1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484
|
# /opt/fasta/fasta34 -m 10 -y 10 -X "-13 -17" -Q -d 2 NC_002127.faa NC_002695.faa
FASTA searches a protein or DNA sequence data bank
version 34.26 January 12, 2007
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query library NC_002127.faa vs NC_002695.faa library
searching NC_002695.faa library
1>>>gi|10955263|ref|NP_052604.1| plasmid mobilization [Escherichia coli O157:H7 s 107 aa - 107 aa
vs NC_002695.faa library
opt E()
< 20 1 0:=
22 0 0: one = represents 8 library sequences
24 0 0:
26 0 0:
28 1 1:*
30 4 7:*
32 32 28:===*
34 87 76:=========*=
36 180 156:===================*===
38 308 258:================================*======
40 354 359:============================================*
42 471 439:======================================================*====
44 458 484:========================================================== *
46 412 493:==================================================== *
48 450 472:========================================================= *
50 430 431:=====================================================*
52 380 379:===============================================*
54 301 324:====================================== *
56 272 270:=================================*
58 218 222:===========================*
60 191 180:======================*=
62 152 144:=================*=
64 133 115:==============*==
66 99 91:===========*=
68 84 71:========*==
70 53 56:======*
72 54 44:=====*=
74 27 34:====*
76 20 26:===*
78 24 21:==*
80 15 16:=*
82 6 12:=*
84 11 10:=*
86 5 7:*
88 4 6:* inset = represents 1 library sequences
90 2 4:*
92 8 3:* :==*=====
94 2 3:* :==*
96 1 2:* :=*
98 2 2:* :=*
100 0 1:* :*
102 0 1:* :*
104 0 1:* :*
106 0 1:* :*
108 0 0: *
110 1 0:= *=
112 0 0: *
114 0 0: *
116 0 0: *
118 0 0: *
>120 0 0: *
1578204 residues in 5253 sequences
Expectation_n fit: rho(ln(x))= 4.3805+/-0.00127; mu= 8.3307+/- 0.071
mean_var=55.5989+/-11.432, 0's: 1 Z-trim: 1 B-trim: 0 in 0/43
Lambda= 0.172005
Kolmogorov-Smirnov statistic: 0.0215 (N=29) at 42
FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2
join: 36, opt: 24, open/ext: -10/-2, width: 10
Scan time: 0.200
The best scores are: opt bits E(5253)
gi|162139799|ref|NP_309634.2| 23S rRNA pseudouridi ( 207) 77 26.5 1.2
gi|15831859|ref|NP_310632.1| trehalose-6-phosphate ( 266) 69 24.6 5.8
gi|15832986|ref|NP_311759.1| EivE [Escherichia col ( 381) 70 25.0 6.4
gi|15829430|ref|NP_308203.1| undecaprenyl pyrophos ( 253) 67 24.1 7.9
gi|15832380|ref|NP_311153.1| sn-glycerol-3-phospha ( 542) 69 24.9 9.9
>>>gi|10955263|ref|NP_052604.1|, 107 aa vs NC_002695.faa library
; pg_name: /opt/fasta/fasta34
; pg_ver: 34.26
; pg_argv: /opt/fasta/fasta34 -m 10 -y 10 -X -13 -17 -Q -d 2 NC_002127.faa NC_002695.faa
; pg_name: FASTA
; pg_ver: 3.5 Sept 2006
; pg_matrix: BL50 (15:-5)
; pg_open-ext: -10 -2
; pg_ktup: 2
; pg_optcut: 24
; pg_cgap: 36
; mp_extrap: 60000 5253
; mp_stats: Expectation_n fit: rho(ln(x))= 4.3805+/-0.00127; mu= 8.3307+/- 0.071 mean_var=55.5989+/-11.432, 0's: 1 Z-trim: 1 B-trim: 0 in 0/43 Lambda= 0.172005
; mp_KS: 0.0215 (N=29) at 42
>>gi|162139799|ref|NP_309634.2| 23S rRNA pseudouridine synthase E [Escherichia coli O157:H7 str. Sakai]
; fa_frame: f
; fa_initn: 55
; fa_init1: 55
; fa_opt: 77
; fa_z-score: 110.8
; fa_bits: 26.5
; fa_expect: 1.2
; sw_score: 77
; sw_ident: 0.284
; sw_sim: 0.545
; sw_overlap: 88
>gi|10955263| ..
