1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742
|
\chapter{Sequence objects}
\label{chapter:seq_objects}
Biological sequences are arguably the central object in Bioinformatics, and in this chapter we'll introduce the Biopython mechanism for dealing with sequences, the \verb|Seq| object.
Chapter~\ref{chapter:seq_annot} will introduce the related \verb|SeqRecord| object, which combines the sequence information with any annotation, used again in Chapter~\ref{chapter:seqio} for Sequence Input/Output.
Sequences are essentially strings of letters like \verb|AGTACACTGGT|, which seems very natural since this is the most common way that sequences are seen in biological file formats.
The most important difference between \verb|Seq| objects and standard Python strings is they have different methods.
Although the \verb|Seq| object supports many of the same methods as a plain string, its \verb|translate()| method differs by doing biological translation, and there are also additional biologically relevant methods like \verb|reverse_complement()|.
\section{Sequences act like strings}
In most ways, we can deal with Seq objects as if they were normal Python strings, for example getting the length, or iterating over the elements:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GATCG")
>>> for index, letter in enumerate(my_seq):
... print("%i %s" % (index, letter))
0 G
1 A
2 T
3 C
4 G
>>> print(len(my_seq))
5
\end{minted}
You can access elements of the sequence in the same way as for strings (but remember, Python counts from zero!):
%cont-doctest
\begin{minted}{pycon}
>>> print(my_seq[0]) #first letter
G
>>> print(my_seq[2]) #third letter
T
>>> print(my_seq[-1]) #last letter
G
\end{minted}
The \verb|Seq| object has a \verb|.count()| method, just like a string.
Note that this means that like a Python string, this gives a
\emph{non-overlapping} count:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> "AAAA".count("AA")
2
>>> Seq("AAAA").count("AA")
2
\end{minted}
\noindent For some biological uses, you may actually want an overlapping count
(i.e. $3$ in this trivial example). When searching for single letters, this
makes no difference:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC")
>>> len(my_seq)
32
>>> my_seq.count("G")
9
>>> 100 * float(my_seq.count("G") + my_seq.count("C")) / len(my_seq)
46.875
\end{minted}
While you could use the above snippet of code to calculate a GC\%, note that the \verb|Bio.SeqUtils| module has several GC functions already built. For example:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> from Bio.SeqUtils import GC
>>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC")
>>> GC(my_seq)
46.875
\end{minted}
\noindent Note that using the \verb|Bio.SeqUtils.GC()| function should automatically cope with mixed case sequences and the ambiguous nucleotide S which means G or C.
Also note that just like a normal Python string, the \verb|Seq| object is in some ways ``read-only''. If you need to edit your sequence, for example simulating a point mutation, look at the Section~\ref{sec:mutable-seq} below which talks about the \verb|MutableSeq| object.
\section{Slicing a sequence}
A more complicated example, let's get a slice of the sequence:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC")
>>> my_seq[4:12]
Seq('GATGGGCC')
\end{minted}
Note that `Seq` objects follow the usual indexing conventions for Python strings, with the first element of the sequence numbered 0. When you do a slice the first item is included (i.e.~4 in this case) and the last is excluded (12 in this case).
Also like a Python string, you can do slices with a start, stop and \emph{stride} (the step size, which defaults to one). For example, we can get the first, second and third codon positions of this DNA sequence:
%cont-doctest
\begin{minted}{pycon}
>>> my_seq[0::3]
Seq('GCTGTAGTAAG')
>>> my_seq[1::3]
Seq('AGGCATGCATC')
>>> my_seq[2::3]
Seq('TAGCTAAGAC')
\end{minted}
Another stride trick you might have seen with a Python string is the use of a -1 stride to reverse the string. You can do this with a \verb|Seq| object too:
%cont-doctest
\begin{minted}{pycon}
>>> my_seq[::-1]
Seq('CGCTAAAAGCTAGGATATATCCGGGTAGCTAG')
\end{minted}
\section{Turning Seq objects into strings}
\label{sec:seq-to-string}
If you really do just need a plain string, for example to write to a file, or insert into a database, then this is very easy to get:
%cont-doctest
\begin{minted}{pycon}
>>> str(my_seq)
'GATCGATGGGCCTATATAGGATCGAAAATCGC'
\end{minted}
Since calling \verb|str()| on a \verb|Seq| object returns the full sequence as a string,
you often don't actually have to do this conversion explicitly.
