1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100
|
<?xml version="1.0" encoding="UTF-8"?>
<uniprot xmlns="http://uniprot.org/uniprot"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry version="21" modified="2009-07-07" dataset="Swiss-Prot" created="2009-06-16">
<accession>Q91G55</accession>
<name>043L_IIV6</name>
<protein>
<recommendedName>
<fullName>Uncharacterized protein 043L</fullName>
</recommendedName>
</protein>
<gene>
<name type="ORF">IIV6-043L</name>
</gene>
<organism key="1">
<name type="scientific">Invertebrate iridescent virus 6</name>
<name type="common">IIV-6</name>
<name type="synonym">Chilo iridescent virus</name>
<dbReference type="NCBI Taxonomy" key="2" id="176652"/>
<lineage>
<taxon>Viruses</taxon>
<taxon>dsDNA viruses, no RNA stage</taxon>
<taxon>Iridoviridae</taxon>
<taxon>Iridovirus</taxon>
</lineage>
</organism>
<organismHost key="3">
<name type="scientific">Acheta domesticus</name>
<name type="common">House cricket</name>
<dbReference type="NCBI Taxonomy" key="4" id="6997"/>
</organismHost>
<organismHost key="5">
<name type="scientific">Chilo suppressalis</name>
<name type="common">striped riceborer</name>
<dbReference type="NCBI Taxonomy" key="6" id="168631"/>
</organismHost>
<organismHost key="7">
<name type="scientific">Gryllus bimaculatus</name>
<name type="common">Two-spotted cricket</name>
<dbReference type="NCBI Taxonomy" key="8" id="6999"/>
</organismHost>
<organismHost key="9">
<name type="scientific">Gryllus campestris</name>
<dbReference type="NCBI Taxonomy" key="10" id="58607"/>
</organismHost>
<organismHost key="11">
<name type="scientific">Spodoptera frugiperda</name>
<name type="common">Fall armyworm</name>
<dbReference type="NCBI Taxonomy" key="12" id="7108"/>
</organismHost>
<reference key="13">
<citation volume="286" type="journal article" name="Virology" last="196" first="182" date="2001">
<title>Analysis of the first complete DNA sequence of an invertebrate iridovirus: coding strategy of the genome of Chilo iridescent virus.</title>
<authorList>
<person name="Jakob N.J."/>
<person name="Mueller K."/>
<person name="Bahr U."/>
<person name="Darai G."/>
</authorList>
<dbReference type="DOI" key="14" id="10.1006/viro.2001.0963"/>
<dbReference type="MEDLINE" key="15" id="21342589"/>
<dbReference type="PubMed" key="16" id="11448171"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]</scope>
</reference>
<reference key="17">
<citation volume="4" type="journal article" name="Virol. J." last="11" first="11" date="2007">
<title>Comparative genomic analysis of the family Iridoviridae: re-annotating and defining the core set of iridovirus genes.</title>
<authorList>
<person name="Eaton H.E."/>
<person name="Metcalf J."/>
<person name="Penny E."/>
<person name="Tcherepanov V."/>
<person name="Upton C."/>
<person name="Brunetti C.R."/>
</authorList>
<dbReference type="DOI" key="18" id="10.1186/1743-422X-4-11"/>
<dbReference type="PubMed" key="19" id="17239238"/>
</citation>
<scope>GENOME REANNOTATION</scope>
</reference>
<dbReference type="EMBL" key="20" id="AF303741">
<property value="AAK81977.1" type="protein sequence ID"/>
<property value="Genomic_DNA" type="molecule type"/>
</dbReference>
<dbReference type="RefSeq" key="21" id="NP_149506.1"/>
<dbReference type="GeneId" key="22" id="1733003"/>
<proteinExistence type="Predicted"/>
<keyword id="KW-0181">Complete proteome</keyword>
<keyword id="KW-1019">Virus reference strain</keyword>
<feature type="chain" id="PRO_0000377969" description="Uncharacterized protein 043L">
<location>
<begin position="1"/>
<end position="116"/>
</location>
</feature>
<sequence version="1" modified="2001-12-01" mass="13673" length="116" checksum="4A29B35FB716523C">MDLINNKLNIEIQKFCLDLEKKYNINYNNLIDLWFNKESTERLIKCEVNLENKIKFNQKYNSDTIKIMNILFLICSDGVFGKIENNDVKPLTDEDEKICVKFGYKIMIGCLNDIPI</sequence>
</entry>
</uniprot>
|