fail w/o offset
with self.assertRaises(RuntimeError):
mhandle = modelling.BuildRawModel(aln)
# try with hard-coded offset
aln.SetSequenceOffset(1, 55)
mhandle = modelling.BuildRawModel(aln)
self.assertEqual(len(mhandle.gaps), 4)
def testOnTop(self):
# do we clean up atoms that are on top of each other?
# ResNum 8 has CA-pos == C-pos
tpl = io.LoadPDB('data/gly_on_top.pdb')
aln = io.LoadAlignment('data/seq.fasta')
aln.AttachView(1, tpl.CreateFullView())
result = modelling.BuildRawModel(aln)
self.assertEqual(len(result.gaps), 1)
self.assertEqual(result.gaps[0].before.number.num, 7)
self.assertEqual(result.gaps[0].after.number.num, 9)
#######################################################################
def testModellingHandleOperations(self):
# handle with gap
tpl = io.LoadPDB('data/1crn_cut.pdb')
aln = io.LoadAlignment('data/1crn.fasta')
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# check ModellingHandle
self.assertEqual(len(mhandle.gaps), 1)
self.assertEqual(str(mhandle.gaps[0]), 'A.ALA24-(ICATYT)-A.GLY31')
self.checkModel(mhandle)
# check copy
mhandle_copy = mhandle.Copy()
self.assertEqual([str(a) for a in mhandle_copy.model.atoms],
[str(a) for a in mhandle.model.atoms])
self.assertEqual([str(g) for g in mhandle_copy.gaps],
[str(g) for g in mhandle.gaps])
self.assertEqual([str(s) for s in mhandle_copy.seqres],
[str(s) for s in mhandle.seqres])
# rest of the fields not checked...yet
# handle without gap
tpl_closed = io.LoadPDB('data/1crn_build.pdb')
seqres = str(aln.sequences[0])
aln_closed = seq.CreateAlignment(seq.CreateSequence('trg', seqres),
seq.CreateSequence('tpl', seqres))
aln_closed.AttachView(1, tpl_closed.CreateFullView())
mhandle_closed = modelling.BuildRawModel(aln_closed)
# merge with no overlap (no change)
mhandle_copy = mhandle.Copy()
modelling.MergeMHandle(mhandle_closed, mhandle_copy, 0, 0, 10, 19,
geom.Mat4())
self.assertEqual([str(a) for a in mhandle_copy.model.atoms],
[str(a) for a in mhandle.model.atoms])
self.assertEqual([str(g) for g in mhandle_copy.gaps],
[str(g) for g in mhandle.gaps])
self.assertEqual([str(s) for s in mhandle_copy.seqres],
[str(s) for s in mhandle.seqres])
self.checkModel(mhandle_copy)
# merge with overlap on N-side
mhandle_copy = mhandle.Copy()
modelling.MergeMHandle(mhandle_closed, mhandle_copy, 0, 0, 20, 29,
geom.Mat4())
self.assertEqual(len(mhandle_copy.gaps), 1)
self.assertEqual(str(mhandle_copy.gaps[0]), 'A.TYR29-(T)-A.GLY31')
self.checkModel(mhandle_copy)
# merge with overlap on C-side
mhandle_copy = mhandle.Copy()
modelling.MergeMHandle(mhandle_closed, mhandle_copy, 0, 0, 27, 35,
geom.Mat4())
self.assertEqual(len(mhandle_copy.gaps), 1)
self.assertEqual(str(mhandle_copy.gaps[0]), 'A.ALA24-(IC)-A.ALA27')
self.checkModel(mhandle_copy)
# merge with full overlap
mhandle_copy = mhandle.Copy()
modelling.MergeMHandle(mhandle_closed, mhandle_copy, 0, 0, 20, 35,
geom.Mat4())
self.assertEqual(len(mhandle_copy.gaps), 0)
self.checkModel(mhandle_copy)
#######################################################################
def testMergeGaps(self):
tpl = io.LoadPDB('data/1mcg.pdb')
aln = seq.CreateAlignment(seq.CreateSequence('trg', 'DDFAGTHN'),
seq.CreateSequence('tpl', 'N-N-A-LF'))
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# check