Python does this automatically in the print function:
%cont-doctest
\begin{minted}{pycon}
>>> print(my_seq)
GATCGATGGGCCTATATAGGATCGAAAATCGC
\end{minted}
You can also use the \verb|Seq| object directly with a \verb|%s| placeholder when using the Python string formatting or interpolation operator (\verb|%|):
%cont-doctest
\begin{minted}{pycon}
>>> fasta_format_string = ">Name\n%s\n" % my_seq
>>> print(fasta_format_string)
>Name
GATCGATGGGCCTATATAGGATCGAAAATCGC
<BLANKLINE>
\end{minted}
\noindent This line of code constructs a simple FASTA format record (without worrying about line wrapping).
Section~\ref{sec:SeqRecord-format} describes a neat way to get a FASTA formatted
string from a \verb|SeqRecord| object, while the more general topic of reading and
writing FASTA format sequence files is covered in Chapter~\ref{chapter:seqio}.
\section{Concatenating or adding sequences}
As of Biopython 1.78, you can add any two Seq objects together.
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> protein_seq = Seq("EVRNAK")
>>> dna_seq = Seq("ACGT")
>>> protein_seq + dna_seq
Seq('EVRNAKACGT')
\end{minted}
Deliberately mixing DNA and protein like this is likely a mistake though...
You may often have many sequences to add together, which can be done with a for loop like this:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> list_of_seqs = [Seq("ACGT"), Seq("AACC"), Seq("GGTT")]
>>> concatenated = Seq("")
>>> for s in list_of_seqs:
... concatenated += s
...
>>> concatenated
Seq('ACGTAACCGGTT')
\end{minted}
Like Python strings, Biopython \verb|Seq| also has a \verb|.join| method:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> contigs = [Seq("ATG"), Seq("ATCCCG"), Seq("TTGCA")]
>>> spacer = Seq("N"*10)
>>> spacer.join(contigs)
Seq('ATGNNNNNNNNNNATCCCGNNNNNNNNNNTTGCA')
\end{minted}
\section{Changing case}
Python strings have very useful \verb|upper| and \verb|lower| methods for changing the case.
For example,
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> dna_seq = Seq("acgtACGT")
>>> dna_seq
Seq('acgtACGT')
>>> dna_seq.upper()
Seq('ACGTACGT')
>>> dna_seq.lower()
Seq('acgtacgt')
\end{minted}
These are useful for doing case insensitive matching:
%cont-doctest
\begin{minted}{pycon}
>>> "GTAC" in dna_seq
False
>>> "GTAC" in dna_seq.upper()
True
\end{minted}
\section{Nucleotide sequences and (reverse) complements}
\label{sec:seq-reverse-complement}
For nucleotide sequences, you can easily obtain the complement or reverse
complement of a \verb|Seq| object using its built-in methods:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC")
>>> my_seq
Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC')
>>> my_seq.complement()
Seq('CTAGCTACCCGGATATATCCTAGCTTTTAGCG')
>>> my_seq.reverse_complement()
Seq('GCGATTTTCGATCCTATATAGGCCCATCGATC')
\end{minted}
As mentioned earlier, an easy way to just reverse a \verb|Seq| object (or a
Python string) is slice it with -1 step:
%cont-doctest
\begin{minted}{pycon}
>>> my_seq[::-1]
Seq('CGCTAAAAGCTAGGATATATCCGGGTAGCTAG')
\end{minted}
If you do accidentally end up trying to do something weird like taking the
(reverse)complement of a protein sequence, the results are biologically
meaningless:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> protein_seq = Seq("EVRNAK")
>>> protein_seq.complement()
Seq('EBYNTM')
\end{minted}
Here the letter ``E'' is not a valid IUPAC ambiguity code for nucleotides,
so was not complemented. However, ``V'' means ``A'', ``C'' or ``G'' and
has complement ``B``, and so on.
