1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402
|
# Copyright 2000-2002 Andrew Dalke. All rights reserved.
# Copyright 2002-2004 Brad Chapman. All rights reserved.
# Copyright 2006-2020 by Peter Cock. All rights reserved.
#
# This file is part of the Biopython distribution and governed by your
# choice of the "Biopython License Agreement" or the "BSD 3-Clause License".
# Please see the LICENSE file that should have been included as part of this
# package.
"""Represent a Sequence Record, a sequence with annotation."""
# NEEDS TO BE SYNCH WITH THE REST OF BIOPYTHON AND BIOPERL
# In particular, the SeqRecord and BioSQL.BioSeq.DBSeqRecord classes
# need to be in sync (this is the BioSQL "Database SeqRecord").
from io import StringIO
import numbers
from Bio import StreamModeError
from Bio.Seq import UndefinedSequenceError
_NO_SEQRECORD_COMPARISON = "SeqRecord comparison is deliberately not implemented. Explicitly compare the attributes of interest."
class _RestrictedDict(dict):
"""Dict which only allows sequences of given length as values (PRIVATE).
This simple subclass of the Python dictionary is used in the SeqRecord
object for holding per-letter-annotations. This class is intended to
prevent simple errors by only allowing python sequences (e.g. lists,
strings and tuples) to be stored, and only if their length matches that
expected (the length of the SeqRecord's seq object). It cannot however
prevent the entries being edited in situ (for example appending entries
to a list).
>>> x = _RestrictedDict(5)
>>> x["test"] = "hello"
>>> x
{'test': 'hello'}
Adding entries which don't have the expected length are blocked:
>>> x["test"] = "hello world"
Traceback (most recent call last):
...
TypeError: We only allow python sequences (lists, tuples or strings) of length 5.
The expected length is stored as a private attribute,
>>> x._length
5
In order that the SeqRecord (and other objects using this class) can be
pickled, for example for use in the multiprocessing library, we need to
be able to pickle the restricted dictionary objects.
Using the default protocol, which is 3 on Python 3,
>>> import pickle
>>> y = pickle.loads(pickle.dumps(x))
>>> y
{'test': 'hello'}
>>> y._length
5
Using the highest protocol, which is 4 on Python 3,
>>> import pickle
>>> z = pickle.loads(pickle.dumps(x, pickle.HIGHEST_PROTOCOL))
>>> z
{'test': 'hello'}
>>> z._length
5
"""
def __init__(self, length):
"""Create an EMPTY restricted dictionary."""
dict.__init__(self)
self._length = int(length)
def __setitem__(self, key, value):
# The check hasattr(self, "_length") is to cope with pickle protocol 2
# I couldn't seem to avoid this with __getstate__ and __setstate__
if (
not hasattr(value, "__len__")
or not hasattr(value, "__getitem__")
or (hasattr(self, "_length") and len(value) != self._length)
):
raise TypeError(
"We only allow python sequences (lists, tuples or strings) "
f"of length {self._length}."
)
dict.__setitem__(self, key, value)
def update(self, new_dict):
# Force this to go via our strict __setitem__ method
for (key, value) in new_dict.items():
self[key] = value
class SeqRecord:
"""A SeqRecord object holds a sequence and information about it.
Main attributes:
- id - Identifier such as a locus tag (string)
- seq - The sequence itself (Seq object or similar)
Additional attributes:
- name - Sequence name, e.g. gene name (string)
- description - Additional text (string)
- dbxrefs - List of database cross references (list of strings)
- features - Any (sub)features defined (list of SeqFeature objects)
- annotations - Further information about the whole sequence (dictionary).
Most entries are strings, or lists of strings.
- letter_annotations - Per letter/symbol annotation (restricted
dictionary). This holds Python sequences (lists, strings
or tuples) whose length matches that of the sequence.
A typical use would be to hold a list of integers
representing sequencing quality scores, or a string
representing the secondary structure.
You will typically use Bio.SeqIO to read in sequences from files as
SeqRecord objects. However, you may want to create your own SeqRecord
objects directly (see the __init__ method for further details):
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
... id="YP_025292.1", name="HokC",
... description="toxic membrane protein")
>>> print(record)
ID: YP_025292.1
Name: HokC
Description: toxic membrane protein
Number of features: 0
Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF')
If you want to save SeqRecord objects to a sequence file, use Bio.SeqIO
for this. For the special case where you want the SeqRecord turned into
a string in a particular file format there is a format method which uses
Bio.SeqIO internally:
>>> print(record.format("fasta"))
>YP_025292.1 toxic membrane protein
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
<BLANKLINE>
You can also do things like slicing a SeqRecord, checking its length, etc
>>> len(record)
44
>>> edited = record[:10] + record[11:]
>>> print(edited.seq)
MKQHKAMIVAIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
>>> print(record.seq)
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
"""
def __init__(
self,
seq,
id="<unknown id>",
name="<unknown name>",
description="<unknown description>",
dbxrefs=None,
features=None,
annotations=None,
letter_annotations=None,
):
"""Create a SeqRecord.
Arguments:
- seq - Sequence, required (Seq or MutableSeq)
- id - Sequence identifier, recommended (string)
- name - Sequence name, optional (string)
- description - Sequence description, optional (string)
- dbxrefs - Database cross references, optional (list of strings)
- features - Any (sub)features, optional (list of SeqFeature objects)
- annotations - Dictionary of annotations for the whole sequence
- letter_annotations - Dictionary of per-letter-annotations, values
should be strings, list or tuples of the same length as the full
sequence.