seqres = ''.join([r.one_letter_code for r in mhandle.model.residues])
self.assertEqual(seqres, 'DFGHN')
self.assertEqual(len(mhandle.gaps), 3)
modelling.MergeGaps(mhandle, 0)
seqres = ''.join([r.one_letter_code for r in mhandle.model.residues])
self.assertEqual(seqres, 'DGHN')
self.assertEqual(len(mhandle.gaps), 2)
self.assertEqual(str(mhandle.gaps[0]), 'A.ASP1-(DFA)-A.GLY5')
modelling.MergeGaps(mhandle, 0)
seqres = ''.join([r.one_letter_code for r in mhandle.model.residues])
self.assertEqual(seqres, 'DHN')
self.assertEqual(len(mhandle.gaps), 1)
self.assertEqual(str(mhandle.gaps[0]), 'A.ASP1-(DFAGT)-A.HIS7')
# last gap: should throw exception
with self.assertRaises(RuntimeError):
modelling.MergeGaps(mhandle, 0)
def testMergeGapsOligo(self):
# check that merge gaps fails if on diff. chains
tpl = io.LoadPDB('data/5d52-1.pdb')
aln_A = seq.CreateAlignment(
seq.CreateSequence('trg', 'GIVEQAAACCTSICSLYQLENYCN'),
seq.CreateSequence('tpl', 'GIVEQ---CCTSICSLYQLENYCN'))
aln_B = seq.CreateAlignment(
seq.CreateSequence('trg', 'FVNQHLCG---LEALTLVCGERGFFYTPKA'),
seq.CreateSequence('tpl', 'FVNQHLCGSHLVEALYLVCGERGFFYTPKA'))
aln_A.AttachView(1, tpl.Select("cname=A").CreateFullView())
aln_B.AttachView(1, tpl.Select("cname=B").CreateFullView())
alns = seq.AlignmentList()
alns.append(aln_A)
alns.append(aln_B)
mhandle = modelling.BuildRawModel(alns)
# check
self.assertEqual(len(mhandle.gaps), 2)
with self.assertRaises(RuntimeError):
modelling.MergeGaps(mhandle, 0)
def testCountEnclosedGaps(self):
tpl = io.LoadPDB('data/2dbs.pdb')
aln = seq.CreateAlignment(
seq.CreateSequence('trg', 'GATLNGFTVPAGNTLVLN---PD--KG---ATVTMAGA'),
seq.CreateSequence('tpl', '--NGG--TL--LI--PNGTYHFLGIQMKSNVHIRVE--'))
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# check
self.assertEqual(len(mhandle.gaps), 8)
for g in mhandle.gaps:
self.assertEqual(modelling.CountEnclosedGaps(mhandle, g), 1)
self.assertEqual(modelling.CountEnclosedInsertions(mhandle, g),
1 if (g.length > 0) else 0)
mych = mhandle.model.chains[0]
# none
mygap = modelling.StructuralGap(mych.FindResidue(15),
mych.FindResidue(17), "L")
self.assertEqual(modelling.CountEnclosedGaps(mhandle, mygap), 0)
self.assertEqual(modelling.CountEnclosedInsertions(mhandle, mygap), 0)
# extended singles
mygap = modelling.StructuralGap(mych.FindResidue(3),
mych.FindResidue(9), "LNGFT")
self.assertEqual(modelling.CountEnclosedGaps(mhandle, mygap), 1)
self.assertEqual(modelling.CountEnclosedInsertions(mhandle, mygap), 1)
mygap = modelling.StructuralGap(mych.FindResidue(20),
mych.FindResidue(22), "K")
self.assertEqual(modelling.CountEnclosedGaps(mhandle, mygap), 1)
self.assertEqual(modelling.CountEnclosedInsertions(mhandle, mygap), 0)
# doubles
mygap = modelling.StructuralGap(mych.FindResidue(3),
mych.FindResidue(12), "LNGFTVPA")
self.assertEqual(modelling.CountEnclosedGaps(mhandle, mygap), 2)
self.assertEqual(modelling.CountEnclosedInsertions(mhandle, mygap), 2)
mygap = modelling.StructuralGap(mych.FindResidue(13),
mych.FindResidue(19), "TLVLN")
self.assertEqual(modelling.CountEnclosedGaps(mhandle, mygap), 2)
self.assertEqual(modelling.CountEnclosedInsertions(mhandle, mygap), 1)
mygap = modelling.StructuralGap(mych.FindResidue(20),
