1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215
|
<?xml version='1.0' encoding='UTF-8'?>
<uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry dataset="TrEMBL" created="2013-07-24" modified="2016-09-07" version="15">
<accession>R5HY77</accession>
<name>R5HY77_9BACT</name>
<protein>
<recommendedName>
<fullName evidence="1">Elongation factor Ts</fullName>
<shortName evidence="1">EF-Ts</shortName>
</recommendedName>
</protein>
<gene>
<name type="primary" evidence="1">tsf</name>
<name type="ORF" evidence="3">BN796_01519</name>
</gene>
<organism evidence="3 4">
<name type="scientific">Alistipes sp. CAG:831</name>
<dbReference type="NCBI Taxonomy" id="1262698"/>
<lineage>
<taxon>Bacteria</taxon>
<taxon>Bacteroidetes</taxon>
<taxon>Bacteroidia</taxon>
<taxon>Bacteroidales</taxon>
<taxon>Rikenellaceae</taxon>
<taxon>Alistipes</taxon>
<taxon>environmental samples</taxon>
</lineage>
</organism>
<reference key="1" evidence="3 4">
<citation type="submission" date="2012-11" db="EMBL/GenBank/DDBJ databases">
<title>Dependencies among metagenomic species, viruses, plasmids and units of genetic variation.</title>
<authorList>
<person name="Nielsen H.B."/>
<person name="Almeida M."/>
<person name="Juncker A.S."/>
<person name="Rasmussen S."/>
<person name="Li J."/>
<person name="Sunagawa S."/>
<person name="Plichta D."/>
<person name="Gautier L."/>
<person name="Le Chatelier E."/>
<person name="Peletier E."/>
<person name="Bonde I."/>
<person name="Nielsen T."/>
<person name="Manichanh C."/>
<person name="Arumugam M."/>
<person name="Batto J."/>
<person name="Santos M.B.Q.D."/>
<person name="Blom N."/>
<person name="Borruel N."/>
<person name="Burgdorf K.S."/>
<person name="Boumezbeur F."/>
<person name="Casellas F."/>
<person name="Dore J."/>
<person name="Guarner F."/>
<person name="Hansen T."/>
<person name="Hildebrand F."/>
<person name="Kaas R.S."/>
<person name="Kennedy S."/>
<person name="Kristiansen K."/>
<person name="Kultima J.R."/>
<person name="Leonard P."/>
<person name="Levenez F."/>
<person name="Lund O."/>
<person name="Moumen B."/>
<person name="Le Paslier D."/>
<person name="Pons N."/>
<person name="Pedersen O."/>
<person name="Prifti E."/>
<person name="Qin J."/>
<person name="Raes J."/>
<person name="Tap J."/>
<person name="Tims S."/>
<person name="Ussery D.W."/>
<person name="Yamada T."/>
<person name="MetaHit consortium"/>
<person name="Renault P."/>
<person name="Sicheritz-Ponten T."/>
<person name="Bork P."/>
<person name="Wang J."/>
<person name="Brunak S."/>
<person name="Ehrlich S.D."/>
</authorList>
</citation>
<scope>NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]</scope>
<source>
<strain evidence="4">MGS:831</strain>
</source>
</reference>
<comment type="function">
<text evidence="1">Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.</text>
</comment>
<comment type="subcellular location">
<subcellularLocation>
<location evidence="1">Cytoplasm</location>
</subcellularLocation>
</comment>
<comment type="similarity">
<text evidence="1">Belongs to the EF-Ts family.</text>
</comment>
<comment type="caution">
<text evidence="3">The sequence shown here is derived from an EMBL/GenBank/DDBJ whole genome shotgun (WGS) entry which is preliminary data.</text>
</comment>
<dbReference type="EMBL" id="CAYB010000029">
<property type="protein sequence ID" value="CCY34813.1"/>
<property type="molecule type" value="Genomic_DNA"/>
</dbReference>
<dbReference type="Proteomes" id="UP000018094">
<property type="component" value="Unassembled WGS sequence"/>
</dbReference>