You will typically use Bio.SeqIO to read in sequences from files as
SeqRecord objects. However, you may want to create your own SeqRecord
objects directly.
Note that while an id is optional, we strongly recommend you supply a
unique id string for each record. This is especially important
if you wish to write your sequences to a file.
You can create a 'blank' SeqRecord object, and then populate the
attributes later.
"""
if id is not None and not isinstance(id, str):
# Lots of existing code uses id=None... this may be a bad idea.
raise TypeError("id argument should be a string")
if not isinstance(name, str):
raise TypeError("name argument should be a string")
if not isinstance(description, str):
raise TypeError("description argument should be a string")
self._seq = seq
self.id = id
self.name = name
self.description = description
# database cross references (for the whole sequence)
if dbxrefs is None:
dbxrefs = []
elif not isinstance(dbxrefs, list):
raise TypeError("dbxrefs argument should be a list (of strings)")
self.dbxrefs = dbxrefs
# annotations about the whole sequence
if annotations is None:
annotations = {}
elif not isinstance(annotations, dict):
raise TypeError("annotations argument must be a dict or None")
self.annotations = annotations
if letter_annotations is None:
# annotations about each letter in the sequence
if seq is None:
# Should we allow this and use a normal unrestricted dict?
self._per_letter_annotations = _RestrictedDict(length=0)
else:
try:
self._per_letter_annotations = _RestrictedDict(length=len(seq))
except TypeError:
raise TypeError(
"seq argument should be a Seq object or similar"
) from None
else:
# This will be handled via the property set function, which will
# turn this into a _RestrictedDict and thus ensure all the values
# in the dict are the right length
self.letter_annotations = letter_annotations
# annotations about parts of the sequence
if features is None:
features = []
elif not isinstance(features, list):
raise TypeError(
"features argument should be a list (of SeqFeature objects)"
)
self.features = features
# TODO - Just make this a read only property?
def _set_per_letter_annotations(self, value):
if not isinstance(value, dict):
raise TypeError(
"The per-letter-annotations should be a (restricted) dictionary."
)
# Turn this into a restricted-dictionary (and check the entries)
try:
self._per_letter_annotations = _RestrictedDict(length=len(self.seq))
except AttributeError:
# e.g. seq is None
self._per_letter_annotations = _RestrictedDict(length=0)
self._per_letter_annotations.update(value)
letter_annotations = property(
fget=lambda self: self._per_letter_annotations,
fset=_set_per_letter_annotations,
doc="""Dictionary of per-letter-annotation for the sequence.
For example, this can hold quality scores used in FASTQ or QUAL files.
Consider this example using Bio.SeqIO to read in an example Solexa
variant FASTQ file as a SeqRecord:
>>> from Bio import SeqIO
>>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
>>> print("%s %s" % (record.id, record.seq))
slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
>>> print(list(record.letter_annotations))
['solexa_quality']
>>> print(record.letter_annotations["solexa_quality"])
[40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0, -1, -2, -3, -4, -5]
The letter_annotations get sliced automatically if you slice the
parent SeqRecord, for example taking the last ten bases:
>>> sub_record = record[-10:]
>>> print("%s %s" % (sub_record.id, sub_record.seq))
slxa_0001_1_0001_01 ACGTNNNNNN
>>> print(sub_record.letter_annotations["solexa_quality"])
[4, 3, 2, 1, 0, -1, -2, -3, -4, -5]
Any python sequence (i.e. list, tuple or string) can be recorded in
the SeqRecord's letter_annotations dictionary as long as the length
matches that of the SeqRecord's sequence. e.g.
>>> len(sub_record.letter_annotations)
1
>>> sub_record.letter_annotations["dummy"] = "abcdefghij"
>>> len(sub_record.letter_annotations)
2
You can delete entries from the letter_annotations dictionary as usual:
>>> del sub_record.letter_annotations["solexa_quality"]
>>> sub_record.letter_annotations
{'dummy': 'abcdefghij'}
You can completely clear the dictionary easily as follows:
>>> sub_record.letter_annotations = {}
>>> sub_record.letter_annotations
{}
Note that if replacing the record's sequence with a sequence of a
different length you must first clear the letter_annotations dict.
""",
)
def _set_seq(self, value):
# TODO - Add a deprecation warning that the seq should be write only?
if self._per_letter_annotations:
if len(self) != len(value):
# TODO - Make this a warning? Silently empty the dictionary?
raise ValueError("You must empty the letter annotations first!")
else:
# Leave the existing per letter annotations unchanged:
self._seq = value
else:
self._seq = value
# Reset the (empty) letter annotations dict with new length:
try:
self._per_letter_annotations = _RestrictedDict(length=len(self.seq))
except AttributeError:
# e.g. seq is None
self._per_letter_annotations = _RestrictedDict(length=0)
seq = property(
fget=lambda self: self._seq,
fset=_set_seq,
doc="The sequence itself, as a Seq or MutableSeq object.",
)
def __getitem__(self, index):
"""Return a sub-sequence or an individual letter.
Slicing, e.g. my_record[5:10], returns a new SeqRecord for
that sub-sequence with some annotation preserved as follows:
* The name, id and description are kept as-is.
* Any per-letter-annotations are sliced to match the requested
sub-sequence.