; sq_len: 107
; sq_offset: 1
; sq_type: p
; al_start: 5
; al_stop: 89
; al_display_start: 1
-----------MTKRSGSNTRRRAISRPVR--LTAEEDQEIRKRAAECG-
KTVSGFLRAAALGKKVNSLTDDRVLKEVMRLGALQKKLFIDGKRVGDREY
AEVLIAITEYHRALLSRLMAD
>gi|162139799|ref|NP_309634.2| ..
; sq_len: 207
; sq_type: p
; al_start: 16
; al_stop: 103
; al_display_start: 1
MQKTSFRNHQVKRFSSQRSTRRKPENQPTRVILFNKPYDVLPQFTDEAGR
KTLKEFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYY
VQVEGIPTQDALEALRNGVTLNDGPTLPAGAELVDEPAWLWPRNPPIRER
KSIPTSWLKITLYEGRNRQVRRMTAHVGFP
>>gi|15831859|ref|NP_310632.1| trehalose-6-phosphate phosphatase [Escherichia coli O157:H7 str. Sakai]
; fa_frame: f
; fa_initn: 43
; fa_init1: 43
; fa_opt: 69
; fa_z-score: 98.6
; fa_bits: 24.6
; fa_expect: 5.8
; sw_score: 69
; sw_ident: 0.283
; sw_sim: 0.660
; sw_overlap: 53
>gi|10955263| ..
; sq_len: 107
; sq_offset: 1
; sq_type: p
; al_start: 27
; al_stop: 74
; al_display_start: 1
----MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRAA
A-LGKKV----NSLTDDRVLKEVMRLGALQKKLFIDGKRVGDREYAEVLI
AITEYHRALLSRLMAD
>gi|15831859|ref|NP_310632.1| ..
; sq_len: 266
; sq_type: p
; al_start: 167
; al_stop: 219
; al_display_start: 137
PQHEDALMTLAQRITQIWPQMALQQGKCVVEIKPRGTSKGEAIAAFMQEA
PFIGRTPVFLGDDLTDESGFAVVNRLGGMSVKIGTGATQASWRLAGVPDV
WSWLEMITTALQQKRENNRS
2>>>gi|10955264|ref|NP_052605.1| hypothetical protein pOSAK1_02 [Escherichia coli O157:H7 s 126 aa - 126 aa
vs NC_002695.faa library
opt E()
< 20 0 0:
22 0 0: one = represents 9 library sequences
24 0 0:
26 0 0:
28 0 1:*
30 3 7:*
32 10 28:== *
34 57 76:======= *
36 184 156:=================*===
38 286 258:============================*===
40 413 359:=======================================*======
42 455 439:================================================*==
44 512 484:=====================================================*===
46 456 493:=================================================== *
48 451 472:=================================================== *
50 400 431:============================================= *
52 333 379:===================================== *
54 341 324:===================================*==
56 289 270:=============================*===
58 191 222:====================== *
60 178 180:===================*
62 153 144:===============*=
64 102 115:============*
66 95 91:==========*
68 71 71:=======*
70 45 56:===== *
72 58 44:====*==
74 46 34:===*==
76 33 26:==*=
78 21 21:==*
80 21 16:=*=
82 14 12:=*
84 5 10:=*
86 6 7:*
88 2 6:* inset = represents 1 library sequences
90 3 4:*
92 6 3:* :==*===
94 5 3:* :==*==
96 2 2:* :=*
98 2 2:* :=*
100 1 1:* :*
102 1 1:* :*
104 1 1:* :*
106 1 1:* :*
108 0 0: *
110 0 0: *
112 0 0: *
114 0 0: *
116 0 0: *
118 0 0: *
>120 0 0: *
1578204 residues in 5253 sequences
Expectation_n fit: rho(ln(x))= 3.9868+/-0.00133; mu= 9.5505+/- 0.074
mean_var=58.9770+/-12.363, 0's: 0 Z-trim: 0 B-trim: 194 in 1/42
Lambda= 0.167006
Kolmogorov-Smirnov statistic: 0.0212 (N=29) at 44
FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2
join: 36, opt: 24, open/ext: -10/-2, width: 10
Scan time: 0.180
The best scores are: opt bits E(5253)
gi|15829419|ref|NP_308192.1| serine endoprotease [ ( 474) 77 27.0 2.3
gi|15832592|ref|NP_311365.1| phosphoribosylaminoim ( 237) 74 26.0 2.4
gi|15833483|ref|NP_312256.1| DNA adenine methylase ( 278) 72 25.6 3.7
gi|15831563|ref|NP_310336.1| NAD(P) transhydrogena ( 510) 73 26.1 4.7
gi|15834523|ref|NP_313296.1| hypothetical protein ( 404) 71 25.5 5.6
gi|15829964|ref|NP_308737.1| glutaminyl-tRNA synth ( 554) 72 25.9 5.8
gi|15831153|ref|NP_309926.1| putative LACI-type tr ( 332) 69 24.9 6.9
gi|15832760|ref|NP_311533.1| hypothetical lipoprot ( 131) 65 23.5 7.2
gi|15830381|ref|NP_309154.1| hypothetical protein ( 60) 61 22.2 8.4
gi|15831794|ref|NP_310567.1| carboxy-terminal prot ( 682) 70 25.5 9.4
gi|15830925|ref|NP_309698.1| hypothetical protein ( 122) 63 23.0 9.6
>>>gi|10955264|ref|NP_052605.1|, 126 aa vs NC_002695.faa library
; pg_name: /opt/fasta/fasta34
; pg_ver: 34.26
; pg_argv: /opt/fasta/fasta34 -m 10 -y 10 -X -13 -17 -Q -d 2 NC_002127.faa NC_002695.faa
; pg_name: FASTA
; pg_ver: 3.5 Sept 2006
; pg_matrix: BL50 (15:-5)
; pg_open-ext: -10 -2
; pg_ktup: 2
; pg_optcut: 24
; pg_cgap: 36
; mp_extrap: 60000 5253
; mp_stats: Expectation_n fit: rho(ln(x))= 3.9868+/-0.00133; mu= 9.5505+/- 0.074 mean_var=58.9770+/-12.363, 0's: 0 Z-trim: 0 B-trim: 194 in 1/42 Lambda= 0.167006
; mp_KS: 0.0212 (N=29) at 44
>>gi|15829419|ref|NP_308192.1| serine endoprotease [Escherichia coli O157:H7 str. Sakai]
; fa_frame: f
; fa_initn: 64
; fa_init1: 40
; fa_opt: 77
; fa_z-score: 105.8
; fa_bits: 27.0
; fa_expect: 2.3
; sw_score: 77
; sw_ident: 0.250
; sw_sim: 0.620
; sw_overlap: 92
>gi|10955264| ..
; sq_len: 126
; sq_offset: 1
; sq_type: p
; al_start: 31
; al_stop: 117
; al_display_start: 1
MKKDKKYQIEAIKNKDKTLFIVYATDIYSPSEFFSKIESDLKKKKSKGDV
FFDLIIPNG-----GKKDRYVYTSFNGEKFSSYTLNKVTKTDEYNDLSEL
SASFFKKNFDKINVNLLSKATSFALKKGIPI
>gi|15829419|ref|NP_308192.1| ..
; sq_len: 474
; sq_type: p
; al_start: 296
; al_stop: 384
; al_display_start: 266
FAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRG-A
FVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRA-QVGTMPVGSKL
TLGLLRDG-KQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVV
VNNVKTGTPAAQIGLKKGDVIIGANQQAVK
>>gi|15832592|ref|NP_311365.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Escherichia coli O157:H7 str. Sakai]
; fa_frame: f
; fa_initn: 73
; fa_init1: 45
; fa_opt: 74
; fa_z-score: 105.5
; fa_bits: 26.0
; fa_expect: 2.4
; sw_score: 74
; sw_ident: 0.274
; sw_sim: 0.589
; sw_overlap: 73
>gi|10955264| ..
; sq_len: 126
; sq_offset: 1
; sq_type: p
; al_start: 51
; al_stop: 123
; al_display_start: 21
IVYATDIYSPSEFFSKIESDLKKKKSKGDVFFDLIIPNGGKKDRYVYTSF
NGEKFSSYTLNKVTKTDEYNDLSELSASFFKKNFDKINVNLLSKATSFAL
KKGIPI
>gi|15832592|ref|NP_311365.1| ..
