1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340
|
# Copyright 2012 Lenna X. Peterson (arklenna@gmail.com).
# All rights reserved.
#
# Tests adapted from test_PDB.py
#
# This code is part of the Biopython distribution and governed by its
# license. Please see the LICENSE file that should have been included
# as part of this package.
"""Unit tests for the MMCIF portion of the Bio.PDB module."""
import tempfile
import unittest
import warnings
try:
import numpy
from numpy import dot # Missing on old PyPy's micronumpy
del dot
from numpy.linalg import svd, det # Missing in PyPy 2.0 numpypy
except ImportError:
from Bio import MissingPythonDependencyError
raise MissingPythonDependencyError(
"Install NumPy if you want to use Bio.PDB.")
from Bio.Seq import Seq
from Bio.Alphabet import generic_protein
from Bio.PDB.PDBExceptions import PDBConstructionException, PDBConstructionWarning
from Bio.PDB import PPBuilder, CaPPBuilder
from Bio.PDB.MMCIFParser import MMCIFParser, FastMMCIFParser
from Bio.PDB import PDBParser, PDBIO
class ParseReal(unittest.TestCase):
"""Testing with real CIF file(s)."""
def test_parsers(self):
"""Extract polypeptides from 1A80."""
parser = MMCIFParser()
fast_parser = FastMMCIFParser()
structure = parser.get_structure("example", "PDB/1A8O.cif")
f_structure = fast_parser.get_structure("example", "PDB/1A8O.cif")
self.assertEqual(len(structure), 1)
self.assertEqual(len(f_structure), 1)
for ppbuild in [PPBuilder(), CaPPBuilder()]:
# ==========================================================
# Check that serial_num (model column) is stored properly
self.assertEqual(structure[0].serial_num, 1)
self.assertEqual(f_structure[0].serial_num, structure[0].serial_num)
# First try allowing non-standard amino acids,
polypeptides = ppbuild.build_peptides(structure[0], False)
f_polypeptides = ppbuild.build_peptides(f_structure[0], False)
self.assertEqual(len(polypeptides), 1)
self.assertEqual(len(f_polypeptides), 1)
pp = polypeptides[0]
f_pp = f_polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 151)
self.assertEqual(pp[-1].get_id()[1], 220)
self.assertEqual(f_pp[0].get_id()[1], 151)
self.assertEqual(f_pp[-1].get_id()[1], 220)
# Check the sequence
s = pp.get_sequence()
f_s = f_pp.get_sequence()
self.assertEqual(s, f_s) # enough to test this
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
# Here non-standard MSE are shown as M
self.assertEqual("MDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQ"
"NANPDCKTILKALGPGATLEEMMTACQG", str(s))
# ==========================================================
# Now try strict version with only standard amino acids
# Should ignore MSE 151 at start, and then break the chain
# at MSE 185, and MSE 214,215
polypeptides = ppbuild.build_peptides(structure[0], True)
self.assertEqual(len(polypeptides), 3)
# First fragment
pp = polypeptides[0]
self.assertEqual(pp[0].get_id()[1], 152)
self.assertEqual(pp[-1].get_id()[1], 184)
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("DIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNW", str(s))
# Second fragment
pp = polypeptides[1]
self.assertEqual(pp[0].get_id()[1], 186)
self.assertEqual(pp[-1].get_id()[1], 213)
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("TETLLVQNANPDCKTILKALGPGATLEE", str(s))
# Third fragment
pp = polypeptides[2]
self.assertEqual(pp[0].get_id()[1], 216)
self.assertEqual(pp[-1].get_id()[1], 220)
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("TACQG", str(s))
s_atoms = list(structure.get_atoms())
f_atoms = list(f_structure.get_atoms())
for atoms in [s_atoms, f_atoms]:
self.assertEqual(len(atoms), 644)
atom_names = ['N', 'CA', 'C', 'O', 'CB']
self.assertSequenceEqual([a.get_name() for a in atoms[:5]], atom_names)
self.assertSequenceEqual([a.get_id() for a in atoms[:5]], atom_names)
self.assertSequenceEqual([a.get_fullname() for a in atoms[:5]], atom_names)
self.assertSequenceEqual([a.get_occupancy() for a in atoms[:5]], [1., 1., 1., 1., 1.])