* Unless a stride is used, all those features which fall fully
within the subsequence are included (with their locations
adjusted accordingly). If you want to preserve any truncated
features (e.g. GenBank/EMBL source features), you must
explicitly add them to the new SeqRecord yourself.
* With the exception of any molecule type, the annotations
dictionary and the dbxrefs list are not used for the new
SeqRecord, as in general they may not apply to the
subsequence. If you want to preserve them, you must explicitly
copy them to the new SeqRecord yourself.
Using an integer index, e.g. my_record[5] is shorthand for
extracting that letter from the sequence, my_record.seq[5].
For example, consider this short protein and its secondary
structure as encoded by the PDB (e.g. H for alpha helices),
plus a simple feature for its histidine self phosphorylation
site:
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> from Bio.SeqFeature import SeqFeature, SimpleLocation
>>> rec = SeqRecord(Seq("MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT"
... "EMMSEQDGYLAESINKDIEECNAIIEQFIDYLR"),
... id="1JOY", name="EnvZ",
... description="Homodimeric domain of EnvZ from E. coli")
>>> rec.letter_annotations["secondary_structure"] = " S SSSSSSHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTT "
>>> rec.features.append(SeqFeature(SimpleLocation(20, 21),
... type = "Site"))
Now let's have a quick look at the full record,
>>> print(rec)
ID: 1JOY
Name: EnvZ
Description: Homodimeric domain of EnvZ from E. coli
Number of features: 1
Per letter annotation for: secondary_structure
Seq('MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEE...YLR')
>>> rec.letter_annotations["secondary_structure"]
' S SSSSSSHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTT '
>>> print(rec.features[0].location)
[20:21]
Now let's take a sub sequence, here chosen as the first (fractured)
alpha helix which includes the histidine phosphorylation site:
>>> sub = rec[11:41]
>>> print(sub)
ID: 1JOY
Name: EnvZ
Description: Homodimeric domain of EnvZ from E. coli
Number of features: 1
Per letter annotation for: secondary_structure
Seq('RTLLMAGVSHDLRTPLTRIRLATEMMSEQD')
>>> sub.letter_annotations["secondary_structure"]
'HHHHHTTTHHHHHHHHHHHHHHHHHHHHHH'
>>> print(sub.features[0].location)
[9:10]
You can also of course omit the start or end values, for
example to get the first ten letters only:
>>> print(rec[:10])
ID: 1JOY
Name: EnvZ
Description: Homodimeric domain of EnvZ from E. coli
Number of features: 0
Per letter annotation for: secondary_structure
Seq('MAAGVKQLAD')
Or for the last ten letters:
>>> print(rec[-10:])
ID: 1JOY
Name: EnvZ
Description: Homodimeric domain of EnvZ from E. coli
Number of features: 0
Per letter annotation for: secondary_structure
Seq('IIEQFIDYLR')
If you omit both, then you get a copy of the original record (although
lacking the annotations and dbxrefs):
>>> print(rec[:])
ID: 1JOY
Name: EnvZ
Description: Homodimeric domain of EnvZ from E. coli
Number of features: 1
Per letter annotation for: secondary_structure
Seq('MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEE...YLR')
Finally, indexing with a simple integer is shorthand for pulling out
that letter from the sequence directly:
>>> rec[5]
'K'
>>> rec.seq[5]
'K'
"""
if isinstance(index, numbers.Integral):
# NOTE - The sequence level annotation like the id, name, etc
# do not really apply to a single character. However, should
# we try and expose any per-letter-annotation here? If so how?
return self.seq[index]
elif isinstance(index, slice):
if self.seq is None:
raise ValueError("If the sequence is None, we cannot slice it.")
parent_length = len(self)
try:
from BioSQL.BioSeq import DBSeqRecord
biosql_available = True
except ImportError:
biosql_available = False
if biosql_available and isinstance(self, DBSeqRecord):
answer = SeqRecord(
self.seq[index],
id=self.id,
name=self.name,
description=self.description,
)
else:
answer = self.__class__(
self.seq[index],
id=self.id,
name=self.name,
description=self.description,
)
# TODO - The description may no longer apply.
# It would be safer to change it to something
# generic like "edited" or the default value.
# Don't copy the annotation dict and dbxefs list,
# they may not apply to a subsequence.
# answer.annotations = dict(self.annotations.items())
# answer.dbxrefs = self.dbxrefs[:]
# TODO - Review this in light of adding SeqRecord objects?
if "molecule_type" in self.annotations:
# This will still apply, and we need it for GenBank/EMBL etc output
answer.annotations["molecule_type"] = self.annotations["molecule_type"]
# TODO - Cope with strides by generating ambiguous locations?
start, stop, step = index.indices(parent_length)
if step == 1:
# Select relevant features, add them with shifted locations
# assert str(self.seq)[index] == str(self.seq)[start:stop]
for f in self.features:
if f.ref or f.ref_db:
# TODO - Implement this (with lots of tests)?
import warnings
warnings.warn(
"When slicing SeqRecord objects, any "
"SeqFeature referencing other sequences (e.g. "
"from segmented GenBank records) are ignored."
)
continue
try:
if start <= f.location.start and f.location.end <= stop:
answer.features.append(f._shift(-start))
except TypeError:
# Will fail on UnknownPosition
pass
# Slice all the values to match the sliced sequence
# (this should also work with strides, even negative strides):
for key, value in self.letter_annotations.items():
answer._per_letter_annotations[key] = value[index]
return answer
raise ValueError("Invalid index")
def __iter__(self):
"""Iterate over the letters in the sequence.
