1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133
|
# Copyright 2007-2009 by Peter Cock. All rights reserved.
# This code is part of the Biopython distribution and governed by its
# license. Please see the LICENSE file that should have been included
# as part of this package.
import os
from Bio.SeqUtils import GC, quick_FASTA_reader
from Bio.SeqUtils.CheckSum import crc32, crc64, gcg, seguid
from Bio.SeqUtils.lcc import lcc_simp, lcc_mult
from Bio.SeqUtils.CodonUsage import CodonAdaptationIndex
from Bio.SeqRecord import SeqRecord
from Bio.Seq import Seq, MutableSeq
from Bio.Alphabet import single_letter_alphabet
from Bio import SeqIO
######################
# quick_FASTA_reader #
######################
dna_fasta_filename = "Fasta/f002"
tuple_records = quick_FASTA_reader(dna_fasta_filename)
assert len(tuple_records)==3
seq_records = list(SeqIO.parse(open(dna_fasta_filename),"fasta"))
assert len(seq_records)==3
for tuple_record, seq_record in zip(tuple_records, seq_records):
assert tuple_record == (seq_record.description, seq_record.seq.tostring())
print "%s has GC%% of %0.1f" % (seq_record.name, GC(seq_record.seq))
##############
# CodonUsage #
##############
print
print "Codon Adaption Index (CAI)"
CAI = CodonAdaptationIndex()
# Note - this needs a whole number of codons, and a DNA seq AS A STRING.
print "Example CAI %0.5f using E. coli (default)" \
% CAI.cai_for_gene("ATGCGTATCGATCGCGATACGATTAGGCGGATG")
#We need a FASTA file of CDS sequences to count the codon usage...
dna_fasta_filename = "fasta.tmp"
dna_genbank_filename = "GenBank/NC_005816.gb"
record = SeqIO.read(open(dna_genbank_filename), "genbank")
records = []
for feature in record.features:
if feature.type == "CDS" \
and not feature.sub_features:
start = feature.location.start.position
end = feature.location.end.position
table = int(feature.qualifiers["transl_table"][0])
if feature.strand == -1:
seq = record.seq[start:end].reverse_complement()
else:
seq = record.seq[start:end]
#Double check we have the CDS sequence expected
#TODO - Use any cds_start option if/when added to deal with the met
assert "M" + str(seq[3:].translate(table)) \
== feature.qualifiers["translation"][0]+"*"
records.append(SeqRecord(seq, id=feature.qualifiers["protein_id"][0],
description=feature.qualifiers["product"][0]))
del start, end, table, seq
if os.path.isfile(dna_fasta_filename):
os.remove(dna_fasta_filename)
handle = open(dna_fasta_filename, "w")
SeqIO.write(records, handle, "fasta")
handle.close()
CAI = CodonAdaptationIndex()
# Note - this needs a FASTA file which containing non-ambiguous DNA coding
# sequences - which should each be a whole number of codons.
CAI.generate_index(dna_fasta_filename)
print "Example CAI %0.5f using %s" \
% (CAI.cai_for_gene("ATGCGTATCGATCGCGATACGATTAGGCGGATG"),
record.annotations["source"])
os.remove(dna_fasta_filename)
del record, records
del dna_genbank_filename
del dna_fasta_filename
print
###################
# crc64 collision #
###################
# Example of crc64 collision from Sebastian Bassi using the
# immunoglobulin lambda light chain variable region from Homo sapiens
# Both sequences share the same CRC64 checksum: 44CAAD88706CC153
str_light_chain_one = "QSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGK" \
+ "APKLMIYEGSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADY" \
+ "YCSSYAGSSTLVFGGGTKLTVL"
str_light_chain_two = "QSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGK" \
+ "APKLMIYEGSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADY" \
+ "YCCSYAGSSTWVFGGGTKLTVL"
#Explicit testing of crc64 collision:
assert str_light_chain_one != str_light_chain_two
assert crc32(str_light_chain_one) != crc32(str_light_chain_two)
assert crc64(str_light_chain_one) == crc64(str_light_chain_two)
assert gcg(str_light_chain_one) != gcg(str_light_chain_two)
assert seguid(str_light_chain_one) != seguid(str_light_chain_two)
###########################
# main checksum/LCC tests #
###########################
#Print some output, which the test harness will check
examples = [str_light_chain_one, str_light_chain_two,
"ATGCGTATCGATCGCGATACGATTAGGCGGAT"]
for i, seq_str in enumerate(examples):
print "Example %i, length %i, %s..." % (i+1, len(seq_str), seq_str[:10])
#Avoid cross platforms with printing floats by doing conversion explicitly
def simple_LCC(s):
return "%0.2f" % lcc_simp(s)
def windowed_LCC(s):
return ", ".join(["%0.2f" % v for v in lcc_mult(s,20)])
for checksum in [crc32, crc64, gcg, seguid, simple_LCC, windowed_LCC]:
#First using a string:
value = checksum(seq_str)
print " %s = %s" % (checksum.__name__, value)
#Secondly check it works with a Seq object
assert value == checksum(Seq(seq_str, single_letter_alphabet))
#Finally check it works with a MutableSeq object
assert value == checksum(MutableSeq(seq_str, single_letter_alphabet))
|