1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186
|
<?xml version='1.0' encoding='UTF-8'?>
<uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry dataset="TrEMBL" created="2011-05-31" modified="2015-01-07" version="17">
<accession>F2CXE6</accession>
<name>F2CXE6_HORVD</name>
<protein>
<submittedName>
<fullName evidence="3">Plasma membrane intrinsic protein</fullName>
</submittedName>
<submittedName>
<fullName evidence="2">Predicted protein</fullName>
</submittedName>
</protein>
<gene>
<name type="primary" evidence="3">HvPIP2;8</name>
</gene>
<organism evidence="2">
<name type="scientific">Hordeum vulgare var. distichum</name>
<name type="common">Domesticated barley</name>
<dbReference type="NCBI Taxonomy" id="112509"/>
<lineage>
<taxon>Eukaryota</taxon>
<taxon>Viridiplantae</taxon>
<taxon>Streptophyta</taxon>
<taxon>Embryophyta</taxon>
<taxon>Tracheophyta</taxon>
<taxon>Spermatophyta</taxon>
<taxon>Magnoliophyta</taxon>
<taxon>Liliopsida</taxon>
<taxon>Poales</taxon>
<taxon>Poaceae</taxon>
<taxon>BEP clade</taxon>
<taxon>Pooideae</taxon>
<taxon>Triticeae</taxon>
<taxon>Hordeum</taxon>
</lineage>
</organism>
<reference key="1" evidence="2">
<citation type="journal article" date="2010" name="Plant Physiol." volume="156" first="20" last="28">
<title>Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries.</title>
<authorList>
<person name="Matsumoto T."/>
<person name="Tanaka T."/>
<person name="Sakai H."/>
<person name="Amano N."/>
<person name="Kanamori H."/>
<person name="Kurita K."/>
<person name="Kikuta A."/>
<person name="Kamiya K."/>
<person name="Yamamoto M."/>
<person name="Ikawa H."/>
<person name="Fujii N."/>
<person name="Hori K."/>
<person name="Itoh T."/>
<person name="Sato K."/>
</authorList>
<dbReference type="PubMed" id="21415278"/>
<dbReference type="DOI" id="10.1104/pp.110.171579"/>
</citation>
<scope>NUCLEOTIDE SEQUENCE</scope>
<source>
<tissue evidence="2">Shoot</tissue>
</source>
</reference>
<reference key="2" evidence="3">
<citation type="journal article" date="2011" name="Plant Signal. Behav." volume="7" first="1648" last="1652">
<title>Functional characterization of a novel plasma membrane intrinsic protein2 in barley.</title>
<authorList>
<person name="Shibasaka M."/>
<person name="Sasano S."/>
<person name="Utsugi S."/>
<person name="Katsuhara M."/>
</authorList>
</citation>
<scope>NUCLEOTIDE SEQUENCE</scope>
<source>
<tissue evidence="3">Shoot</tissue>
</source>
</reference>
<reference key="3" evidence="3">
<citation type="submission" date="2013-02" db="EMBL/GenBank/DDBJ databases">
<authorList>
<person name="Shibasaka M."/>
<person name="Katsuhara M."/>
<person name="Sasano S."/>
</authorList>
</citation>
<scope>NUCLEOTIDE SEQUENCE</scope>
<source>
<tissue evidence="3">Shoot</tissue>
</source>
</reference>
<comment type="similarity">
<text evidence="1">Belongs to the MIP/aquaporin family.</text>
</comment>
<dbReference type="EMBL" id="AK356299">
<property type="protein sequence ID" value="BAJ87517.1"/>
<property type="molecule type" value="mRNA"/>
</dbReference>
<dbReference type="EMBL" id="AK359199">
<property type="protein sequence ID" value="BAJ90410.1"/>
<property type="molecule type" value="mRNA"/>
</dbReference>
<dbReference type="EMBL" id="AB808658">
<property type="protein sequence ID" value="BAN04711.1"/>
<property type="molecule type" value="mRNA"/>
</dbReference>
<dbReference type="ProteinModelPortal" id="F2CXE6"/>
<dbReference type="ExpressionAtlas" id="F2CXE6">
<property type="expression patterns" value="baseline"/>
</dbReference>
<dbReference type="GO" id="GO:0016021">
<property type="term" value="C:integral component of membrane"/>
<property type="evidence" value="IEA:UniProtKB-KW"/>
</dbReference>
<dbReference type="GO" id="GO:0005215">
<property type="term" value="F:transporter activity"/>
<property type="evidence" value="IEA:InterPro"/>
</dbReference>
<dbReference type="Gene3D" id="1.20.1080.10">
<property type="match status" value="1"/>
</dbReference>
<dbReference type="InterPro" id="IPR023271">
<property type="entry name" value="Aquaporin-like"/>
</dbReference>
<dbReference type="InterPro" id="IPR000425">
<property type="entry name" value="MIP"/>
</dbReference>
<dbReference type="InterPro" id="IPR022357">
<property type="entry name" value="MIP_CS"/>
</dbReference>
<dbReference type="PANTHER" id="PTHR19139">
<property type="entry name" value="PTHR19139"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="Pfam" id="PF00230">
<property type="entry name" value="MIP"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PRINTS" id="PR00783">
<property type="entry name" value="MINTRINSICP"/>
</dbReference>
<dbReference type="SUPFAM" id="SSF81338">
<property type="entry name" value="SSF81338"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="TIGRFAMs" id="TIGR00861">
<property type="entry name" value="MIP"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PROSITE" id="PS00221">
<property type="entry name" value="MIP"/>
<property type="match status" value="1"/>
</dbReference>
<proteinExistence type="evidence at transcript level"/>
<keyword id="KW-0472" evidence="1">Membrane</keyword>
<keyword id="KW-0812" evidence="1">Transmembrane</keyword>
<keyword id="KW-0813" evidence="1">Transport</keyword>
<evidence key="1" type="ECO:0000256">
<source>
<dbReference type="RuleBase" id="RU000477"/>
</source>
</evidence>
<evidence key="2" type="ECO:0000313">
<source>
<dbReference type="EMBL" id="BAJ87517.1"/>
</source>
</evidence>
<evidence key="3" type="ECO:0000313">
<source>
<dbReference type="EMBL" id="BAN04711.1"/>
</source>
</evidence>
<sequence length="291" mass="30495" checksum="07E95E632BD020E9" modified="2011-05-31" version="1">
MTMAAAQGKLSPDAIDNEVISNGSAKDYLDPPPAPLVDAGELGKWSLYRAVIAEFTATLL
FVYVAVATVVGHKRQTDAQACSGAGVLGIAWAFGGTIAVLVYCTAGISGGHINPAVTFGL
LLARKVSLPRAFLYMVAQCVGAICGAALVRAVHGGHHYALYGGGANELAPGYSRMAGLIA
EIAGTFVLVYTVFSATDPKRIARDPHVPVLAPLLIGFSVLMAHLATIPVTGTGINPARSF
GAAVVYNNKKAWGDQWIFWVGPFIGSAVAMVYHQYVLRNSAIFRSNYDAAV
</sequence>
</entry>
<copyright>
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
</copyright>
</uniprot>
|