self.assertIsInstance(atoms[0].get_coord(), numpy.ndarray)
coord = numpy.array([19.594, 32.367, 28.012], dtype=numpy.float32)
numpy.testing.assert_array_equal(atoms[0].get_coord(), coord)
self.assertEqual(atoms[0].get_bfactor(), 18.03)
for atom in atoms:
self.assertIsNone(atom.get_anisou())
def test_with_anisotrop(self):
parser = MMCIFParser()
fast_parser = FastMMCIFParser()
structure = parser.get_structure("example", "PDB/4CUP.cif")
f_structure = fast_parser.get_structure("example", "PDB/4CUP.cif")
self.assertEqual(len(structure), 1)
self.assertEqual(len(f_structure), 1)
s_atoms = list(structure.get_atoms())
f_atoms = list(f_structure.get_atoms())
self.assertEqual(len(s_atoms), len(f_atoms))
for atoms in [s_atoms, f_atoms]:
atom_names = ['N', 'CA', 'C', 'O', 'CB']
self.assertSequenceEqual([a.get_name() for a in atoms[:5]], atom_names)
self.assertSequenceEqual([a.get_id() for a in atoms[:5]], atom_names)
self.assertSequenceEqual([a.get_fullname() for a in atoms[:5]], atom_names)
self.assertSequenceEqual([a.get_occupancy() for a in atoms[:5]], [1., 1., 1., 1., 1.])
self.assertIsInstance(atoms[0].get_coord(), numpy.ndarray)
coord = numpy.array([50.346, 19.287, 17.288], dtype=numpy.float32)
numpy.testing.assert_array_equal(atoms[0].get_coord(), coord)
self.assertEqual(atoms[0].get_bfactor(), 32.02)
ansiou = numpy.array([0.4738, -0.0309, -0.0231, 0.4524, 0.0036, 0.2904], dtype=numpy.float32)
numpy.testing.assert_array_equal(atoms[0].get_anisou(), ansiou)
ansiou = numpy.array([1.1242, 0.2942, -0.0995, 1.1240, -0.1088, 0.8221], dtype=numpy.float32)
atom_937 = list(f_structure[0]['A'])[114]['CB']
numpy.testing.assert_array_equal(atom_937.get_anisou(), ansiou)
def testModels(self):
"""Test file with multiple models"""
parser = MMCIFParser(QUIET=1)
f_parser = FastMMCIFParser(QUIET=1)
with warnings.catch_warnings():
warnings.simplefilter('ignore', PDBConstructionWarning)
structure = parser.get_structure("example", "PDB/1LCD.cif")
f_structure = f_parser.get_structure("example", "PDB/1LCD.cif")
self.assertEqual(len(structure), 3)
self.assertEqual(len(f_structure), 3)
for ppbuild in [PPBuilder(), CaPPBuilder()]:
# ==========================================================
# Check that serial_num (model column) is stored properly
self.assertEqual(structure[0].serial_num, 1)
self.assertEqual(structure[1].serial_num, 2)
self.assertEqual(structure[2].serial_num, 3)
# First try allowing non-standard amino acids,
polypeptides = ppbuild.build_peptides(structure[0], False)
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 1)
self.assertEqual(pp[-1].get_id()[1], 51)
# Check the sequence
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
# Here non-standard MSE are shown as M
self.assertEqual("MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR",
str(s))
# ==========================================================
# Now try strict version with only standard amino acids
polypeptides = ppbuild.build_peptides(structure[0], True)
self.assertEqual(len(polypeptides), 1)
pp = polypeptides[0]
# Check the start and end positions
self.assertEqual(pp[0].get_id()[1], 1)
self.assertEqual(pp[-1].get_id()[1], 51)
# Check the sequence
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual("MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR",
str(s))