The example in Section~\ref{sec:SeqIO-reverse-complement} combines the \verb|Seq|
object's reverse complement method with \verb|Bio.SeqIO| for sequence input/output.
\section{Transcription}
Before talking about transcription, I want to try to clarify the strand issue.
Consider the following (made up) stretch of double stranded DNA which
encodes a short peptide:
\begin{tabular}{rcl}
\\
& {\small DNA coding strand (aka Crick strand, strand $+1$)} & \\
5' & \texttt{ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG} & 3' \\
& \texttt{|||||||||||||||||||||||||||||||||||||||} & \\
3' & \texttt{TACCGGTAACATTACCCGGCGACTTTCCCACGGGCTATC} & 5' \\
& {\small DNA template strand (aka Watson strand, strand $-1$)} & \\
\\
& {\LARGE $|$} &\\
& Transcription & \\
& {\LARGE $\downarrow$} &\\
\\
5' & \texttt{AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG} & 3' \\
& {\small Single stranded messenger RNA} & \\
\\
\end{tabular}
The actual biological transcription process works from the template strand, doing a reverse complement (TCAG $\rightarrow$ CUGA) to give the mRNA. However, in Biopython and bioinformatics in general, we typically work directly with the coding strand because this means we can get the mRNA sequence just by switching T $\rightarrow$ U.
Now let's actually get down to doing a transcription in Biopython. First, let's create \verb|Seq| objects for the coding and template DNA strands:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG")
>>> coding_dna
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG')
>>> template_dna = coding_dna.reverse_complement()
>>> template_dna
Seq('CTATCGGGCACCCTTTCAGCGGCCCATTACAATGGCCAT')
\end{minted}
\noindent These should match the figure above - remember by convention nucleotide sequences are normally read from the 5' to 3' direction, while in the figure the template strand is shown reversed.
Now let's transcribe the coding strand into the corresponding mRNA, using the \verb|Seq| object's built in \verb|transcribe| method:
%cont-doctest
\begin{minted}{pycon}
>>> coding_dna
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG')
>>> messenger_rna = coding_dna.transcribe()
>>> messenger_rna
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG')
\end{minted}
\noindent As you can see, all this does is to replace T by U.
If you do want to do a true biological transcription starting with the template strand, then this becomes a two-step process:
%cont-doctest
\begin{minted}{pycon}
>>> template_dna.reverse_complement().transcribe()
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG')
\end{minted}
The \verb|Seq| object also includes a back-transcription method for going from the mRNA to the coding strand of the DNA. Again, this is a simple U $\rightarrow$ T substitution:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG")
>>> messenger_rna
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG')
>>> messenger_rna.back_transcribe()
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG')
\end{minted}
\emph{Note:} The \verb|Seq| object's \verb|transcribe| and \verb|back_transcribe| methods
were added in Biopython 1.49. For older releases you would have to use the \verb|Bio.Seq|
module's functions instead, see Section~\ref{sec:seq-module-functions}.
\section{Translation}
\label{sec:translation}
Sticking with the same example discussed in the transcription section above,
now let's translate this mRNA into the corresponding protein sequence - again taking
advantage of one of the \verb|Seq| object's biological methods:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG")
>>> messenger_rna
Seq('AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG')
>>> messenger_rna.translate()
Seq('MAIVMGR*KGAR*')
\end{minted}
You can also translate directly from the coding strand DNA sequence:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG")
>>> coding_dna
Seq('ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG')
>>> coding_dna.translate()
Seq('MAIVMGR*KGAR*')
\end{minted}
You should notice in the above protein sequences that in addition to the end stop character, there is an internal stop as well. This was a deliberate choice of example, as it gives an excuse to talk about some optional arguments, including different translation tables (Genetic Codes).