For example, using Bio.SeqIO to read in a protein FASTA file:
>>> from Bio import SeqIO
>>> record = SeqIO.read("Fasta/loveliesbleeding.pro", "fasta")
>>> for amino in record:
... print(amino)
... if amino == "L": break
X
A
G
L
>>> print(record.seq[3])
L
This is just a shortcut for iterating over the sequence directly:
>>> for amino in record.seq:
... print(amino)
... if amino == "L": break
X
A
G
L
>>> print(record.seq[3])
L
Note that this does not facilitate iteration together with any
per-letter-annotation. However, you can achieve that using the
python zip function on the record (or its sequence) and the relevant
per-letter-annotation:
>>> from Bio import SeqIO
>>> rec = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
>>> print("%s %s" % (rec.id, rec.seq))
slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
>>> print(list(rec.letter_annotations))
['solexa_quality']
>>> for nuc, qual in zip(rec, rec.letter_annotations["solexa_quality"]):
... if qual > 35:
... print("%s %i" % (nuc, qual))
A 40
C 39
G 38
T 37
A 36
You may agree that using zip(rec.seq, ...) is more explicit than using
zip(rec, ...) as shown above.
"""
return iter(self.seq)
def __contains__(self, char):
"""Implement the 'in' keyword, searches the sequence.
e.g.
>>> from Bio import SeqIO
>>> record = SeqIO.read("Fasta/sweetpea.nu", "fasta")
>>> "GAATTC" in record
False
>>> "AAA" in record
True
This essentially acts as a proxy for using "in" on the sequence:
>>> "GAATTC" in record.seq
False
>>> "AAA" in record.seq
True
Note that you can also use Seq objects as the query,
>>> from Bio.Seq import Seq
>>> Seq("AAA") in record
True
See also the Seq object's __contains__ method.
"""
return char in self.seq
def __str__(self):
"""Return a human readable summary of the record and its annotation (string).
The python built in function str works by calling the object's __str__
method. e.g.
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
... id="YP_025292.1", name="HokC",
... description="toxic membrane protein, small")
>>> print(str(record))
ID: YP_025292.1
Name: HokC
Description: toxic membrane protein, small
Number of features: 0
Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF')
In this example you don't actually need to call str explicitly, as the
print command does this automatically:
>>> print(record)
ID: YP_025292.1
Name: HokC
Description: toxic membrane protein, small
Number of features: 0
Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF')
Note that long sequences are shown truncated.
"""
lines = []
if self.id:
lines.append(f"ID: {self.id}")
if self.name:
lines.append(f"Name: {self.name}")
if self.description:
lines.append(f"Description: {self.description}")
if self.dbxrefs:
lines.append("Database cross-references: " + ", ".join(self.dbxrefs))
lines.append(f"Number of features: {len(self.features)}")
for a in self.annotations:
lines.append(f"/{a}={str(self.annotations[a])}")
if self.letter_annotations:
lines.append(
"Per letter annotation for: " + ", ".join(self.letter_annotations)
)
try:
bytes(self.seq)
except UndefinedSequenceError:
lines.append(f"Undefined sequence of length {len(self.seq)}")
else:
# Don't want to include the entire sequence
seq = repr(self.seq)
lines.append(seq)
return "\n".join(lines)
def __repr__(self):
"""Return a concise summary of the record for debugging (string).
The python built in function repr works by calling the object's __repr__
method. e.g.
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> rec = SeqRecord(Seq("MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKAT"
... "GEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQ"
... "SGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQ"
... "PQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF"),
... id="NP_418483.1", name="b4059",
... description="ssDNA-binding protein",
... dbxrefs=["ASAP:13298", "GI:16131885", "GeneID:948570"])
>>> print(repr(rec))
SeqRecord(seq=Seq('MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTE...IPF'), id='NP_418483.1', name='b4059', description='ssDNA-binding protein', dbxrefs=['ASAP:13298', 'GI:16131885', 'GeneID:948570'])
At the python prompt you can also use this shorthand:
>>> rec
SeqRecord(seq=Seq('MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTE...IPF'), id='NP_418483.1', name='b4059', description='ssDNA-binding protein', dbxrefs=['ASAP:13298', 'GI:16131885', 'GeneID:948570'])
Note that long sequences are shown truncated. Also note that any
annotations, letter_annotations and features are not shown (as they
would lead to a very long string).
"""
return (
f"{self.__class__.__name__}(seq={self.seq!r}, id={self.id!r},"
f" name={self.name!r}, description={self.description!r},"
f" dbxrefs={self.dbxrefs!r})"
)
def format(self, format):
r"""Return the record as a string in the specified file format.
The format should be a lower case string supported as an output
format by Bio.SeqIO, which is used to turn the SeqRecord into a
string. e.g.
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
... id="YP_025292.1", name="HokC",
... description="toxic membrane protein")
>>> record.format("fasta")
'>YP_025292.1 toxic membrane protein\nMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF\n'
>>> print(record.format("fasta"))
>YP_025292.1 toxic membrane protein
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
<BLANKLINE>
The Python print function automatically appends a new line, meaning
in this example a blank line is shown. If you look at the string
representation you can see there is a trailing new line (shown as
slash n) which is important when writing to a file or if
concatenating multiple sequence strings together.
Note that this method will NOT work on every possible file format
supported by Bio.SeqIO (e.g. some are for multiple sequences only,
and binary formats are not supported).