mych.FindResidue(25), "KGAT")
self.assertEqual(modelling.CountEnclosedGaps(mhandle, mygap), 2)
self.assertEqual(modelling.CountEnclosedInsertions(mhandle, mygap), 0)
#######################################################################
def testClearGapsExceptions(self):
# check that clear gaps throws exceptions when used wrongly
tpl = io.LoadPDB('data/1mcg.pdb')
aln = seq.CreateAlignment(seq.CreateSequence('trg', 'DDFAGTHN'),
seq.CreateSequence('tpl', 'N-N-A-LF'))
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# get gaps before we remove residues in MergeGaps
mych = mhandle.model.chains[0]
mygap = modelling.StructuralGap(mych.FindResidue(0),
mych.FindResidue(3), "DD")
mygap2 = modelling.StructuralGap(mych.FindResidue(3),
mych.FindResidue(9), "AGTHN")
mygap3 = modelling.StructuralGap(mych.FindResidue(3),
mych.FindResidue(5), "A")
# check
modelling.MergeGaps(mhandle, 0)
modelling.MergeGaps(mhandle, 0)
self.assertEqual(len(mhandle.gaps), 1)
with self.assertRaises(RuntimeError):
modelling.ClearGaps(mhandle, mygap)
with self.assertRaises(RuntimeError):
modelling.ClearGaps(mhandle, mygap2)
with self.assertRaises(RuntimeError):
modelling.ClearGaps(mhandle, mygap3)
self.assertEqual(len(mhandle.gaps), 1)
def testClearGaps(self):
tpl = io.LoadPDB('data/2dbs.pdb')
aln = seq.CreateAlignment(
seq.CreateSequence('trg', 'TLNGFTVPAGNTLVLN---PDKG--ATVTM-A'),
seq.CreateSequence('tpl', 'N-GG-TLLI--PNGTYHFLGIQMKSNVHIRVE'))
aln.AttachView(1, tpl.CreateFullView())
# disable aln_preprocessing to also keep the small deletion in the end
mhandle = modelling.BuildRawModel(aln, aln_preprocessing=False)
# check
self.assertEqual(len(mhandle.gaps), 6)
self.assertEqual(modelling.ClearGaps(mhandle, mhandle.gaps[1]), 1)
self.assertEqual(len(mhandle.gaps), 5)
self.assertEqual(modelling.ClearGaps(mhandle, mhandle.gaps[2]), 2)
self.assertEqual(len(mhandle.gaps), 4)
# special gaps
mych = mhandle.model.chains[0]
mygap = modelling.StructuralGap(mych.FindResidue(8),
mych.FindResidue(13), "AGNT")
self.assertEqual(modelling.ClearGaps(mhandle, mygap), 1)
self.assertEqual(len(mhandle.gaps), 3)
mygap = modelling.StructuralGap(mych.FindResidue(19),
mych.FindResidue(22), "GA")
self.assertEqual(modelling.ClearGaps(mhandle, mygap), 1)
self.assertEqual(len(mhandle.gaps), 2)
mygap = modelling.StructuralGap(mych.FindResidue(25),
mych.FindResidue(27), "A")
self.assertEqual(modelling.ClearGaps(mhandle, mygap), -1)
self.assertEqual(len(mhandle.gaps), 1)
mygap = modelling.StructuralGap(mych.FindResidue(0),
mych.FindResidue(3), "TL")
self.assertEqual(modelling.ClearGaps(mhandle, mygap), -1)
self.assertEqual(len(mhandle.gaps), 0)
self.assertEqual(modelling.ClearGaps(mhandle, mygap), -1)
def testClearMultipleGaps(self):
# check that we can clear multiple gaps at once
tpl = io.LoadPDB('data/2dbs.pdb')
aln = seq.CreateAlignment(
seq.CreateSequence('trg', 'TLNGFTVPAGNTLVLN---PD--KG---ATVTMA'),
seq.CreateSequence('tpl', 'NGG--TL--LI--PNGTYHFLGIQMKSNVHIRVE'))
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# check
self.assertEqual(len(mhandle.gaps), 6)
mych = mhandle.model.chains[0]
mygap = modelling.StructuralGap(mych.FindResidue(1),
mych.FindResidue(10), "LNGFTVPA")
self.assertEqual(modelling.ClearGaps(mhandle, mygap), 0)