The translation tables available in Biopython are based on those \href{https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi}{from the NCBI} (see the next section of this tutorial). By default, translation will use the \emph{standard} genetic code (NCBI table id 1).
Suppose we are dealing with a mitochondrial sequence. We need to tell the translation function to use the relevant genetic code instead:
%cont-doctest
\begin{minted}{pycon}
>>> coding_dna.translate(table="Vertebrate Mitochondrial")
Seq('MAIVMGRWKGAR*')
\end{minted}
You can also specify the table using the NCBI table number which is shorter, and often included in the feature annotation of GenBank files:
%cont-doctest
\begin{minted}{pycon}
>>> coding_dna.translate(table=2)
Seq('MAIVMGRWKGAR*')
\end{minted}
Now, you may want to translate the nucleotides up to the first in frame stop codon,
and then stop (as happens in nature):
%cont-doctest
\begin{minted}{pycon}
>>> coding_dna.translate()
Seq('MAIVMGR*KGAR*')
>>> coding_dna.translate(to_stop=True)
Seq('MAIVMGR')
>>> coding_dna.translate(table=2)
Seq('MAIVMGRWKGAR*')
>>> coding_dna.translate(table=2, to_stop=True)
Seq('MAIVMGRWKGAR')
\end{minted}
\noindent Notice that when you use the \verb|to_stop| argument, the stop codon itself
is not translated - and the stop symbol is not included at the end of your protein
sequence.
You can even specify the stop symbol if you don't like the default asterisk:
%cont-doctest
\begin{minted}{pycon}
>>> coding_dna.translate(table=2, stop_symbol="@")
Seq('MAIVMGRWKGAR@')
\end{minted}
Now, suppose you have a complete coding sequence CDS, which is to say a
nucleotide sequence (e.g. mRNA -- after any splicing) which is a whole number
of codons (i.e. the length is a multiple of three), commences with a start
codon, ends with a stop codon, and has no internal in-frame stop codons.
In general, given a complete CDS, the default translate method will do what
you want (perhaps with the \verb|to_stop| option). However, what if your
sequence uses a non-standard start codon? This happens a lot in bacteria --
for example the gene yaaX in \texttt{E. coli} K12:
%TODO - handle line wrapping in doctest?
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> gene = Seq("GTGAAAAAGATGCAATCTATCGTACTCGCACTTTCCCTGGTTCTGGTCGCTCCCATGGCA"
... "GCACAGGCTGCGGAAATTACGTTAGTCCCGTCAGTAAAATTACAGATAGGCGATCGTGAT"
... "AATCGTGGCTATTACTGGGATGGAGGTCACTGGCGCGACCACGGCTGGTGGAAACAACAT"
... "TATGAATGGCGAGGCAATCGCTGGCACCTACACGGACCGCCGCCACCGCCGCGCCACCAT"
... "AAGAAAGCTCCTCATGATCATCACGGCGGTCATGGTCCAGGCAAACATCACCGCTAA")
>>> gene.translate(table="Bacterial")
Seq('VKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDH...HR*',
ProteinAlpabet())
>>> gene.translate(table="Bacterial", to_stop=True)
Seq('VKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDH...HHR')
\end{minted}
\noindent In the bacterial genetic code \texttt{GTG} is a valid start codon,
and while it does \emph{normally} encode Valine, if used as a start codon it
should be translated as methionine. This happens if you tell Biopython your
sequence is a complete CDS:
%TODO - handle line wrapping in doctest?
\begin{minted}{pycon}
>>> gene.translate(table="Bacterial", cds=True)
Seq('MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDH...HHR')
\end{minted}
In addition to telling Biopython to translate an alternative start codon as
methionine, using this option also makes sure your sequence really is a valid
CDS (you'll get an exception if not).