"""
# See also the __format__ method
return self.__format__(format)
def __format__(self, format_spec):
r"""Return the record as a string in the specified file format.
This method supports the Python format() function and f-strings.
The format_spec should be a lower case string supported by
Bio.SeqIO as a text output file format. Requesting a binary file
format raises a ValueError. e.g.
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
... id="YP_025292.1", name="HokC",
... description="toxic membrane protein")
...
>>> format(record, "fasta")
'>YP_025292.1 toxic membrane protein\nMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF\n'
>>> print(f"Here is {record.id} in FASTA format:\n{record:fasta}")
Here is YP_025292.1 in FASTA format:
>YP_025292.1 toxic membrane protein
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
<BLANKLINE>
See also the SeqRecord's format() method.
"""
if not format_spec:
# Follow python convention and default to using __str__
return str(self)
from Bio import SeqIO
# Easy case, can call string-building function directly
if format_spec in SeqIO._FormatToString:
return SeqIO._FormatToString[format_spec](self)
# Harder case, make a temp handle instead
handle = StringIO()
try:
SeqIO.write(self, handle, format_spec)
except StreamModeError:
raise ValueError(
"Binary format %s cannot be used with SeqRecord format method"
% format_spec
) from None
return handle.getvalue()
def __len__(self):
"""Return the length of the sequence.
For example, using Bio.SeqIO to read in a FASTA nucleotide file:
>>> from Bio import SeqIO
>>> record = SeqIO.read("Fasta/sweetpea.nu", "fasta")
>>> len(record)
309
>>> len(record.seq)
309
"""
return len(self.seq)
def __lt__(self, other):
"""Define the less-than operand (not implemented)."""
raise NotImplementedError(_NO_SEQRECORD_COMPARISON)
def __le__(self, other):
"""Define the less-than-or-equal-to operand (not implemented)."""
raise NotImplementedError(_NO_SEQRECORD_COMPARISON)
def __eq__(self, other):
"""Define the equal-to operand (not implemented)."""
raise NotImplementedError(_NO_SEQRECORD_COMPARISON)
def __ne__(self, other):
"""Define the not-equal-to operand (not implemented)."""
raise NotImplementedError(_NO_SEQRECORD_COMPARISON)
def __gt__(self, other):
"""Define the greater-than operand (not implemented)."""
raise NotImplementedError(_NO_SEQRECORD_COMPARISON)
def __ge__(self, other):
"""Define the greater-than-or-equal-to operand (not implemented)."""
raise NotImplementedError(_NO_SEQRECORD_COMPARISON)
def __bool__(self):
"""Boolean value of an instance of this class (True).
This behaviour is for backwards compatibility, since until the
__len__ method was added, a SeqRecord always evaluated as True.
Note that in comparison, a Seq object will evaluate to False if it
has a zero length sequence.
WARNING: The SeqRecord may in future evaluate to False when its
sequence is of zero length (in order to better match the Seq
object behaviour)!
"""
return True
def __add__(self, other):
"""Add another sequence or string to this sequence.
The other sequence can be a SeqRecord object, a Seq object (or
similar, e.g. a MutableSeq) or a plain Python string. If you add
a plain string or a Seq (like) object, the new SeqRecord will simply
have this appended to the existing data. However, any per letter
annotation will be lost:
>>> from Bio import SeqIO
>>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
>>> print("%s %s" % (record.id, record.seq))
slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
>>> print(list(record.letter_annotations))
['solexa_quality']
>>> new = record + "ACT"
>>> print("%s %s" % (new.id, new.seq))
slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNNACT
>>> print(list(new.letter_annotations))
[]
The new record will attempt to combine the annotation, but for any
ambiguities (e.g. different names) it defaults to omitting that
annotation.
>>> from Bio import SeqIO
>>> with open("GenBank/pBAD30.gb") as handle:
... plasmid = SeqIO.read(handle, "gb")
>>> print("%s %i" % (plasmid.id, len(plasmid)))
pBAD30 4923
Now let's cut the plasmid into two pieces, and join them back up the
other way round (i.e. shift the starting point on this plasmid, have
a look at the annotated features in the original file to see why this
particular split point might make sense):
>>> left = plasmid[:3765]
>>> right = plasmid[3765:]
>>> new = right + left
>>> print("%s %i" % (new.id, len(new)))
pBAD30 4923
>>> str(new.seq) == str(right.seq + left.seq)
True
>>> len(new.features) == len(left.features) + len(right.features)
True
When we add the left and right SeqRecord objects, their annotation
is all consistent, so it is all conserved in the new SeqRecord:
>>> new.id == left.id == right.id == plasmid.id
True
>>> new.name == left.name == right.name == plasmid.name
True
>>> new.description == plasmid.description
True
>>> new.annotations == left.annotations == right.annotations
True
>>> new.letter_annotations == plasmid.letter_annotations
True
>>> new.dbxrefs == left.dbxrefs == right.dbxrefs
True
However, we should point out that when we sliced the SeqRecord,
any annotations dictionary or dbxrefs list entries were lost.
