1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320
|
LOCUS ATCOR66M 513 bp mRNA PLN 02-MAR-1992
DEFINITION A.thaliana cor6.6 mRNA.
ACCESSION X55053
VERSION X55053.1 GI:16229
KEYWORDS antifreeze protein homology; cold-regulated gene; cor6.6 gene; KIN1
homology.
SOURCE thale cress.
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons;
Rosidae; Capparales; Brassicaceae; Arabidopsis.
REFERENCE 1 (bases 1 to 513)
AUTHORS Thomashow,M.F.
TITLE Direct Submission
JOURNAL Submitted (01-FEB-1991) M.F. Thomashow, Dept. Crop and Soil
Sciences, Dept. Microbiology, Michigan State University, East
Lansing, Michigan 48824, USA
REFERENCE 2 (bases 1 to 513)
AUTHORS Gilmour,S.J., Artus,N.N. and Thomashow,M.F.
TITLE cDNA sequence analysis and expression of two cold-regulated genes
of Arabidopsis thaliana
JOURNAL Plant Mol. Biol. 18 (1), 13-21 (1992)
MEDLINE 92119220
COMMENT Cor6.6 homologous to KIN1. KIN1 is a cold-regulated Arabidopsis
gene with suggested similarity to type I fish antifreeze proteins.
FEATURES Location/Qualifiers
source 1..513
/organism="Arabidopsis thaliana"
/strain="Columbia"
/db_xref="taxon:3702"
gene 50..250
/gene="cor6.6"
CDS 50..250
/gene="cor6.6"
/note="cold regulated"
/codon_start=1
/protein_id="CAA38894.1"
/db_xref="GI:16230"
/db_xref="SWISS-PROT:P31169"
/translation="MSETNKNAFQAGQAAGKAEEKSNVLLDKAKDAAAAAGASAQQAG
KSISDAAVGGVNFVKDKTGLNK"
BASE COUNT 194 a 82 c 104 g 133 t
ORIGIN
1 aacaaaacac acatcaaaaa cgattttaca agaaaaaaat atctgaaaaa tgtcagagac
61 caacaagaat gccttccaag ccggtcaggc cgctggcaaa gctgaggaga agagcaatgt
121 tctgctggac aaggccaagg atgctgctgc tgcagctgga gcttccgcgc aacaggcggg
181 aaagagtata tcggatgcgg cagtgggagg tgttaacttc gtgaaggaca agaccggcct
241 gaacaagtag cgatccgagt caactttggg agttataatt tcccttttct aattaattgt
301 tgggattttc aaataaaatt tgggagtcat aattgattct cgtactcatc gtacttgttg
361 ttgtttttag tgttgtaatg ttttaatgtt tcttctccct ttagatgtac tacgtttgga
421 actttaagtt taatcaacaa aatctagttt aagttctaaa aaaaaaaaaa aaaaaaaaaa
481 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa
//
LOCUS ATKIN2 880 bp DNA PLN 23-JUL-1992
DEFINITION A.thaliana kin2 gene.
ACCESSION X62281
VERSION X62281.1 GI:16353
KEYWORDS kin2 gene.
SOURCE thale cress.
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons;
Rosidae; Capparales; Brassicaceae; Arabidopsis.
REFERENCE 1 (bases 1 to 880)
AUTHORS Borg-Franck,M.E.
TITLE Direct Submission
JOURNAL Submitted (27-SEP-1991) M.E. Borg-Franck, Inst of Biotechnology,
University of Helsinki, Karvaamokuja 3, SF-00380 Helsinki, FINLAND
REFERENCE 2 (bases 1 to 880)
AUTHORS Kurkela,S. and Borg-Franck,M.