The example in Section~\ref{sec:SeqIO-translate} combines the \verb|Seq| object's
translate method with \verb|Bio.SeqIO| for sequence input/output.
\section{Translation Tables}
In the previous sections we talked about the \verb|Seq| object translation method (and mentioned the equivalent function in the \verb|Bio.Seq| module -- see
Section~\ref{sec:seq-module-functions}).
Internally these use codon table objects derived from the NCBI information at
\url{ftp://ftp.ncbi.nlm.nih.gov/entrez/misc/data/gc.prt}, also shown on
\url{https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi} in a much more readable layout.
As before, let's just focus on two choices: the Standard translation table, and the
translation table for Vertebrate Mitochondrial DNA.
%doctest
\begin{minted}{pycon}
>>> from Bio.Data import CodonTable
>>> standard_table = CodonTable.unambiguous_dna_by_name["Standard"]
>>> mito_table = CodonTable.unambiguous_dna_by_name["Vertebrate Mitochondrial"]
\end{minted}
Alternatively, these tables are labeled with ID numbers 1 and 2, respectively:
%cont-doctest
\begin{minted}{pycon}
>>> from Bio.Data import CodonTable
>>> standard_table = CodonTable.unambiguous_dna_by_id[1]
>>> mito_table = CodonTable.unambiguous_dna_by_id[2]
\end{minted}
You can compare the actual tables visually by printing them:
%TODO - handle <BLANKLINE> automatically in doctest?
\begin{minted}{pycon}
>>> print(standard_table)
Table 1 Standard, SGC0
| T | C | A | G |
--+---------+---------+---------+---------+--
T | TTT F | TCT S | TAT Y | TGT C | T
T | TTC F | TCC S | TAC Y | TGC C | C
T | TTA L | TCA S | TAA Stop| TGA Stop| A
T | TTG L(s)| TCG S | TAG Stop| TGG W | G
--+---------+---------+---------+---------+--
C | CTT L | CCT P | CAT H | CGT R | T
C | CTC L | CCC P | CAC H | CGC R | C
C | CTA L | CCA P | CAA Q | CGA R | A
C | CTG L(s)| CCG P | CAG Q | CGG R | G
--+---------+---------+---------+---------+--
A | ATT I | ACT T | AAT N | AGT S | T
A | ATC I | ACC T | AAC N | AGC S | C
A | ATA I | ACA T | AAA K | AGA R | A
A | ATG M(s)| ACG T | AAG K | AGG R | G
--+---------+---------+---------+---------+--
G | GTT V | GCT A | GAT D | GGT G | T
G | GTC V | GCC A | GAC D | GGC G | C
G | GTA V | GCA A | GAA E | GGA G | A
G | GTG V | GCG A | GAG E | GGG G | G
--+---------+---------+---------+---------+--
\end{minted}
\noindent and:
\begin{minted}{pycon}
>>> print(mito_table)
Table 2 Vertebrate Mitochondrial, SGC1
| T | C | A | G |
--+---------+---------+---------+---------+--
T | TTT F | TCT S | TAT Y | TGT C | T
T | TTC F | TCC S | TAC Y | TGC C | C
T | TTA L | TCA S | TAA Stop| TGA W | A
T | TTG L | TCG S | TAG Stop| TGG W | G
--+---------+---------+---------+---------+--
C | CTT L | CCT P | CAT H | CGT R | T
C | CTC L | CCC P | CAC H | CGC R | C
C | CTA L | CCA P | CAA Q | CGA R | A
C | CTG L | CCG P | CAG Q | CGG R | G
--+---------+---------+---------+---------+--
A | ATT I(s)| ACT T | AAT N | AGT S | T
A | ATC I(s)| ACC T | AAC N | AGC S | C
A | ATA M(s)| ACA T | AAA K | AGA Stop| A
A | ATG M(s)| ACG T | AAG K | AGG Stop| G
--+---------+---------+---------+---------+--
G | GTT V | GCT A | GAT D | GGT G | T
G | GTC V | GCC A | GAC D | GGC G | C
G | GTA V | GCA A | GAA E | GGA G | A
G | GTG V(s)| GCG A | GAG E | GGG G | G
--+---------+---------+---------+---------+--
\end{minted}
You may find these following properties useful -- for example if you are trying
to do your own gene finding:
%cont-doctest
\begin{minted}{pycon}
>>> mito_table.stop_codons
['TAA', 'TAG', 'AGA', 'AGG']
>>> mito_table.start_codons
['ATT', 'ATC', 'ATA', 'ATG', 'GTG']
>>> mito_table.forward_table["ACG"]
'T'
\end{minted}
\section{Comparing Seq objects}
\label{sec:seq-comparison}
Sequence comparison is actually a very complicated topic, and there is no easy
way to decide if two sequences are equal. The basic problem is the meaning of
the letters in a sequence are context dependent - the letter ``A'' could be part
of a DNA, RNA or protein sequence. Biopython can track the molecule type, so
comparing two \verb|Seq| objects could mean considering this too.