You can explicitly copy them like this:
>>> new.annotations = plasmid.annotations.copy()
>>> new.dbxrefs = plasmid.dbxrefs[:]
"""
if not isinstance(other, SeqRecord):
# Assume it is a string or a Seq.
# Note can't transfer any per-letter-annotations
return SeqRecord(
self.seq + other,
id=self.id,
name=self.name,
description=self.description,
features=self.features[:],
annotations=self.annotations.copy(),
dbxrefs=self.dbxrefs[:],
)
# Adding two SeqRecord objects... must merge annotation.
answer = SeqRecord(
self.seq + other.seq, features=self.features[:], dbxrefs=self.dbxrefs[:]
)
# Will take all the features and all the db cross refs,
length = len(self)
for f in other.features:
answer.features.append(f._shift(length))
del length
for ref in other.dbxrefs:
if ref not in answer.dbxrefs:
answer.dbxrefs.append(ref)
# Take common id/name/description/annotation
if self.id == other.id:
answer.id = self.id
if self.name == other.name:
answer.name = self.name
if self.description == other.description:
answer.description = self.description
for k, v in self.annotations.items():
if k in other.annotations and other.annotations[k] == v:
answer.annotations[k] = v
# Can append matching per-letter-annotation
for k, v in self.letter_annotations.items():
if k in other.letter_annotations:
answer.letter_annotations[k] = v + other.letter_annotations[k]
return answer
def __radd__(self, other):
"""Add another sequence or string to this sequence (from the left).
This method handles adding a Seq object (or similar, e.g. MutableSeq)
or a plain Python string (on the left) to a SeqRecord (on the right).
See the __add__ method for more details, but for example:
>>> from Bio import SeqIO
>>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
>>> print("%s %s" % (record.id, record.seq))
slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
>>> print(list(record.letter_annotations))
['solexa_quality']
>>> new = "ACT" + record
>>> print("%s %s" % (new.id, new.seq))
slxa_0001_1_0001_01 ACTACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
>>> print(list(new.letter_annotations))
[]
"""
if isinstance(other, SeqRecord):
raise RuntimeError(
"This should have happened via the __add__ of "
"the other SeqRecord being added!"
)
# Assume it is a string or a Seq.
# Note can't transfer any per-letter-annotations
offset = len(other)
return SeqRecord(
other + self.seq,
id=self.id,
name=self.name,
description=self.description,
features=[f._shift(offset) for f in self.features],
annotations=self.annotations.copy(),
dbxrefs=self.dbxrefs[:],
)
def count(self, sub, start=None, end=None):
"""Return the number of non-overlapping occurrences of sub in seq[start:end].
Optional arguments start and end are interpreted as in slice notation.
This method behaves as the count method of Python strings.
"""
return self.seq.count(sub, start, end)
def upper(self):
"""Return a copy of the record with an upper case sequence.
All the annotation is preserved unchanged. e.g.
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> record = SeqRecord(Seq("acgtACGT"), id="Test",
... description = "Made up for this example")
>>> record.letter_annotations["phred_quality"] = [1, 2, 3, 4, 5, 6, 7, 8]
>>> print(record.upper().format("fastq"))
@Test Made up for this example
ACGTACGT
+
"#$%&'()
<BLANKLINE>
Naturally, there is a matching lower method:
>>> print(record.lower().format("fastq"))
@Test Made up for this example
acgtacgt
+
"#$%&'()
<BLANKLINE>
"""
return SeqRecord(
self.seq.upper(),
id=self.id,
name=self.name,
description=self.description,
dbxrefs=self.dbxrefs[:],
features=self.features[:],
annotations=self.annotations.copy(),
letter_annotations=self.letter_annotations.copy(),
)
def lower(self):
"""Return a copy of the record with a lower case sequence.
All the annotation is preserved unchanged. e.g.
>>> from Bio import SeqIO
>>> record = SeqIO.read("Fasta/aster.pro", "fasta")
>>> print(record.format("fasta"))
>gi|3298468|dbj|BAA31520.1| SAMIPF
GGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSTVACLLLKFVTNDMAVGVFSLSAGVG
VTNALVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANI
<BLANKLINE>
>>> print(record.lower().format("fasta"))
>gi|3298468|dbj|BAA31520.1| SAMIPF
gghvnpavtfgafvggnitllrgivyiiaqllgstvaclllkfvtndmavgvfslsagvg
vtnalvfeivmtfglvytvyataidpkkgslgtiapiaigfivgani
<BLANKLINE>
To take a more annotation rich example,
>>> from Bio import SeqIO
>>> old = SeqIO.read("EMBL/TRBG361.embl", "embl")
>>> len(old.features)
3
>>> new = old.lower()
>>> len(old.features) == len(new.features)
True
>>> old.annotations["organism"] == new.annotations["organism"]
True
>>> old.dbxrefs == new.dbxrefs
True
"""
return SeqRecord(
self.seq.lower(),
id=self.id,
name=self.name,
description=self.description,
dbxrefs=self.dbxrefs[:],
features=self.features[:],
annotations=self.annotations.copy(),
letter_annotations=self.letter_annotations.copy(),
)
def isupper(self):
"""Return True if all ASCII characters in the record's sequence are uppercase.
If there are no cased characters, the method returns False.
"""
return self.seq.isupper()
def islower(self):
"""Return True if all ASCII characters in the record's sequence are lowercase.
If there are no cased characters, the method returns False.
"""
return self.seq.islower()
def reverse_complement(
self,
id=False,
name=False,
description=False,
features=True,
annotations=False,
letter_annotations=True,
dbxrefs=False,
):
"""Return new SeqRecord with reverse complement sequence.
By default the new record does NOT preserve the sequence identifier,
name, description, general annotation or database cross-references -
these are unlikely to apply to the reversed sequence.
