1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471
|
test_AlignIO
Testing reading clustal format file Clustalw/cw02.aln with 1 alignments
Alignment 0, with 2 sequences of length 601
MENSDSNDKGSDQSAAQRRSQMDRLDREEAFYQFVN...SVV gi|4959044|gb|AAD34209.1|AF069
---------MSPQTETKASVGFKAGVKEYKLTYYTP...--- gi|671626|emb|CAA85685.1|
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading clustal format file Clustalw/opuntia.aln with 1 alignments
Alignment 0, with 7 sequences of length 156
TTTTTTT alignment column 0
AAAAAAA alignment column 1
TTTTTTT alignment column 2
AAAAAAA alignment column 3
CCCCCCC alignment column 4
||||||| ...
AAAAAAA alignment column 155
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading clustal format file Clustalw/hedgehog.aln with 1 alignments
Alignment 0, with 5 sequences of length 447
M---- alignment column 0
F---- alignment column 1
N---- alignment column 2
L---- alignment column 3
V---- alignment column 4
||||| ...
---SS alignment column 446
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading clustal format file Clustalw/odd_consensus.aln with 1 alignments
Alignment 0, with 2 sequences of length 687
------------------------------------...TAG AT3G20900.1-CDS
ATGAACAAAGTAGCGAGGAAGAACAAAACATCAGGT...TAG AT3G20900.1-SEQ
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Failed: Repeated identifier, possibly due to truncation
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading clustal format file Clustalw/protein.aln with 1 alignments
Alignment 0, with 20 sequences of length 411
-M------------------ alignment column 0
-T------------------ alignment column 1
-V------------------ alignment column 2
-L-----------------M alignment column 3
-E---------------MMS alignment column 4
|||||||||||||||||||| ...
-------------------T alignment column 410
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Failed: Repeated identifier, possibly due to truncation
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading clustal format file Clustalw/promals3d.aln with 1 alignments
Alignment 0, with 20 sequences of length 414
MMMMMMMMMMMMMMMM-M-- alignment column 0
-----------------T-- alignment column 1
-----------------V-- alignment column 2
-----------------L-- alignment column 3
-S---------------E-- alignment column 4
|||||||||||||||||||| ...
-T------------------ alignment column 413
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Failed: Repeated identifier, possibly due to truncation
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading fasta format file GFF/multi.fna with 1 alignments
Alignment 0, with 3 sequences of length 8
ACGTCGCG test1
GGGGCCCC test2
AAACACAC test3
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading nexus format file Nexus/test_Nexus_input.nex with 1 alignments
Alignment 0, with 9 sequences of length 48
AAAAAAAAc alignment column 0
-----c?tc alignment column 1
CCCCCCCCc alignment column 2
--c-?a-tc alignment column 3
GGGGGGGGc alignment column 4
||||||||| ...
tt--?ag?c alignment column 47
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading stockholm format file Stockholm/simple.sth with 1 alignments
Alignment 0, with 2 sequences of length 104
UUAAUCGAGCUCAACACUCUUCGUAUAUCCUC-UCA...UGU AP001509.1
AAAAUUGAAUAUCGUUUUACUUGUUUAU-GUCGUGA...GAU AE007476.1
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading stockholm format file Stockholm/funny.sth with 1 alignments
Alignment 0, with 5 sequences of length 43
MMMEE alignment column 0
TQIVV alignment column 1
CHEMM alignment column 2
RVALL alignment column 3
ASDTT alignment column 4
||||| ...
SYSEE alignment column 42
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading phylip format file Phylip/reference_dna.phy with 1 alignments
Alignment 0, with 6 sequences of length 13
CCTTCG alignment column 0
GGAAAG alignment column 1
ATAAAC alignment column 2
TTTTAA alignment column 3
GAGGAG alignment column 4
|||||| ...
CTTTTC alignment column 12
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading phylip format file Phylip/reference_dna2.phy with 1 alignments
Alignment 0, with 6 sequences of length 39
CCTTCG alignment column 0
GGAAAG alignment column 1
ATAAAC alignment column 2
TTTTAA alignment column 3
GAGGAG alignment column 4
|||||| ...
