1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442
|
# Copyright 2000-2002 by Andrew Dalke.
# Revisions copyright 2007-2010 by Peter Cock.
# All rights reserved.
# This code is part of the Biopython distribution and governed by its
# license. Please see the LICENSE file that should have been included
# as part of this package.
"""Alphabets used in Seq objects etc to declare sequence type and letters.
This is used by sequences which contain a finite number of similar words.
"""
class Alphabet(object):
"""Generic alphabet base class.
This class is used as a base class for other types of alphabets.
Attributes:
letters -- list-like object containing the letters of the alphabet.
Usually it is a string when letters are single characters.
size -- size of the alphabet's letters (e.g. 1 when letters are
single characters).
"""
size = None # default to no fixed size for words
letters = None # default to no fixed alphabet
# In general, a list-like object. However,
# assuming letters are single characters, use a
# string. This is expected for use with Seq like
# objects.
def __repr__(self):
return self.__class__.__name__ + "()"
def contains(self, other):
"""Does this alphabet 'contain' the other (OBSOLETE?).
Returns a boolean. This relies on the Alphabet subclassing
hierarchy only, and does not check the letters property.
This isn't ideal, and doesn't seem to work as intended
with the AlphabetEncoder classes."""
return isinstance(other, self.__class__)
def _case_less(self):
"""Return a case-less variant of the current alphabet (PRIVATE)."""
#TODO - remove this method by dealing with things in subclasses?
if isinstance(self, ProteinAlphabet):
return generic_protein
elif isinstance(self, DNAAlphabet):
return generic_dna
elif isinstance(self, RNAAlphabet):
return generic_rna
elif isinstance(self, NucleotideAlphabet):
return generic_nucleotide
elif isinstance(self, SingleLetterAlphabet):
return single_letter_alphabet
else:
return generic_alphabet
def _upper(self):
"""Return an upper case variant of the current alphabet (PRIVATE)."""
if not self.letters or self.letters==self.letters.upper():
#Easy case, no letters or already upper case!
return self
else:
#TODO - Raise NotImplementedError and handle via subclass?
return self._case_less()
def _lower(self):
"""Return a lower case variant of the current alphabet (PRIVATE)."""
if not self.letters or self.letters==self.letters.lower():
#Easy case, no letters or already lower case!
return self
else:
#TODO - Raise NotImplementedError and handle via subclass?
return self._case_less()
generic_alphabet = Alphabet()
class SingleLetterAlphabet(Alphabet):
"""Generic alphabet with letters of size one."""
size = 1
letters = None # string of all letters in the alphabet
single_letter_alphabet = SingleLetterAlphabet()
########### Protein
class ProteinAlphabet(SingleLetterAlphabet):
"""Generic single letter protein alphabet."""
pass
generic_protein = ProteinAlphabet()
########### DNA
class NucleotideAlphabet(SingleLetterAlphabet):
"""Generic single letter nucleotide alphabet."""
pass
generic_nucleotide = NucleotideAlphabet()
class DNAAlphabet(NucleotideAlphabet):
"""Generic single letter DNA alphabet."""
pass
generic_dna = DNAAlphabet()
########### RNA
class RNAAlphabet(NucleotideAlphabet):
"""Generic single letter RNA alphabet."""
pass
generic_rna = RNAAlphabet()
########### Other per-sequence encodings
class SecondaryStructure(SingleLetterAlphabet):
"""Alphabet used to describe secondary structure.
Letters are 'H' (helix), 'S' (strand), 'T' (turn) and 'C' (coil).
"""
letters = "HSTC"
class ThreeLetterProtein(Alphabet):
"""Three letter protein alphabet."""
size = 3
letters = [
"Ala", "Asx", "Cys", "Asp", "Glu", "Phe", "Gly", "His", "Ile",
"Lys", "Leu", "Met", "Asn", "Pro", "Gln", "Arg", "Ser", "Thr",
"Sec", "Val", "Trp", "Xaa", "Tyr", "Glx",
]
###### Non per-sequence modifications
# (These are Decorator classes)
class AlphabetEncoder(object):
def __init__(self, alphabet, new_letters):
self.alphabet = alphabet
self.new_letters = new_letters
if alphabet.letters is not None:
self.letters = alphabet.letters + new_letters
else:
self.letters = None
def __getattr__(self, key):
if key[:2] == "__" and key[-2:] == "__":
raise AttributeError(key)
return getattr(self.alphabet, key)
def __repr__(self):
return "%s(%r, %r)" % (self.__class__.__name__, self.alphabet,
self.new_letters)
def contains(self, other):
"""Does this alphabet 'contain' the other (OBSOLETE?).