You can specify the returned record's id, name and description as
strings, or True to keep that of the parent, or False for a default.
You can specify the returned record's features with a list of
SeqFeature objects, or True to keep that of the parent, or False to
omit them. The default is to keep the original features (with the
strand and locations adjusted).
You can also specify both the returned record's annotations and
letter_annotations as dictionaries, True to keep that of the parent,
or False to omit them. The default is to keep the original
annotations (with the letter annotations reversed).
To show what happens to the pre-letter annotations, consider an
example Solexa variant FASTQ file with a single entry, which we'll
read in as a SeqRecord:
>>> from Bio import SeqIO
>>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
>>> print("%s %s" % (record.id, record.seq))
slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
>>> print(list(record.letter_annotations))
['solexa_quality']
>>> print(record.letter_annotations["solexa_quality"])
[40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0, -1, -2, -3, -4, -5]
Now take the reverse complement, here we explicitly give a new
identifier (the old identifier with a suffix):
>>> rc_record = record.reverse_complement(id=record.id + "_rc")
>>> print("%s %s" % (rc_record.id, rc_record.seq))
slxa_0001_1_0001_01_rc NNNNNNACGTACGTACGTACGTACGTACGTACGTACGTACGTACGT
Notice that the per-letter-annotations have also been reversed,
although this may not be appropriate for all cases.
>>> print(rc_record.letter_annotations["solexa_quality"])
[-5, -4, -3, -2, -1, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40]
Now for the features, we need a different example. Parsing a GenBank
file is probably the easiest way to get an nice example with features
in it...
>>> from Bio import SeqIO
>>> with open("GenBank/pBAD30.gb") as handle:
... plasmid = SeqIO.read(handle, "gb")
>>> print("%s %i" % (plasmid.id, len(plasmid)))
pBAD30 4923
>>> plasmid.seq
Seq('GCTAGCGGAGTGTATACTGGCTTACTATGTTGGCACTGATGAGGGTGTCAGTGA...ATG')
>>> len(plasmid.features)
13
Now, let's take the reverse complement of this whole plasmid:
>>> rc_plasmid = plasmid.reverse_complement(id=plasmid.id+"_rc")
>>> print("%s %i" % (rc_plasmid.id, len(rc_plasmid)))
pBAD30_rc 4923
>>> rc_plasmid.seq
Seq('CATGGGCAAATATTATACGCAAGGCGACAAGGTGCTGATGCCGCTGGCGATTCA...AGC')
>>> len(rc_plasmid.features)
13
Let's compare the first CDS feature - it has gone from being the
second feature (index 1) to the second last feature (index -2), its
strand has changed, and the location switched round.
>>> print(plasmid.features[1])
type: CDS
location: [1081:1960](-)
qualifiers:
Key: label, Value: ['araC']
Key: note, Value: ['araC regulator of the arabinose BAD promoter']
Key: vntifkey, Value: ['4']
<BLANKLINE>
>>> print(rc_plasmid.features[-2])
type: CDS
location: [2963:3842](+)
qualifiers:
Key: label, Value: ['araC']
Key: note, Value: ['araC regulator of the arabinose BAD promoter']
Key: vntifkey, Value: ['4']
<BLANKLINE>
You can check this new location, based on the length of the plasmid:
>>> len(plasmid) - 1081
3842
>>> len(plasmid) - 1960
2963
Note that if the SeqFeature annotation includes any strand specific
information (e.g. base changes for a SNP), this information is not
amended, and would need correction after the reverse complement.
Note trying to reverse complement a protein SeqRecord raises an
exception:
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> protein_rec = SeqRecord(Seq("MAIVMGR"), id="Test",
... annotations={"molecule_type": "protein"})
>>> protein_rec.reverse_complement()
Traceback (most recent call last):
...
ValueError: Proteins do not have complements!
If you have RNA without any U bases, it must be annotated as RNA
otherwise it will be treated as DNA by default with A mapped to T:
>>> from Bio.Seq import Seq
>>> from Bio.SeqRecord import SeqRecord
>>> rna1 = SeqRecord(Seq("ACG"), id="Test")
>>> rna2 = SeqRecord(Seq("ACG"), id="Test", annotations={"molecule_type": "RNA"})
>>> print(rna1.reverse_complement(id="RC", description="unk").format("fasta"))
>RC unk
CGT
<BLANKLINE>
>>> print(rna2.reverse_complement(id="RC", description="RNA").format("fasta"))
>RC RNA
CGU
<BLANKLINE>
Also note you can reverse complement a SeqRecord using a MutableSeq:
>>> from Bio.Seq import MutableSeq
>>> from Bio.SeqRecord import SeqRecord
>>> rec = SeqRecord(MutableSeq("ACGT"), id="Test")
>>> rec.seq[0] = "T"
>>> print("%s %s" % (rec.id, rec.seq))
Test TCGT
>>> rc = rec.reverse_complement(id=True)
>>> print("%s %s" % (rc.id, rc.seq))
Test ACGA
"""
from Bio.Seq import Seq, MutableSeq # Lazy to avoid circular imports
if "protein" in self.annotations.get("molecule_type", ""):
raise ValueError("Proteins do not have complements!")
