1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316
  
     | 
    
      # hmmscan :: search sequence(s) against a profile database
# HMMER 3.0 (March 2010); http://hmmer.org/
# Copyright (C) 2010 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             mult.fasta
# target HMM database:             /home/bow/db/hmmer/Pfam-A.hmm
# output directed to file:         hmmer_cases/text_hmmscan_mult.out
# per-seq hits tabular output:     hmmer_cases/tab_hmmscan_mult.out
# per-dom hits tabular output:     hmmer_cases/domtab_hmmscan_mult.out
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:       random_s00  [L=32]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   [No hits detected that satisfy reporting thresholds]
Domain annotation for each model (and alignments):
   [No targets detected that satisfy reporting thresholds]
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (32 residues)
Target model(s):                       13672  (2396357 nodes)
Passed MSV filter:                       338  (0.0247221); expected 273.4 (0.02)
Passed bias filter:                       87  (0.00636337); expected 273.4 (0.02)
Passed Vit filter:                        23  (0.00168227); expected 13.7 (0.001)
Passed Fwd filter:                        14  (0.00102399); expected 0.1 (1e-05)
Initial search space (Z):              13672  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.20u 0.12s 00:00:00.32 Elapsed: 00:00:00.19
# Mc/sec: 403.60
//
Query:       gi|4885477|ref|NP_005359.1|  [L=154]
Description: myoglobin [Homo sapiens]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      6e-21   74.6   0.3    9.2e-21   74.0   0.2    1.3  1  Globin   Globin
Domain annotation for each model (and alignments):
>> Globin  Globin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.0   0.2   6.7e-25   9.2e-21       1     107 [.       7     112 ..       7     113 .. 0.97
  Alignments for each domain:
  == domain 1    score: 74.0 bits;  conditional E-value: 6.7e-25
                                  HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHSGGGGGGGCCCTTTT.HHHHHTSCHHHHHHHHHHHHHHHHHHCTTSHHHHHH CS
                       Globin   1 qkalvkaswekvkanaeeigaeilkrlfkaypdtkklFkkfgdls.aedlksspkfkahakkvlaaldeavknldnddnlka 81 
                                  +++lv   w+kv+a+++ +g+e+l rlfk +p+t ++F kf+ l+  +++k s+++k+h+++vl al+ ++k+   ++ ++a
  gi|4885477|ref|NP_005359.1|   7 EWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKsEDEMKASEDLKKHGATVLTALGGILKK---KGHHEA 85 
                                  5789*********************************************************************...6899** PP
                                  HHHHHHHHHHTT-.--HHHHCCHHHHH CS
                       Globin  82 alkklgarHakrg.vdpanfklfgeal 107
                                  ++k l+++Ha+++ ++ ++ + ++e++
  gi|4885477|ref|NP_005359.1|  86 EIKPLAQSHATKHkIPVKYLEFISECI 112
                                  *********************999998 PP
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (154 residues)
Target model(s):                       13672  (2396357 nodes)
Passed MSV filter:                       458  (0.0334991); expected 273.4 (0.02)
Passed bias filter:                      404  (0.0295494); expected 273.4 (0.02)
Passed Vit filter:                        31  (0.00226741); expected 13.7 (0.001)
Passed Fwd filter:                         1  (7.31422e-05); expected 0.1 (1e-05)
Initial search space (Z):              13672  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.33u 0.16s 00:00:00.49 Elapsed: 00:00:00.21
# Mc/sec: 1757.33
//
Query:       gi|126362951:116-221  [L=106]
Description: leukocyte immunoglobulin-like receptor subfamily B member 1 isoform 2 precursor [Homo sapiens]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.4e-09   38.2   0.4    2.1e-09   37.6   0.3    1.3  1  Ig_3     Immunoglobulin domain
    3.5e-05   23.7   0.1    4.3e-05   23.4   0.1    1.1  1  Ig_2     Immunoglobulin domain
Domain annotation for each model (and alignments):
>> Ig_3  Immunoglobulin domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.6   0.3     3e-13   2.1e-09       1      73 [.       9      84 ..       9      88 .. 0.94
  Alignments for each domain:
  == domain 1    score: 37.6 bits;  conditional E-value: 3e-13
                  Ig_3  1 kPvisvspsptvtsggnvtLtCsaeggpppptisWy.....ietppelqgsegssssestLtissvtsedsgtYtCva 73
                          kP++s++psp+v+sggnv L+C ++     + +s +     +++   +++++ ++ss +++++ +v+++ +  Y+C+a
  gi|126362951:116-221  9 KPTLSAQPSPVVNSGGNVILQCDSQVA--FDGFSLCkegedEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYA 84
                          8************************99..78888888****************************************9 PP
>> Ig_2  Immunoglobulin domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.4   0.1   6.2e-09   4.3e-05       1      80 []       9     104 ..       9     104 .. 0.71