CTTTTC alignment column 38
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading phylip format file Phylip/hennigian.phy with 1 alignments
Alignment 0, with 10 sequences of length 40
CCCCCAAAAA alignment column 0
AAAAACCCCC alignment column 1
CCCAAAAAAA alignment column 2
AAACCAAAAA alignment column 3
CCAAAAAAAA alignment column 4
|||||||||| ...
AAAAAAAAAA alignment column 39
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading phylip format file Phylip/horses.phy with 1 alignments
Alignment 0, with 10 sequences of length 40
AACCCCCCCC alignment column 0
AAAACCCCCC alignment column 1
AAAAAAAAAC alignment column 2
ACAAAAAAAA alignment column 3
ACACCCCCCC alignment column 4
|||||||||| ...
AAAAAAAAAA alignment column 39
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading phylip format file Phylip/random.phy with 1 alignments
Alignment 0, with 10 sequences of length 40
CAAAACAAAC alignment column 0
AACAACCACC alignment column 1
CAAAACAAAA alignment column 2
ACAACACACA alignment column 3
CCAAAACCAA alignment column 4
|||||||||| ...
AAAAAAAAAA alignment column 39
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading phylip format file Phylip/interlaced.phy with 1 alignments
Alignment 0, with 3 sequences of length 384
-----MKVILLFVLAVFTVFVSS-------------...I-- CYS1_DICDI
MAHARVLLLALAVLATAAVAVASSSSFADSNPIRPV...VAA ALEU_HORVU
------MWATLPLLCAGAWLLGV--------PVCGA...PLV CATH_HUMAN
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading phylip format file Phylip/interlaced2.phy with 1 alignments
Alignment 0, with 4 sequences of length 131
TSPASIRPPAGPSSRPAMVSSRRTRPSPPGPRRPTG...SHE IXI_234
TSPASIRPPAGPSSR---------RPSPPGPRRPTG...SHE IXI_235
TSPASIRPPAGPSSRPAMVSSR--RPSPPPPRRPPG...SHE IXI_236
TSPASLRPPAGPSSRPAMVSSRR-RPSPPGPRRPT-...SHE IXI_237
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading emboss format file Emboss/alignret.txt with 1 alignments
Alignment 0, with 4 sequences of length 131
TSPASIRPPAGPSSRPAMVSSRRTRPSPPGPRRPTG...SHE IXI_234
TSPASIRPPAGPSSR---------RPSPPGPRRPTG...SHE IXI_235
TSPASIRPPAGPSSRPAMVSSR--RPSPPPPRRPPG...SHE IXI_236
TSPASLRPPAGPSSRPAMVSSRR-RPSPPGPRRPT-...SHE IXI_237
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading emboss format file Emboss/needle.txt with 5 alignments
Alignment 0, with 2 sequences of length 124
KILIVDD----QYGIRILLNEVFNKEGYQTFQAANG...--- ref_rec
-VLLADDHALVRRGFRLMLED--DPEIEIVAEAGDG...GET gi|94968718|receiver
Alignment 1, with 2 sequences of length 119
KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQAL...--- ref_rec
-ILIVDDEANTLASLSRAFRLAGHEATVCDNAVRAL...LKR gi|94968761|receiver
Alignment 2, with 2 sequences of length 120
-KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQA...--- ref_rec
LHIVVVDDDPGTCVYIESVFAELGHTCKSFVRPEAA...HKE gi|94967506|receiver
...
Alignment 4, with 2 sequences of length 125
KILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQAL...--- ref_rec
TVLLVEDEEGVRKLVRGILSRQGYHVLEATSGEEAL...KRQ gi|94970041|receiver
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: We can only write one Alignment to a Nexus file.