TITLE Structure and expression of kin2, one of two cold- and ABA-induced
genes of Arabidopsis thaliana
JOURNAL Plant Mol. Biol. 19 (4), 689-692 (1992)
MEDLINE 92329728
FEATURES Location/Qualifiers
source 1..880
/organism="Arabidopsis thaliana"
/strain="ssp. L. Heynh, Colombia"
/db_xref="taxon:3702"
TATA_signal 9..20
exon 44..160
/gene="kin2"
/number=1
prim_transcript 44..>579
/gene="kin2"
mRNA join(44..160,320..390,504..>579)
/gene="kin2"
gene 44..579
/gene="kin2"
CDS join(104..160,320..390,504..579)
/gene="kin2"
/codon_start=1
/protein_id="CAA44171.1"
/db_xref="GI:16354"
/db_xref="SWISS-PROT:P31169"
/translation="MSETNKNAFQAGQAAGKAERRRAMFCWTRPRMLLLQLELPRNRA
GKSISDAAVGGVNFVKDKTGLNK"
intron 161..319
/gene="kin2"
/number=1
exon 320..390
/gene="kin2"
/number=2
intron 391..503
/gene="kin2"
/number=2
exon 504..>579
/gene="kin2"
/number=3
polyA_signal 620..625
polyA_signal 641..646
polyA_site 785
polyA_site 800
BASE COUNT 263 a 155 c 160 g 302 t
ORIGIN
1 atttggccta taaatataaa cccttaagcc cacatatctt ctcaatccat cacaaacaaa
61 acacacatca aaaacgattt tacaagaaaa aaatatctga aaaatgtcag agaccaacaa
121 gaatgccttc caagccggtc aggccgctgg caaagctgag gtactctttc tctcttagaa
181 cagagtactg atagattgtt caagttataa ctctttgaaa acagttgaaa cttgatcact
241 cctagaactt ccattttctt gtttaattta gtttgtcgta attatgtaat tgattttgtg
301 ttgaccatgg ttgttatata ggagaagagc aatgttctgc tggacaaggc caaggatgct
361 gctgctgcag ctggagcttc cgcgcaacag gtaaacgatc tatacacaca ttatgacatt
421 tatgtaaaga atgaaaagtc ttcttagagc atacatttac gcagatttct gatattttca
481 tatggtttga tgtaaatgtt ataggcggga aagagtatat cggatgcggc agtgggaggt
541 gttaacttcg tgaaggacaa gaccggcctg aacaagtagc gatccgagtc aactttggga
601 gttataattt cccttttcta attaattgtt gggattttca aataaaattt gggagtcata
661 attgattctc gtactcatcg tacttgttgt tgtttttagt gttgtaatgt tttaatgttt
721 cttctccctt tagatgtact acgtttggaa ctttaagttt aatcaacaaa atctagttta
781 agttctaaga actttgtttt accatcctct tttttattgc acttaatgct tatagacttt
841 tatctccatc catttctcaa ttcggctacg ttgaattata
//
LOCUS BNAKINI 441 bp mRNA PLN 27-APR-1993
DEFINITION Rapeseed Kin1 protein (kin1) mRNA, complete cds.
ACCESSION M81224
VERSION M81224.1 GI:167145
KEYWORDS .
SOURCE Brassica napus (cultivar Jet neuf) cold induced leaf cDNA to mRNA.
ORGANISM Brassica napus
Eukaryota; Viridiplantae; Embryophyta; Tracheophyta; Spermatophyta;
Magnoliophyta; eudicotyledons; core eudicots; Rosidae; eurosids II;
Brassicales; Brassicaceae; Brassica.
REFERENCE 1 (bases 1 to 441)
AUTHORS Orr,W., Iu,B., White,T., Robert,L.S. and Singh,J.