  Alignments for each domain:
  == domain 1    score: 23.4 bits;  conditional E-value: 6.2e-09
                  Ig_2   1 kpvlvapp.svvtegenvtLtCsapgnptprvqwykdg.vels......qsqnq........lfipnvsaedsgtYtCra....rnseg 69 
                           kp+l+a+p +vv++g nv L+C ++    + +++ k+g +e +      +            + +  vs++    Y+C+a    + +e+
  gi|126362951:116-221   9 KPTLSAQPsPVVNSGGNVILQCDSQVA-FDGFSLCKEGeDEHPqclnsqP---HargssraiFSVGPVSPSRRWWYRCYAydsnSPYEW 93 
                           799998885779*************85.899***9988655554443320...134455543444669************884433445 PP
                  Ig_2  70 gktstsveltv 80 
                           + +s+ +el v
  gi|126362951:116-221  94 SLPSDLLELLV 104
                           88888888766 PP
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (106 residues)
Target model(s):                       13672  (2396357 nodes)
Passed MSV filter:                       153  (0.0111908); expected 273.4 (0.02)
Passed bias filter:                      143  (0.0104593); expected 273.4 (0.02)
Passed Vit filter:                        11  (0.000804564); expected 13.7 (0.001)
Passed Fwd filter:                         2  (0.000146284); expected 0.1 (1e-05)
Initial search space (Z):              13672  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.26u 0.14s 00:00:00.40 Elapsed: 00:00:00.20
# Mc/sec: 1270.07
//
Query:       gi|22748937|ref|NP_065801.1|  [L=1204]
Description: exportin-5 [Homo sapiens]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    7.8e-34  116.6   7.8    1.1e-33  116.1   3.4    2.8  2  Xpo1     Exportin 1-like protein
     0.0039   16.9   0.0      0.033   14.0   0.0    2.7  2  IBN_N    Importin-beta N-terminal domain
Domain annotation for each model (and alignments):
>> Xpo1  Exportin 1-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  116.1   3.4   1.6e-37   1.1e-33       2     148 .]     110     271 ..     109     271 .. 0.98
   2 ?   -1.8   0.0      0.35   2.4e+03     112     139 ..     499     525 ..     496     529 .. 0.86
  Alignments for each domain:
  == domain 1    score: 116.1 bits;  conditional E-value: 1.6e-37
                                   HHHHHHHHHHHHHHHHHHTTTTSTTHHHHHHHHHHG-HHHHHHHHHHHHHHHHHHCCS-TTTS-CCCHHHHHHHCHHHHHH CS
                          Xpo1   2 kflrnklaealaelflqeypnqWpsffddllsllssspsglelllriLkvlpeEiadfsrskleqerrnelkdllrsqvqk 82 
                                   +++++ l+++++e++++e+p++Wp+++ +l  l++++++++el++ iL++l+e++++f  ++l  +rr++++++l++++++
  gi|22748937|ref|NP_065801.1| 110 NHIKDALSRIVVEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTF--QTLPPQRRRDIQQTLTQNMER 188
                                   89******************************************************99..79******************* PP
                                   HHHHHHHHHC-TT-..................HHHHHHHHHHHHHHCTTS-CHHCHCS...HHHHHCHHCCSCCCHHHHHH CS
                          Xpo1  83 ilelllqileqsvskk...............sselveatLkclsswvswidiglivnsp..llsllfqlLndpelreaAve 146
                                   i+++ll+ l+++v+k+               ++++  a+L++l+ +++w+++++i +++  ll++l+ lLn++el+  A+e
  gi|22748937|ref|NP_065801.1| 189 IFSFLLNTLQENVNKYqqvktdtsqeskaqaNCRVGVAALNTLAGYIDWVSMSHITAENckLLEILCLLLNEQELQLGAAE 269
                                   **************99*****************************************8889******************** PP
                                   HH CS
                          Xpo1 147 cL 148
                                   cL
  gi|22748937|ref|NP_065801.1| 270 CL 271
                                   *8 PP
  == domain 2    score: -1.8 bits;  conditional E-value: 0.35
                                   HHCTTS-CHHCHCS.HHHHHCHHCCSCC CS
                          Xpo1 112 swvswidiglivnspllsllfqlLndpe 139
                                   s+v+w  ++l+++s +++ +f+ Ln++e
  gi|22748937|ref|NP_065801.1| 499 SFVQWEAMTLFLES-VITQMFRTLNREE 525
                                   899*********98.8888899998776 PP
>> IBN_N  Importin-beta N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   14.0   0.0   4.8e-06     0.033       4      75 ..      36      98 ..      33     100 .. 0.87
   2 ?   -3.3   0.0       1.2     8e+03      57      75 ..     168     186 ..     165     187 .. 0.85
  Alignments for each domain:
  == domain 1    score: 14.0 bits;  conditional E-value: 4.8e-06
                                  HHHHHHHSCTHHHHHHHHHHHTTTSTHHHHHHHHHHHHHHHHHSCCHHHHHHHHCS-HHHHHHHHHHHHHHH CS
                         IBN_N  4 qLnqlekqkPgflsallqilanksldlevRqlAalyLknlItkhWkseeaqrqqqlpeeekelIrnnllnll 75
                                   ++++++  P ++++ l+++ +k+    vR++++++L++ ++ +W+         ++  ek +++n++ +l+
  gi|22748937|ref|NP_065801.1| 36 FCEEFKEKCPICVPCGLRLA-EKTQVAIVRHFGLQILEHVVKFRWN--------GMSRLEKVYLKNSVMELI 98
                                  56788886699*********.6555899******************........999999****99999887 PP