; sq_len: 237
; sq_type: p
; al_start: 117
; al_stop: 185
; al_display_start: 87
VPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESY
C-ETFGWVSKENLARMKE---LTYKANDVLKKLFDDAGLILVDFKLEFGL
YKGEVVLGDEFSPDGSRLWDKETLEKMDKDRFRQSLGGLIEAYEAVARRL
GVQLD
3>>>gi|10955265|ref|NP_052606.1| hypothetical protein pOSAK1_03 [Escherichia coli O157:H7 s 346 aa - 346 aa
vs NC_002695.faa library
opt E()
< 20 0 0:
22 0 0: one = represents 9 library sequences
24 0 0:
26 0 0:
28 0 1:*
30 8 7:*
32 20 28:===*
34 81 76:========*
36 147 156:=================*
38 283 258:============================*===
40 380 359:=======================================*===
42 450 439:================================================*=
44 480 484:=====================================================*
46 496 493:======================================================*=
48 467 472:====================================================*
50 444 431:===============================================*==
52 370 379:==========================================*
54 315 324:===================================*
56 271 270:=============================*=
58 218 222:========================*
60 154 180:================== *
62 143 144:===============*
64 114 115:============*
66 83 91:==========*
68 77 71:=======*=
70 51 56:======*
72 55 44:====*==
74 28 34:===*
76 27 26:==*
78 21 21:==*
80 13 16:=*
82 15 12:=*
84 7 10:=*
86 6 7:*
88 7 6:* inset = represents 1 library sequences
90 3 4:*
92 3 3:* :==*
94 2 3:* :==*
96 1 2:* :=*
98 3 2:* :=*=
100 0 1:* :*
102 3 1:* :*==
104 1 1:* :*
106 2 1:* :*=
108 0 0: *
110 2 0:= *==
112 1 0:= *=
114 0 0: *
116 1 0:= *=
118 0 0: *
>120 0 0: *
1578204 residues in 5253 sequences
Expectation_n fit: rho(ln(x))= 4.3951+/-0.00131; mu= 12.1593+/- 0.073
mean_var=61.9743+/-12.803, 0's: 0 Z-trim: 1 B-trim: 15 in 1/42
Lambda= 0.162918
Kolmogorov-Smirnov statistic: 0.0096 (N=29) at 50
FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2
join: 37, opt: 25, open/ext: -10/-2, width: 10
Scan time: 0.350
The best scores are: opt bits E(5253)
gi|38704138|ref|NP_311957.2| hypothetical protein ( 111) 86 28.6 0.51
gi|15833861|ref|NP_312634.1| hypothetical protein ( 330) 87 29.2 0.95
gi|15830902|ref|NP_309675.1| host specificity prot (1132) 90 30.4 1.4
gi|15830597|ref|NP_309370.1| TerW [Escherichia col ( 155) 81 27.5 1.5
gi|15830637|ref|NP_309410.1| hypothetical protein ( 171) 80 27.3 1.9
gi|15832101|ref|NP_310874.1| putative UDP-galactos ( 331) 82 28.1 2.2
gi|15830086|ref|NP_308859.1| putative minor tail p ( 192) 79 27.1 2.4
gi|15833543|ref|NP_312316.1| putative regulator [E ( 345) 80 27.6 3.1
gi|15833652|ref|NP_312425.1| putative cytochrome C ( 465) 81 28.0 3.2
gi|15830726|ref|NP_309499.1| acyl carrier protein ( 78) 72 25.1 3.9
gi|15832800|ref|NP_311573.1| transcriptional repre ( 176) 74 25.9 5
gi|15830949|ref|NP_309722.1| hypothetical protein ( 93) 70 24.7 6.1
gi|15831415|ref|NP_310188.1| putative host specifi (1159) 81 28.3 6.2
gi|15831371|ref|NP_310144.1| predicted lipoprotein (1343) 81 28.4 6.9
gi|15831965|ref|NP_310738.1| hypothetical protein ( 216) 71 25.3 9.5
>>>gi|10955265|ref|NP_052606.1|, 346 aa vs NC_002695.faa library
; pg_name: /opt/fasta/fasta34
; pg_ver: 34.26
; pg_argv: /opt/fasta/fasta34 -m 10 -y 10 -X -13 -17 -Q -d 2 NC_002127.faa NC_002695.faa
; pg_name: FASTA
; pg_ver: 3.5 Sept 2006
; pg_matrix: BL50 (15:-5)
; pg_open-ext: -10 -2
; pg_ktup: 2
; pg_optcut: 25
; pg_cgap: 37
; mp_extrap: 60000 5253
; mp_stats: Expectation_n fit: rho(ln(x))= 4.3951+/-0.00131; mu= 12.1593+/- 0.073 mean_var=61.9743+/-12.803, 0's: 0 Z-trim: 1 B-trim: 15 in 1/42 Lambda= 0.162918
; mp_KS: 0.0096 (N=29) at 50
>>gi|38704138|ref|NP_311957.2| hypothetical protein ECs3930 [Escherichia coli O157:H7 str. Sakai]
; fa_frame: f
; fa_initn: 50
; fa_init1: 50
; fa_opt: 86
; fa_z-score: 117.5
; fa_bits: 28.6
; fa_expect: 0.51
; sw_score: 86
; sw_ident: 0.302
; sw_sim: 0.635
; sw_overlap: 63
>gi|10955265| ..