TITLE Nucleotide sequence of a winter B. napus Kin 1 cDNA
JOURNAL Plant Physiol. 98, 1532-1534 (1992)
FEATURES Location/Qualifiers
source 1..441
/organism="Brassica napus"
/cultivar="Jet neuf"
/db_xref="taxon:3708"
/dev_stage="cold induced"
/tissue_type="leaf"
gene 34..300
/gene="kin1"
CDS 34..231
/gene="kin1"
/codon_start=1
/evidence=experimental
/protein_id="AAA32993.1"
/db_xref="GI:167146"
/translation="MADNKQSFQAGQASGRAEEKGNVLMDKVKDAATAAGASAQTAGQ
KITEAAGGAVNLVKEKTGMNK"
polyA_signal 241..247
/gene="kin1"
/note="putative"
polyA_signal 294..300
/gene="kin1"
/note="putative"
polyA_site 441
/gene="kin1"
BASE COUNT 129 a 76 c 110 g 126 t
ORIGIN
1 aaaaaaacac aacaaaactc aataaataaa caaatggcag acaacaagca gagcttccaa
61 gccggtcaag cctctggtcg tgctgaggag aagggtaatg tgctgatgga caaggtcaag
121 gatgctgcta ccgcagctgg agcgtctgcg caaaccgcgg gacagaagat aacggaggcg
181 gcagggggag ccgttaatct cgtgaaggag aagaccggca tgaacaagta gccccattgg
241 aaataaaatt gggagttata gtttcccttt ttaatgttaa tcgttgtggt tttaaataaa
301 aattgggtgt tctaattgat cttcaccgta gttgttgttg ttgttgtttt tagtgtttga
361 agtaatgttt tcaaccttta ggtgtatgtc ttgatgttta tgtacttagt tcccccttaa
421 tgaacatctg atttaagctt c
//
LOCUS ARU237582 206 bp DNA PLN 24-MAR-1999
DEFINITION Armoracia rusticana csp14 gene (partial), exons 2-3.
ACCESSION AJ237582
VERSION AJ237582.1 GI:4538892
KEYWORDS cold shock protein; csp14 gene.
SOURCE horseradish.
ORGANISM Armoracia rusticana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
euphyllophytes; Spermatophyta; Magnoliophyta; eudicotyledons;
Rosidae; Capparales; Brassicaceae; Armoracia.
REFERENCE 1 (bases 1 to 206)
AUTHORS Baymiev,A.K., Gimalov,F.R. and Vakhitov,V.A.
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 206)
AUTHORS Baymiev,A.K.
TITLE Direct Submission
JOURNAL Submitted (20-MAR-1999) Baymiev A.K., Departament of Biochemistry
and Cytochemistry, Ufa Scientific Centre, pr. Oktyabrya 69, Ufa,
Bashkortostan, Russia, 450054, RUSSIA
FEATURES Location/Qualifiers
source 1..206
/organism="Armoracia rusticana"
/db_xref="taxon:3704"
/country="Russia:Bashkortostan"
mRNA join(<1..48,143..>206)
/gene="csp14"
exon 1..48
/gene="csp14"
/number=2
gene 1..206
/gene="csp14"
CDS join(<1..48,143..>206)
/gene="csp14"
/codon_start=2
/product="cold shock protein"
/protein_id="CAB39890.1"
/db_xref="GI:4538893"
/translation="DKAKDAAAAAGASAQQAGKNISDAAAGGVNFVKEKTG"
intron 49..142
/gene="csp14"
/number=2
exon 143..206
/gene="csp14"
/number=3
BASE COUNT 65 a 38 c 53 g 48 t 2 others
ORIGIN
1 ggacaaggcc aaggatgctg ctgctgcagc tggagcttcc gcgcaacaag taaacagata
61 cacacacatg acacatatat aantacatat cacaagtagg tcgtagattt ctgatatntt
121 tgtattgtgt attacgtata taggcgggaa agaacatatc ggatgcagca gctggaggtg
181 ttaacttcgt gaaggagaag accggc
//
LOCUS BRRBIF72 282 bp mRNA PLN 01-MAR-1996
DEFINITION Brassica rapa (clone bif72) kin mRNA, complete cds.
ACCESSION L31939
VERSION L31939.1 GI:1209261
KEYWORDS .
SOURCE Brassica rapa flower cDNA to mRNA.
ORGANISM Brassica rapa
Eukaryota; Viridiplantae; Embryophyta; Tracheophyta; Spermatophyta;
Magnoliophyta; eudicotyledons; core eudicots; Rosidae; eurosids II;
Brassicales; Brassicaceae; Brassica.
REFERENCE 1 (bases 1 to 282)
AUTHORS Kim,J.-B., Kim,H.-U., Park,B.-S., Yun,C.-H., Cho,W.-S., Ryu,J.-C.
and Chung,T.-Y.