# This structure contains several models with multiple lengths.
# The tests were failing.
structure = parser.get_structure("example", "PDB/2OFG.cif")
self.assertEqual(len(structure), 3)
def test_insertions(self):
"""Test file with residue insertion codes"""
parser = MMCIFParser(QUIET=1)
with warnings.catch_warnings():
warnings.simplefilter('ignore', PDBConstructionWarning)
structure = parser.get_structure("example", "PDB/4ZHL.cif")
for ppbuild in [PPBuilder(), CaPPBuilder()]:
# First try allowing non-standard amino acids,
polypeptides = ppbuild.build_peptides(structure[0], False)
self.assertEqual(len(polypeptides), 2)
pp = polypeptides[0]
# Check the start and end positions (first segment only)
self.assertEqual(pp[0].get_id()[1], 16)
self.assertEqual(pp[-1].get_id()[1], 244)
# Check the sequence
refseq = "IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGR" \
"SRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMY" \
"NDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQW" \
"KTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE"
s = pp.get_sequence()
self.assertTrue(isinstance(s, Seq))
self.assertEqual(s.alphabet, generic_protein)
self.assertEqual(refseq, str(s))
def test_filehandle(self):
"""Test if the parser can handle file handle as well as filename"""
parser = MMCIFParser()
structure = parser.get_structure("example", "PDB/1A8O.cif")
self.assertEqual(len(structure), 1)
structure = parser.get_structure("example", open("PDB/1A8O.cif"))
self.assertEqual(len(structure), 1)
def test_point_mutations_main(self):
"""Test if MMCIFParser parse point mutations correctly."""
self._run_point_mutation_tests(MMCIFParser(QUIET=True))
def test_point_mutations_fast(self):
"""Test if FastMMCIFParser can parse point mutations correctly."""
self._run_point_mutation_tests(FastMMCIFParser(QUIET=True))
def _run_point_mutation_tests(self, parser):
"""Common test code for testing point mutations."""
structure = parser.get_structure("example", "PDB/3JQH.cif")
# Residue 1 and 15 should be disordered.
res_1 = structure[0]["A"][1]
res_15 = structure[0]["A"][15]
# Cursory check -- this would be true even if the residue just
# contained some disordered atoms.
self.assertTrue(res_1.is_disordered(), "Residue 1 is disordered")
self.assertTrue(res_15.is_disordered(), "Residue 15 is disordered")
# Check a non-mutated residue just to be sure we didn't break the
# parser and cause everyhing to be disordered.
self.assertFalse(
structure[0]["A"][13].is_disordered(),
"Residue 13 is not disordered")
# Check that the residue types were parsed correctly.
self.assertSetEqual(
set(res_1.disordered_get_id_list()),
{"PRO", "SER"},
"Residue 1 is proline/serine")
self.assertSetEqual(
set(res_15.disordered_get_id_list()),
{"ARG", "GLN", "GLU"},
"Residue 15 is arginine/glutamine/glutamic acid")
# Quickly check that we can switch between residues and that the
# correct set of residues was parsed.
res_1.disordered_select('PRO')
self.assertAlmostEqual(
res_1["CA"].get_occupancy(),
0.83, 2, "Residue 1 proline occupancy correcy")
res_1.disordered_select('SER')
self.assertAlmostEqual(
res_1["CA"].get_occupancy(),
0.17, 2, "Residue 1 serine occupancy correcy")
class CIFtoPDB(unittest.TestCase):
"""Testing conversion between formats: CIF to PDB"""
def test_conversion(self):
"""Parse 1A8O.cif, write 1A8O.pdb, parse again and compare"""
cif_parser = MMCIFParser(QUIET=1)
cif_struct = cif_parser.get_structure("example", "PDB/1LCD.cif")
pdb_writer = PDBIO()
pdb_writer.set_structure(cif_struct)
filenumber, filename = tempfile.mkstemp()
pdb_writer.save(filename)
pdb_parser = PDBParser(QUIET=1)
pdb_struct = pdb_parser.get_structure('example_pdb', filename)
# comparisons
self.assertEqual(len(pdb_struct), len(cif_struct))
pdb_atom_names = [a.name for a in pdb_struct.get_atoms()]
cif_atom_names = [a.name for a in cif_struct.get_atoms()]
self.assertEqual(len(pdb_atom_names), len(cif_atom_names))
self.assertSequenceEqual(pdb_atom_names, cif_atom_names)
pdb_atom_elems = [a.element for a in pdb_struct.get_atoms()]
cif_atom_elems = [a.element for a in cif_struct.get_atoms()]
self.assertSequenceEqual(pdb_atom_elems, cif_atom_elems)
if __name__ == '__main__':
runner = unittest.TextTestRunner(verbosity=2)
unittest.main(testRunner=runner)
|