; sq_len: 346
; sq_offset: 1
; sq_type: p
; al_start: 188
; al_stop: 246
; al_display_start: 158
YLQIASLINDFMCSILNMKEIVEQKNKEFNVDIKK-ETIESELHSKLPKS
IDKIHEDIKKQLSCSLI--MKKID-VEMEDYSTYCFSALRAIEGFIYQIL
NDVCNPSSSKNLGEYFTENKPKYIIREIHQETINGEIAEVLCECYTYWHE
NRHGLFHMKPGIADTKTINKLESIAIIDTV
>gi|38704138|ref|NP_311957.2| ..
; sq_len: 111
; sq_type: p
; al_start: 14
; al_stop: 76
; al_display_start: 1
-----------------MALNTYQYRETTMIDPKKIEQIARQVHESMPKG
IREFGEDVEKKIRQTLQAQLTRLDLVSREEFDVQTQVLLRTREKLALLEQ
RSSELEARNNSVADLQSPPAIPPIDKAE
>>gi|15833861|ref|NP_312634.1| hypothetical protein ECs4607 [Escherichia coli O157:H7 str. Sakai]
; fa_frame: f
; fa_initn: 32
; fa_init1: 32
; fa_opt: 87
; fa_z-score: 112.7
; fa_bits: 29.2
; fa_expect: 0.95
; sw_score: 87
; sw_ident: 0.210
; sw_sim: 0.580
; sw_overlap: 157
>gi|10955265| ..
; sq_len: 346
; sq_offset: 1
; sq_type: p
; al_start: 131
; al_stop: 281
; al_display_start: 101
DDDRANLFEFLSEEGITITEDNNNDPNCKHQYIMTTSNGDRVRAKIYKRG
SIQFQGKYLQIASLINDFMCSILNMKEIVEQKNKEFNVDI---KKETI-E
SELHSKLPKSIDKIHEDIKKQLSCSLIMKKIDV-EMEDYSTYCFSALRA-
IEGFIYQILNDVCNPSSSKNLGEYFTENKPKYIIREIHQETINGEIAEVL
CECYTYWHENRHGLFHMKPGIADTKTINKLESIAIIDTVC
>gi|15833861|ref|NP_312634.1| ..
; sq_len: 330
; sq_type: p
; al_start: 10
; al_stop: 155
; al_display_start: 1
---------------------MDFSGRNVKEFIRLLSDHDQFEKDQISEL
TVAANALKLEVAK--NNY-----NMKYSFDTQTERRMIELIREQKDLIPE
KYLHQSGIKKL-KLHED---EFSSLLVDAERQVLEGSSFVLCCGEKINST
ISELLSKKITDLTHPTESFTLSEYFSYDVYEEIFKKVVFTPGECDLVRDS
LVQDGIKPEKIAKIISCLSSRTGIRNLFYACSQAFHVAND
>>><<<
579 residues in 3 query sequences
1578204 residues in 5253 library sequences
Scomplib [34.26]
start: Fri May 23 14:05:39 2008 done: Fri May 23 14:05:40 2008
Total Scan time: 0.730 Total Display time: 0.000
Function used was FASTA [version 34.26 January 12, 2007]
|