TITLE Nucleotide sequences of kin gene in chinese cabbage
JOURNAL Unpublished (1994)
FEATURES Location/Qualifiers
source 1..282
/organism="Brassica rapa"
/db_xref="taxon:3711"
/dev_stage="flower"
gene 24..221
/gene="kin"
CDS 24..221
/gene="kin"
/codon_start=1
/protein_id="AAA91051.1"
/db_xref="GI:1209262"
/translation="MADNKQSFQAGQAAGRAEEKGNVLLMDKVKDAATAAGALQTAGQ
KITEAAGGAVNLVKEKTGMNK"
BASE COUNT 88 a 56 c 80 g 58 t
ORIGIN
1 aacaaaactc aataaataaa caaatggcag acaacaagca gagcttccaa gccggtcaag
61 ccgctggtcg tgctgaggag aagggtaatg tgctgctgat ggacaaggtc aaggatgctg
121 ctaccgcagc tggagctctc caaaccgcgg gacagaagat aacggaggcg gcagggggag
181 ccgttaatct cgtgaaggag aagaccggca tgaacaagta gccccattgg aaacaaaatt
241 gggagttata gtttcctttt taatattaat cgttgtggtt tt
//
LOCUS AF297471 497 bp DNA PLN 14-SEP-2000
DEFINITION Brassica napus BN28a (BN28a) gene, complete cds.
ACCESSION AF297471
VERSION AF297471.1 GI:10121868
KEYWORDS .
SOURCE rape.
ORGANISM Brassica napus
Eukaryota; Viridiplantae; Embryophyta; Tracheophyta; Spermatophyta;
Magnoliophyta; eudicotyledons; core eudicots; Rosidae; eurosids II;
Brassicales; Brassicaceae; Brassica.
REFERENCE 1 (bases 1 to 497)
AUTHORS Byass,L.J. and Flanagan,A.M.
TITLE BN28a, a low temperature-induced gene of Brassica napus
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 497)
AUTHORS Byass,L.J. and Flanagan,A.M.
TITLE Direct Submission
JOURNAL Submitted (18-AUG-2000) AFNS, University of Alberta, 4-10
Agriculture/Forestry Centre, Edmonton, Alberta T6G 2P5, Canada
FEATURES Location/Qualifiers
source 1..497
/organism="Brassica napus"
/cultivar="Cascade"
/db_xref="taxon:3708"
mRNA join(<1..54,241..309,423..>497)
/gene="BN28a"
/product="BN28a"
gene <1..>497
/gene="BN28a"
CDS join(1..54,241..309,423..497)
/gene="BN28a"
/note="low temperature-induced; similar to Brassica napus
Kin1 in Accession Number M81224"
/codon_start=1
/product="BN28a"
/protein_id="AAG13407.1"
/db_xref="GI:10121869"
/translation="MADNKQSFQAGQAAGRAEEKGNVLMDKVKDAATAAGASAQTAGQ
KITEAAGGAVNLVKEKTGMNK"
BASE COUNT 155 a 89 c 116 g 137 t
ORIGIN
1 atggcagaca acaagcagag cttccaagcc ggtcaagccg ctggtcgtgc tgaggtctct
61 ttctctcttt aactctctga tcaaatgcag ttgctgcggt taaacaatca cactttataa
121 aataaagaga agttatttat attttcttga accaagtaaa tgaatgtatt ttgaccaaaa
181 aaagaagaag taaatgaatg tattaattga tttcgtgtgg acaatggtgt gtaaatatag
241 gagaagggta atgtgctgat ggacaaggtc aaggatgctg ctaccgcagc tggagcgtct
301 gcgcaaaccg taagcgatct accccatgat atataaataa acatacgtct ctactctcta
361 ctgtacatgt tcgtagatct catatctttt tatgctgttc taacatgtat ttacgtttat
421 aggcgggaca gaagataacg gaggcggcag ggggagccgt taatctcgtg aaggagaaga
481 ccggcatgaa caagtag
//
|