Should a DNA fragment ``ACG'' and an RNA fragment ``ACG'' be equal? What about
the peptide ``ACG``? Or the Python string ``ACG``?
In everyday use, your sequences will generally all be the same type of
(all DNA, all RNA, or all protein).
Well, as of Biopython 1.65, sequence comparison only looks at the sequence
and compares like the Python string.
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> seq1 = Seq("ACGT")
>>> "ACGT" == seq1
True
>>> seq1 == "ACGT"
True
\end{minted}
As an extension to this, using sequence objects as keys in a Python dictionary
is equivalent to using the sequence as a plain string for the key.
See also Section~\ref{sec:seq-to-string}.
\section{MutableSeq objects}
\label{sec:mutable-seq}
Just like the normal Python string, the \verb|Seq| object is ``read only'', or in Python terminology, immutable. Apart from wanting the \verb|Seq| object to act like a string, this is also a useful default since in many biological applications you want to ensure you are not changing your sequence data:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import Seq
>>> my_seq = Seq("GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA")
\end{minted}
Observe what happens if you try to edit the sequence:
%cont-doctest
\begin{minted}{pycon}
>>> my_seq[5] = "G"
Traceback (most recent call last):
...
TypeError: 'Seq' object does not support item assignment
\end{minted}
However, you can convert it into a mutable sequence (a \verb|MutableSeq| object) and do pretty much anything you want with it:
%cont-doctest
\begin{minted}{pycon}
>>> mutable_seq = my_seq.tomutable()
>>> mutable_seq
MutableSeq('GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA')
\end{minted}
Alternatively, you can create a \verb|MutableSeq| object directly from a string:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import MutableSeq
>>> mutable_seq = MutableSeq("GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA")
\end{minted}
Either way will give you a sequence object which can be changed:
%cont-doctest
\begin{minted}{pycon}
>>> mutable_seq
MutableSeq('GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA')
>>> mutable_seq[5] = "C"
>>> mutable_seq
MutableSeq('GCCATCGTAATGGGCCGCTGAAAGGGTGCCCGA')
>>> mutable_seq.remove("T")
>>> mutable_seq
MutableSeq('GCCACGTAATGGGCCGCTGAAAGGGTGCCCGA')
>>> mutable_seq.reverse()
>>> mutable_seq
MutableSeq('AGCCCGTGGGAAAGTCGCCGGGTAATGCACCG')
\end{minted}
Do note that unlike the \verb|Seq| object, the \verb|MutableSeq| object's methods like \verb|reverse_complement()| and \verb|reverse()| act in-situ!
An important technical difference between mutable and immutable objects in Python means that you can't use a \verb|MutableSeq| object as a dictionary key, but you can use a Python string or a \verb|Seq| object in this way.