This is isn't implemented for the base AlphabetEncoder,
which will always return 0 (False)."""
return 0
def _upper(self):
"""Return an upper case variant of the current alphabet (PRIVATE)."""
return AlphabetEncoder(self.alphabet._upper(), self.new_letters.upper())
def _lower(self):
"""Return a lower case variant of the current alphabet (PRIVATE)."""
return AlphabetEncoder(self.alphabet._lower(), self.new_letters.lower())
class Gapped(AlphabetEncoder):
def __init__(self, alphabet, gap_char = "-"):
AlphabetEncoder.__init__(self, alphabet, gap_char)
self.gap_char = gap_char
def contains(self, other):
"""Does this alphabet 'contain' the other (OBSOLETE?).
Returns a boolean. This relies on the Alphabet subclassing
hierarchy, and attempts to check the gap character. This fails
if the other alphabet does not have a gap character!
"""
return other.gap_char == self.gap_char and \
self.alphabet.contains(other.alphabet)
def _upper(self):
"""Return an upper case variant of the current alphabet (PRIVATE)."""
return Gapped(self.alphabet._upper(), self.gap_char.upper())
def _lower(self):
"""Return a lower case variant of the current alphabet (PRIVATE)."""
return Gapped(self.alphabet._lower(), self.gap_char.lower())
class HasStopCodon(AlphabetEncoder):
def __init__(self, alphabet, stop_symbol = "*"):
AlphabetEncoder.__init__(self, alphabet, stop_symbol)
self.stop_symbol = stop_symbol
def __cmp__(self, other):
x = cmp(self.alphabet, other.alphabet)
if x == 0:
return cmp(self.stop_symbol, other.stop_symbol)
return x
def contains(self, other):
"""Does this alphabet 'contain' the other (OBSOLETE?).
Returns a boolean. This relies on the Alphabet subclassing
hierarchy, and attempts to check the stop symbol. This fails
if the other alphabet does not have a stop symbol!
"""
return other.stop_symbol == self.stop_symbol and \
self.alphabet.contains(other.alphabet)
def _upper(self):
"""Return an upper case variant of the current alphabet (PRIVATE)."""
return HasStopCodon(self.alphabet._upper(), self.stop_symbol.upper())
def _lower(self):
"""Return a lower case variant of the current alphabet (PRIVATE)."""
return HasStopCodon(self.alphabet._lower(), self.stop_symbol.lower())
def _get_base_alphabet(alphabet):
"""Returns the non-gapped non-stop-codon Alphabet object (PRIVATE)."""
a = alphabet
while isinstance(a, AlphabetEncoder):
a = a.alphabet
assert isinstance(a, Alphabet), \
"Invalid alphabet found, %s" % repr(a)
return a
def _ungap(alphabet):
"""Returns the alphabet without any gap encoder (PRIVATE)."""
#TODO - Handle via method of the objects?
if not hasattr(alphabet, "gap_char"):
return alphabet
elif isinstance(alphabet, Gapped):
return alphabet.alphabet
elif isinstance(alphabet, HasStopCodon):
return HasStopCodon(_ungap(alphabet.alphabet), stop_symbol=alphabet.stop_symbol)
elif isinstance(alphabet, AlphabetEncoder):
return AlphabetEncoder(_ungap(alphabet.alphabet), letters=alphabet.letters)
else:
raise NotImplementedError
def _consensus_base_alphabet(alphabets):
"""Returns a common but often generic base alphabet object (PRIVATE).
This throws away any AlphabetEncoder information, e.g. Gapped alphabets.
Note that DNA+RNA -> Nucleotide, and Nucleotide+Protein-> generic single
letter. These DO NOT raise an exception!"""
common = None
for alpha in alphabets:
a = _get_base_alphabet(alpha)
if common is None:
common = a
elif common == a:
pass
elif isinstance(a, common.__class__):
pass
elif isinstance(common, a.__class__):
common = a
elif isinstance(a, NucleotideAlphabet) \
and isinstance(common, NucleotideAlphabet):
#e.g. Give a mix of RNA and DNA alphabets
common = generic_nucleotide
elif isinstance(a, SingleLetterAlphabet) \
and isinstance(common, SingleLetterAlphabet):
#This is a pretty big mis-match!
common = single_letter_alphabet
else:
#We have a major mis-match... take the easy way out!
return generic_alphabet
if common is None:
#Given NO alphabets!
return generic_alphabet
return common
def _consensus_alphabet(alphabets):
"""Returns a common but often generic alphabet object (PRIVATE).