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading emboss format file Emboss/needle_asis.txt with 1 alignments
Alignment 0, with 2 sequences of length 3653
TATTTTTTGGATTTTTTTCTAGATTTTCTAGGTTAT...GAA asis
------------------------------------...GAA asis
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Failed: Repeated identifier, possibly due to truncation
Checking can write/read as 'stockholm' format
Failed: Duplicate record identifier: asis
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading emboss format file Emboss/water.txt with 1 alignments
Alignment 0, with 2 sequences of length 131
TSPASIRPPAGPSSRPAMVSSRRTRPSPPGPRRPTG...SHE IXI_234
TSPASIRPPAGPSSR---------RPSPPGPRRPTG...SHE IXI_235
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading emboss format file Emboss/water2.txt with 1 alignments
Alignment 0, with 2 sequences of length 18
CGTTTGAGT-CTGGGATG asis
CGTTTGAGTACTGGGATG asis
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Failed: Repeated identifier, possibly due to truncation
Checking can write/read as 'stockholm' format
Failed: Duplicate record identifier: asis
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading emboss format file Emboss/matcher_simple.txt with 1 alignments
Alignment 0, with 2 sequences of length 16
GPPPQSPDENRAGESS AF069992_1
GVPPEEAGAAVAAESS CAA85685.1
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading emboss format file Emboss/matcher_pair.txt with 5 alignments
Alignment 0, with 2 sequences of length 145
LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFP...SKY HBA_HUMAN
LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYP...HKY HBB_HUMAN
Alignment 1, with 2 sequences of length 13
KKVADALTNAVAH HBA_HUMAN
QKVVAGVANALAH HBB_HUMAN
Alignment 2, with 2 sequences of length 18
KLRVDPVNFKLLSHCLLV HBA_HUMAN
KVNVDEVGGEALGRLLVV HBB_HUMAN
...
Alignment 4, with 2 sequences of length 10
VKAAWGKVGA HBA_HUMAN
VQAAYQKVVA HBB_HUMAN
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: We can only write one Alignment to a Nexus file.
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading fasta-m10 format file Fasta/output001.m10 with 4 alignments
Alignment 0, with 2 sequences of length 108
SGSNT-RRRAISRPVRLTAEED---QEIRKRAAECG...LSR gi|10955263|ref|NP_052604.1|
AGSGAPRRRGSGLASRISEQSEALLQEAAKHAAEFG...LSR gi|152973457|ref|YP_001338508.1|
Alignment 1, with 2 sequences of length 64
AAECGKTVSGFLRAAALGKKVNSLTDDRVLKEV-MR...AIT gi|10955263|ref|NP_052604.1|
ASRQGCTVGG--KMDSVQDKASDKDKERVMKNINIM...TLT gi|152973588|ref|YP_001338639.1|
Alignment 2, with 2 sequences of length 38
MKKDKKYQIEAIKNKDKTLFIVYATDIYSPSEFFSKIE gi|10955264|ref|NP_052605.1|
IKKDLGVSFLKLKNREKTLIVDALKKKYPVAELLSVLQ gi|152973462|ref|YP_001338513.1|
Alignment 3, with 2 sequences of length 43
SELHSKLPKSIDKIHEDIKKQLSC-SLIMKKIDVEM...TYC gi|10955265|ref|NP_052606.1|
SRINSDVARRIPGIHRDPKDRLSSLKQVEEALDMLI...EYC gi|152973545|ref|YP_001338596.1|
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: We can only write one Alignment to a Nexus file.
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading fasta-m10 format file Fasta/output002.m10 with 6 alignments
Alignment 0, with 2 sequences of length 88
SGSNTRRRAISRPVR--LTAEEDQEIRKRAAECG-K...AEV gi|10955263|ref|NP_052604.1|
SQRSTRRKPENQPTRVILFNKPYDVLPQFTDEAGRK...VQV gi|162139799|ref|NP_309634.2|
Alignment 1, with 2 sequences of length 53
EIRKRAAECGKTVSGFLRAAA-LGKKV----NSLTD...KKL gi|10955263|ref|NP_052604.1|
EIKPRGTSKGEAIAAFMQEAPFIGRTPVFLGDDLTD...VKI gi|15831859|ref|NP_310632.1|
Alignment 2, with 2 sequences of length 92
SEFFSKIESDLKKKKSKGDVFFDLIIPNG-----GK...ATS gi|10955264|ref|NP_052605.1|
TELNSELAKAMKVDAQRG-AFVSQVLPNSSAAKAGI...QSS gi|15829419|ref|NP_308192.1|
...