Once you have finished editing your a \verb|MutableSeq| object, it's easy to get back to a read-only \verb|Seq| object should you need to:
%cont-doctest
\begin{minted}{pycon}
>>> new_seq = mutable_seq.toseq()
>>> new_seq
Seq('AGCCCGTGGGAAAGTCGCCGGGTAATGCACCG')
\end{minted}
You can also get a string from a \verb|MutableSeq| object just like from a \verb|Seq| object (Section~\ref{sec:seq-to-string}).
\section{UnknownSeq objects}
The \verb|UnknownSeq| object is a subclass of the basic \verb|Seq| object
and its purpose is to represent a
sequence where we know the length, but not the actual letters making it up.
You could of course use a normal \verb|Seq| object in this situation, but it wastes
rather a lot of memory to hold a string of a million ``N'' characters when you could
just store a single letter ``N'' and the desired length as an integer.
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import UnknownSeq
>>> unk = UnknownSeq(20)
>>> unk
UnknownSeq(20, character='?')
>>> print(unk)
????????????????????
>>> len(unk)
20
\end{minted}
For DNA or RNA sequences, unknown nucleotides are commonly denoted by the letter ``N'', while for proteins ``X'' is commonly used for unknown amino acids. When creating an `UnknownSeq`, you can specify the character to be used instead of ``?'' to represent unknown letters. For example
%cont-doctest
\begin{minted}{pycon}
>>> from Bio.Seq import UnknownSeq
>>> unk_dna = UnknownSeq(20, character="N")
>>> unk_dna
UnknownSeq(20, character='N')
>>> print(unk_dna)
NNNNNNNNNNNNNNNNNNNN
\end{minted}
You can use all the usual \verb|Seq| object methods too, note these give back
memory saving \verb|UnknownSeq| objects where appropriate as you might expect:
%cont-doctest
\begin{minted}{pycon}
>>> unk_dna
UnknownSeq(20, character='N')
>>> unk_dna.complement()
UnknownSeq(20, character='N')
>>> unk_dna.reverse_complement()
UnknownSeq(20, character='N')
>>> unk_dna.transcribe()
UnknownSeq(20, character='N')
>>> unk_protein = unk_dna.translate()
>>> unk_protein
UnknownSeq(6, character='X')
>>> print(unk_protein)
XXXXXX
>>> len(unk_protein)
6
\end{minted}
You may be able to find a use for the \verb|UnknownSeq| object in your own
code, but it is more likely that you will first come across them in a
\verb|SeqRecord| object created by \verb|Bio.SeqIO|
(see Chapter~\ref{chapter:seqio}).
Some sequence file formats don't always include the actual sequence, for
example GenBank and EMBL files may include a list of features but for the
sequence just present the contig information. Alternatively, the QUAL files
used in sequencing work hold quality scores but they \emph{never} contain a
sequence -- instead there is a partner FASTA file which \emph{does} have the
sequence.
\section{Working with strings directly}
\label{sec:seq-module-functions}
To close this chapter, for those you who \emph{really} don't want to use the sequence
objects (or who prefer a functional programming style to an object orientated one),
there are module level functions in \verb|Bio.Seq| will accept plain Python strings,
\verb|Seq| objects (including \verb|UnknownSeq| objects) or \verb|MutableSeq| objects:
%doctest
\begin{minted}{pycon}
>>> from Bio.Seq import reverse_complement, transcribe, back_transcribe, translate
>>> my_string = "GCTGTTATGGGTCGTTGGAAGGGTGGTCGTGCTGCTGGTTAG"
>>> reverse_complement(my_string)
'CTAACCAGCAGCACGACCACCCTTCCAACGACCCATAACAGC'
>>> transcribe(my_string)
'GCUGUUAUGGGUCGUUGGAAGGGUGGUCGUGCUGCUGGUUAG'
>>> back_transcribe(my_string)
'GCTGTTATGGGTCGTTGGAAGGGTGGTCGTGCTGCTGGTTAG'
>>> translate(my_string)
'AVMGRWKGGRAAG*'
\end{minted}
\noindent You are, however, encouraged to work with \verb|Seq| objects by default.
|