>>> from Bio.Alphabet import IUPAC
>>> _consensus_alphabet([IUPAC.extended_protein, IUPAC.protein])
ExtendedIUPACProtein()
>>> _consensus_alphabet([generic_protein, IUPAC.protein])
ProteinAlphabet()
Note that DNA+RNA -> Nucleotide, and Nucleotide+Protein-> generic single
letter. These DO NOT raise an exception!
>>> _consensus_alphabet([generic_dna, generic_nucleotide])
NucleotideAlphabet()
>>> _consensus_alphabet([generic_dna, generic_rna])
NucleotideAlphabet()
>>> _consensus_alphabet([generic_dna, generic_protein])
SingleLetterAlphabet()
>>> _consensus_alphabet([single_letter_alphabet, generic_protein])
SingleLetterAlphabet()
This is aware of Gapped and HasStopCodon and new letters added by
other AlphabetEncoders. This WILL raise an exception if more than
one gap character or stop symbol is present.
>>> from Bio.Alphabet import IUPAC
>>> _consensus_alphabet([Gapped(IUPAC.extended_protein), HasStopCodon(IUPAC.protein)])
HasStopCodon(Gapped(ExtendedIUPACProtein(), '-'), '*')
>>> _consensus_alphabet([Gapped(IUPAC.protein, "-"), Gapped(IUPAC.protein, "=")])
Traceback (most recent call last):
...
ValueError: More than one gap character present
>>> _consensus_alphabet([HasStopCodon(IUPAC.protein, "*"), HasStopCodon(IUPAC.protein, "+")])
Traceback (most recent call last):
...
ValueError: More than one stop symbol present
"""
base = _consensus_base_alphabet(alphabets)
gap = None
stop = None
new_letters = ""
for alpha in alphabets:
#Gaps...
if not hasattr(alpha, "gap_char"):
pass
elif gap is None:
gap = alpha.gap_char
elif gap == alpha.gap_char:
pass
else:
raise ValueError("More than one gap character present")
#Stops...
if not hasattr(alpha, "stop_symbol"):
pass
elif stop is None:
stop = alpha.stop_symbol
elif stop == alpha.stop_symbol:
pass
else:
raise ValueError("More than one stop symbol present")
#New letters...
if hasattr(alpha, "new_letters"):
for letter in alpha.new_letters:
if letter not in new_letters \
and letter != gap and letter != stop:
new_letters += letter
alpha = base
if new_letters:
alpha = AlphabetEncoder(alpha, new_letters)
if gap:
alpha = Gapped(alpha, gap_char=gap)
if stop:
alpha = HasStopCodon(alpha, stop_symbol=stop)
return alpha
def _check_type_compatible(alphabets):
"""Returns True except for DNA+RNA or Nucleotide+Protein (PRIVATE).
>>> _check_type_compatible([generic_dna, generic_nucleotide])
True
>>> _check_type_compatible([generic_dna, generic_rna])
False
>>> _check_type_compatible([generic_dna, generic_protein])
False
>>> _check_type_compatible([single_letter_alphabet, generic_protein])
True
This relies on the Alphabet subclassing hierarchy. It does not
check things like gap characters or stop symbols."""
dna, rna, nucl, protein = False, False, False, False
for alpha in alphabets:
a = _get_base_alphabet(alpha)
if isinstance(a, DNAAlphabet):
dna = True
nucl = True
if rna or protein:
return False
elif isinstance(a, RNAAlphabet):
rna = True
nucl = True
if dna or protein:
return False
elif isinstance(a, NucleotideAlphabet):
nucl = True
if protein:
return False
elif isinstance(a, ProteinAlphabet):
protein = True
if nucl:
return False
return True
def _verify_alphabet(sequence):
"""Check all letters in sequence are in the alphabet (PRIVATE).
>>> from Bio.Seq import Seq
>>> from Bio.Alphabet import IUPAC
>>> my_seq = Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF",
... IUPAC.protein)
>>> _verify_alphabet(my_seq)
True
This example has an X, which is not in the IUPAC protein alphabet
(you should be using the IUPAC extended protein alphabet):
>>> bad_seq = Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFX",
... IUPAC.protein)
>>> _verify_alphabet(bad_seq)
False
This replaces Bio.utils.verify_alphabet() since we are deprecating
that. Potentially this could be added to the Alphabet object, and
I would like it to be an option when creating a Seq object... but
that might slow things down.
"""
letters = sequence.alphabet.letters
if not letters:
raise ValueError("Alphabet does not define letters.")
for letter in sequence:
if letter not in letters:
return False
return True
|