<dbReference type="GO" id="GO:0005737">
<property type="term" value="C:cytoplasm"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="UniProtKB-SubCell"/>
</dbReference>
<dbReference type="GO" id="GO:0003746">
<property type="term" value="F:translation elongation factor activity"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="UniProtKB-HAMAP"/>
</dbReference>
<dbReference type="Gene3D" id="3.30.479.20">
<property type="match status" value="3"/>
</dbReference>
<dbReference type="HAMAP" id="MF_00050">
<property type="entry name" value="EF_Ts"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="InterPro" id="IPR001816">
<property type="entry name" value="Transl_elong_EFTs/EF1B"/>
</dbReference>
<dbReference type="InterPro" id="IPR014039">
<property type="entry name" value="Transl_elong_EFTs/EF1B_dimer"/>
</dbReference>
<dbReference type="InterPro" id="IPR018101">
<property type="entry name" value="Transl_elong_Ts_CS"/>
</dbReference>
<dbReference type="InterPro" id="IPR009060">
<property type="entry name" value="UBA-like"/>
</dbReference>
<dbReference type="PANTHER" id="PTHR11741">
<property type="entry name" value="PTHR11741"/>
<property type="match status" value="2"/>
</dbReference>
<dbReference type="Pfam" id="PF00889">
<property type="entry name" value="EF_TS"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="SUPFAM" id="SSF46934">
<property type="entry name" value="SSF46934"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="SUPFAM" id="SSF54713">
<property type="entry name" value="SSF54713"/>
<property type="match status" value="4"/>
</dbReference>
<dbReference type="TIGRFAMs" id="TIGR00116">
<property type="entry name" value="tsf"/>
<property type="match status" value="1"/>
</dbReference>
<dbReference type="PROSITE" id="PS01126">
<property type="entry name" value="EF_TS_1"/>
<property type="match status" value="1"/>
</dbReference>
<proteinExistence type="inferred from homology"/>
<keyword id="KW-0181" evidence="4">Complete proteome</keyword>
<keyword id="KW-0963" evidence="1">Cytoplasm</keyword>
<keyword id="KW-0251" evidence="1 3">Elongation factor</keyword>
<keyword id="KW-0648" evidence="1 3">Protein biosynthesis</keyword>
<keyword id="KW-1185" evidence="4">Reference proteome</keyword>
<feature type="domain" description="EF_TS" evidence="2">
<location>
<begin position="71"/>
<end position="328"/>
</location>
</feature>
<feature type="region of interest" description="Involved in Mg(2+) ion dislocation from EF-Tu" evidence="1">
<location>
<begin position="79"/>
<end position="82"/>
</location>
</feature>
<evidence key="1" type="ECO:0000256">
<source>
<dbReference type="HAMAP-Rule" id="MF_00050"/>
</source>
</evidence>
<evidence key="2" type="ECO:0000259">
<source>
<dbReference type="Pfam" id="PF00889"/>
</source>
</evidence>
<evidence key="3" type="ECO:0000313">
<source>
<dbReference type="EMBL" id="CCY34813.1"/>
</source>
</evidence>
<evidence key="4" type="ECO:0000313">
<source>
<dbReference type="Proteomes" id="UP000018094"/>
</source>
</evidence>
<sequence length="331" mass="35648" checksum="ECF3BC99C5D8BFF1" modified="2013-07-24" version="1">
MEIKAIDVQKLRKMTGAGMMDCKKALIEANGDYERAKEIIREKGKLVAAKRADRETSEGA
VVAKVDGSKGILLCLGCETDFVAKNEEFQALANAIADAAIKALPADMEALKACTIADGRT
VEAAITEQIGKTGEKHSLVAYEKVEAPYIISYIHTINGKLGAIVGFNKEVPVDLAKGVAM
QVASMNPVAVNKEAVPQNVIDEELKVAVEKTKEELVKKAVDAALSKAGINPAHVDSEDHI
QSNTAKGWLTPEQADQAREIIRTVSAEKAANLQEAMVNNIANGRLNKFFKENTLEEQEYQ
MGDGKTSVKAAIAAVDKDAKVTVFKRISLVD
</sequence>
</entry>
<copyright>
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
</copyright>
</uniprot>
|