self.assertEqual(len(mhandle.gaps), 4)
mygap = modelling.StructuralGap(mych.FindResidue(11),
mych.FindResidue(17), "TLVLN")
self.assertEqual(modelling.ClearGaps(mhandle, mygap), 0)
self.assertEqual(len(mhandle.gaps), 2)
mygap = modelling.StructuralGap(mych.FindResidue(18),
mych.FindResidue(23), "KGAT")
self.assertEqual(modelling.ClearGaps(mhandle, mygap), -1)
self.assertEqual(len(mhandle.gaps), 0)
def testClearGapsTermnini(self):
# check that we can clear terminal gaps
tpl = io.LoadPDB('data/1mcg.pdb')
aln = seq.CreateAlignment(seq.CreateSequence('trg', 'DDFAGTHN'),
seq.CreateSequence('tpl', '--NNALF-'))
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# check
self.assertEqual(len(mhandle.gaps), 2)
self.assertEqual(modelling.ClearGaps(mhandle, mhandle.gaps[0]), 0)
self.assertEqual(len(mhandle.gaps), 1)
self.assertEqual(modelling.ClearGaps(mhandle, mhandle.gaps[0]), -1)
self.assertEqual(len(mhandle.gaps), 0)
def testClearGapsOligo(self):
# check that we can clear gaps in oligomers
tpl = io.LoadPDB('data/5d52-1.pdb')
aln_A = seq.CreateAlignment(
seq.CreateSequence('trg', 'GIVEQPAYFWPPPAHCCTSICSLYQLENYCN'),
seq.CreateSequence('tpl', 'GIVEQ----------CCTSICSLYQLENYCN'))
aln_B = seq.CreateAlignment(
seq.CreateSequence('trg', 'FVNQHLCGSGHLVEALYLVCGERGFFYTPKA'),
seq.CreateSequence('tpl', 'FVNQHLCGS-HLVEALYLVCGERGFFYTPKA'))
aln_A.AttachView(1, tpl.Select("cname=A").CreateFullView())
aln_B.AttachView(1, tpl.Select("cname=B").CreateFullView())
alns = seq.AlignmentList()
alns.append(aln_A)
alns.append(aln_B)
mhandle = modelling.BuildRawModel(alns)
# check
self.assertEqual(len(mhandle.gaps), 2)
self.assertEqual(modelling.ClearGaps(mhandle, mhandle.gaps[0]), 0)
self.assertEqual(len(mhandle.gaps), 1)
self.assertEqual(modelling.ClearGaps(mhandle, mhandle.gaps[0]), -1)
self.assertEqual(len(mhandle.gaps), 0)
#######################################################################
def testRemoveTerminalGaps(self):
# check that we can remove both terminal gaps
tpl = io.LoadPDB('data/1mcg.pdb')
aln = seq.CreateAlignment(seq.CreateSequence('trg', 'DDFAGTHN'),
seq.CreateSequence('tpl', '--NNALF-'))
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# check
self.assertEqual(len(mhandle.gaps), 2)
self.assertEqual(modelling.RemoveTerminalGaps(mhandle), 2)
self.assertEqual(len(mhandle.gaps), 0)
def testRemoveTerminalGapsN(self):
# check that we can remove N-terminal gaps
tpl = io.LoadPDB('data/1mcg.pdb')
aln = seq.CreateAlignment(seq.CreateSequence('trg', 'DDFAGTH'),
seq.CreateSequence('tpl', '--NNALF'))
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# check
self.assertEqual(len(mhandle.gaps), 1)
self.assertEqual(modelling.RemoveTerminalGaps(mhandle), 1)
self.assertEqual(len(mhandle.gaps), 0)
def testRemoveTerminalGapsC(self):
# check that we can remove C-terminal gaps
tpl = io.LoadPDB('data/1mcg.pdb')
aln = seq.CreateAlignment(seq.CreateSequence('trg', 'FAGTHN'),
seq.CreateSequence('tpl', 'NNALF-'))
aln.AttachView(1, tpl.CreateFullView())
mhandle = modelling.BuildRawModel(aln)
# check
self.assertEqual(len(mhandle.gaps), 1)
self.assertEqual(modelling.RemoveTerminalGaps(mhandle), 1)
self.assertEqual(len(mhandle.gaps), 0)
if __name__ == "__main__":
from ost import testutils
testutils.RunTests()
|