Alignment 5, with 2 sequences of length 157
QYIMTTSNGDRVRAKIYKRGSIQFQGKYLQIASLIN...REI gi|10955265|ref|NP_052606.1|
EFIRLLSDHDQFEKDQISELTVAANALKLEVAK--N...KKV gi|15833861|ref|NP_312634.1|
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: We can only write one Alignment to a Nexus file.
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading fasta-m10 format file Fasta/output003.m10 with 3 alignments
Alignment 0, with 2 sequences of length 55
ISISNNKDQYEELQKEQGERDLKTVDQLVRIAAAGG...IAA gi|152973837|ref|YP_001338874.1|
VRLTAEEDQ--EIRKRAAECG-KTVSGFLRAAALGK...LGA gi|10955263|ref|NP_052604.1|
Alignment 1, with 2 sequences of length 22
DDAEHLFRTLSSR-LDALQDGN gi|152973840|ref|YP_001338877.1|
DDRANLFEFLSEEGITITEDNN gi|10955265|ref|NP_052606.1|
Alignment 2, with 2 sequences of length 63
VFGSFEQPKGEHLSGQVSEQ--RDTAFADQNEQVIR...QAM gi|152973841|ref|YP_001338878.1|
VYTSFN---GEKFSSYTLNKVTKTDEYNDLSELSAS...KGI gi|10955264|ref|NP_052605.1|
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: We can only write one Alignment to a Nexus file.
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading fasta-m10 format file Fasta/output004.m10 with 1 alignments
Alignment 0, with 2 sequences of length 102
AAAAAAGATAAAAAATATCAAATAGAAGCAATAAAA...TCA ref|NC_002127.1|:c1351-971
AGAGAAAATAAAACAAGTAATAAAATATTAATGGAA...ACA ref|NC_002695.1|:1970775-1971404
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Failed: Repeated identifier, possibly due to truncation
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading fasta-m10 format file Fasta/output005.m10 with 1 alignments
Alignment 0, with 2 sequences of length 110
IKNKDKTLFIVYAT-DIYSPSEFFSKIESDLKKKKS...LSK gi|10955264|ref|NP_052605.1|
IKDELPVAFCSWASLDLECEVKYINDVTSLYAKDWM...MSE gi|10955282|ref|NP_052623.1|
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading fasta-m10 format file Fasta/output006.m10 with 1 alignments
Alignment 0, with 2 sequences of length 131
GCAACGCTTCAAGAACTGGAATTAGGAACCGTGACA...CAT query
GCAACGCTTCAAGAACTGGAATTAGGAACCGTGACA...CAT gi|116660610|gb|EG558221.1|EG558221
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading ig format file IntelliGenetics/VIF_mase-pro.txt with 1 alignments
Alignment 0, with 16 sequences of length 298
MMMMMMMMMMMMMMMM alignment column 0
EEEEEEETEEEENEEE alignment column 1
NNNNNNNAEEEEQRKK alignment column 2
--------DEEEEE-- alignment column 3
--------KKKKKK-- alignment column 4
|||||||||||||||| ...
HHHHHHH-AAAAL-R- alignment column 297
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Failed: Need a DNA, RNA or Protein alphabet
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Testing reading pir format file NBRF/clustalw.pir with 1 alignments
Alignment 0, with 2 sequences of length 2527
------------------------------------...--- 804Angiostrongylus_cantonensis
------------------------------------...--- 815Parelaphostrongylus_odocoil
Checking can write/read as 'clustal' format
Checking can write/read as 'nexus' format
Checking can write/read as 'phylip' format
Checking can write/read as 'stockholm' format
Checking can write/read as 'fasta' format
Checking can write/read as 'tab' format
Finished tested reading files
|