if "RNA" in self.annotations.get("molecule_type", ""):
seq = self.seq.reverse_complement_rna(
inplace=False
) # TODO: remove inplace=False
else:
# Default to DNA)
seq = self.seq.reverse_complement(
inplace=False
) # TODO: remove inplace=False
if isinstance(self.seq, MutableSeq):
seq = Seq(seq)
answer = SeqRecord(seq)
if isinstance(id, str):
answer.id = id
elif id:
answer.id = self.id
if isinstance(name, str):
answer.name = name
elif name:
answer.name = self.name
if isinstance(description, str):
answer.description = description
elif description:
answer.description = self.description
if isinstance(dbxrefs, list):
answer.dbxrefs = dbxrefs
elif dbxrefs:
# Copy the old dbxrefs
answer.dbxrefs = self.dbxrefs[:]
if isinstance(features, list):
answer.features = features
elif features:
# Copy the old features, adjusting location and string
length = len(answer)
answer.features = [f._flip(length) for f in self.features]
# The old list should have been sorted by start location,
# reversing it will leave it sorted by what is now the end position,
# so we need to resort in case of overlapping features.
# NOTE - In the common case of gene before CDS (and similar) with
# the exact same locations, this will still maintain gene before CDS
def key_fun(f):
"""Sort on start position."""
try:
return int(f.location.start)
except TypeError: # Expected for UnknownPosition
return None
answer.features.sort(key=key_fun)
if isinstance(annotations, dict):
answer.annotations = annotations
elif annotations:
# Copy the old annotations,
answer.annotations = self.annotations.copy()
if isinstance(letter_annotations, dict):
answer.letter_annotations = letter_annotations
elif letter_annotations:
# Copy the old per letter annotations, reversing them
for key, value in self.letter_annotations.items():
answer._per_letter_annotations[key] = value[::-1]
return answer
def translate(
self,
# Seq translation arguments:
table="Standard",
stop_symbol="*",
to_stop=False,
cds=False,
gap=None,
# SeqRecord annotation arguments:
id=False,
name=False,
description=False,
features=False,
annotations=False,
letter_annotations=False,
dbxrefs=False,
):
"""Return new SeqRecord with translated sequence.
This calls the record's .seq.translate() method (which describes
the translation related arguments, like table for the genetic code),
By default the new record does NOT preserve the sequence identifier,
name, description, general annotation or database cross-references -
these are unlikely to apply to the translated sequence.
You can specify the returned record's id, name and description as
strings, or True to keep that of the parent, or False for a default.
You can specify the returned record's features with a list of
SeqFeature objects, or False (default) to omit them.
You can also specify both the returned record's annotations and
letter_annotations as dictionaries, True to keep that of the parent
(annotations only), or False (default) to omit them.
e.g. Loading a FASTA gene and translating it,
>>> from Bio import SeqIO
>>> gene_record = SeqIO.read("Fasta/sweetpea.nu", "fasta")
>>> print(gene_record.format("fasta"))
>gi|3176602|gb|U78617.1|LOU78617 Lathyrus odoratus phytochrome A (PHYA) gene, partial cds
CAGGCTGCGCGGTTTCTATTTATGAAGAACAAGGTCCGTATGATAGTTGATTGTCATGCA
AAACATGTGAAGGTTCTTCAAGACGAAAAACTCCCATTTGATTTGACTCTGTGCGGTTCG
ACCTTAAGAGCTCCACATAGTTGCCATTTGCAGTACATGGCTAACATGGATTCAATTGCT
TCATTGGTTATGGCAGTGGTCGTCAATGACAGCGATGAAGATGGAGATAGCCGTGACGCA
GTTCTACCACAAAAGAAAAAGAGACTTTGGGGTTTGGTAGTTTGTCATAACACTACTCCG
AGGTTTGTT
<BLANKLINE>
And now translating the record, specifying the new ID and description:
>>> protein_record = gene_record.translate(table=11,
... id="phya",
... description="translation")
>>> print(protein_record.format("fasta"))
>phya translation
QAARFLFMKNKVRMIVDCHAKHVKVLQDEKLPFDLTLCGSTLRAPHSCHLQYMANMDSIA
SLVMAVVVNDSDEDGDSRDAVLPQKKKRLWGLVVCHNTTPRFV
<BLANKLINE>
"""
if "protein" == self.annotations.get("molecule_type", ""):
raise ValueError("Proteins cannot be translated!")
answer = SeqRecord(
self.seq.translate(
table=table, stop_symbol=stop_symbol, to_stop=to_stop, cds=cds, gap=gap
)
)
if isinstance(id, str):
answer.id = id
elif id:
answer.id = self.id
if isinstance(name, str):
answer.name = name
elif name:
answer.name = self.name
if isinstance(description, str):
answer.description = description
elif description:
answer.description = self.description
if isinstance(dbxrefs, list):
answer.dbxrefs = dbxrefs
elif dbxrefs:
# Copy the old dbxrefs
answer.dbxrefs = self.dbxrefs[:]
if isinstance(features, list):
answer.features = features
elif features:
# Does not make sense to copy old features as locations wrong
raise TypeError(f"Unexpected features argument {features!r}")
if isinstance(annotations, dict):
answer.annotations = annotations
elif annotations:
# Copy the old annotations
answer.annotations = self.annotations.copy()
# Set/update to protein:
answer.annotations["molecule_type"] = "protein"
if isinstance(letter_annotations, dict):
answer.letter_annotations = letter_annotations
elif letter_annotations:
# Does not make sense to copy these as length now wrong
raise TypeError(
f"Unexpected letter_annotations argument {letter_annotations!r}"
)
return answer
if __name__ == "__main__":
from Bio._utils import run_doctest
run_doctest()
|