  == domain 2    score: -3.3 bits;  conditional E-value: 1.2
                                   HCS-HHHHHHHHHHHHHHH CS
                         IBN_N  57 qqlpeeekelIrnnllnll 75 
                                   q+lp++ + +I ++l + +
  gi|22748937|ref|NP_065801.1| 168 QTLPPQRRRDIQQTLTQNM 186
                                   6899*******99998865 PP
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (1204 residues)
Target model(s):                       13672  (2396357 nodes)
Passed MSV filter:                       520  (0.0380339); expected 273.4 (0.02)
Passed bias filter:                      319  (0.0233324); expected 273.4 (0.02)
Passed Vit filter:                        23  (0.00168227); expected 13.7 (0.001)
Passed Fwd filter:                         2  (0.000146284); expected 0.1 (1e-05)
Initial search space (Z):              13672  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 1.11u 0.17s 00:00:01.28 Elapsed: 00:00:00.72
# Mc/sec: 4007.24
//
Query:       gi|125490392|ref|NP_038661.2|  [L=352]
Description: POU domain, class 5, transcription factor 1 isoform 1 [Mus musculus]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      7e-37  124.8   0.5    1.4e-36  123.9   0.3    1.5  1  Pou         Pou domain - N-terminal to homeobox domain
    2.1e-18   65.5   1.1    4.1e-18   64.6   0.7    1.5  1  Homeobox    Homeobox domain
  ------ inclusion threshold ------
      0.012   15.6   0.0       0.16   12.0   0.0    2.2  2  HTH_31      Helix-turn-helix domain
      0.039   13.5   0.0      0.095   12.3   0.0    1.6  1  Homeobox_KN Homeobox KN domain
       0.14   10.5   0.1       0.26    9.6   0.1    1.4  1  DUF521      Protein of unknown function (DUF521)
Domain annotation for each model (and alignments):
>> Pou  Pou domain - N-terminal to homeobox domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  123.9   0.3     5e-40   1.4e-36       3      75 .]     133     205 ..     131     205 .. 0.97
  Alignments for each domain:
  == domain 1    score: 123.9 bits;  conditional E-value: 5e-40
                            Pou   3 eldleeleefakefkqrrikLgltqadvgsalgalyGkefsqttIcrFEalqLslknmckLkpllekWLeeae 75 
                                    ++ ++ele+fak +kq+ri+Lg+tqadvg +lg+l+Gk+fsqttIcrFEalqLslknmckL+pllekW+eea+
  gi|125490392|ref|NP_038661.2| 133 KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWVEEAD 205
                                    67899******************************************************************96 PP
>> Homeobox  Homeobox domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.6   0.7   1.5e-21   4.1e-18       1      57 []     224     280 ..     224     280 .. 0.98
  Alignments for each domain:
  == domain 1    score: 64.6 bits;  conditional E-value: 1.5e-21
                                    SS--SS--HHHHHHHHHHCCTSSS--HHHHHHHHHH----HHHHHHHHHHHHHHHHH CS
                       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                    +rkRt++++     Le +F k+++ps ++++++A++lgL++++V+vWF+NrR+k k+
  gi|125490392|ref|NP_038661.2| 224 KRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKR 280
                                    79****************************************************997 PP
>> HTH_31  Helix-turn-helix domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.0   0.0   5.7e-05      0.16       1      35 [.     141     181 ..     141     184 .. 0.96
   2 ?    0.8   0.0      0.19   5.2e+02      39      62 ..     245     268 ..     243     270 .. 0.86
  Alignments for each domain:
  == domain 1    score: 12.0 bits;  conditional E-value: 5.7e-05
                         HTH_31   1 aLGarLralReraGLtqeevAerlg......vSastlsrlE 35 
                                    +++ +L++ R + G tq++v+  lg      +S++t++r E
  gi|125490392|ref|NP_038661.2| 141 QFAKLLKQKRITLGYTQADVGLTLGvlfgkvFSQTTICRFE 181
                                    6999***********************************99 PP
  == domain 2    score: 0.8 bits;  conditional E-value: 0.19
                         HTH_31  39 rgrpsaavlaalaralgldpaera 62 
                                    ++ ps+++++ +a+ lgl+ + ++
  gi|125490392|ref|NP_038661.2| 245 CPKPSLQQITHIANQLGLEKDVVR 268
                                    678**************9988765 PP
>> Homeobox_KN  Homeobox KN domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.3   0.0   3.5e-05     0.095       7      39 ..     244     276 ..     241     277 .. 0.91
  Alignments for each domain:
  == domain 1    score: 12.3 bits;  conditional E-value: 3.5e-05
                    Homeobox_KN   7 hnPYPskevkeelakqTglsrkqidnWFiNaRr 39 
                                    + P Ps +++  +a+q gl  + +  WF N R 
  gi|125490392|ref|NP_038661.2| 244 KCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQ 276
                                    56779*************************996 PP
>> DUF521  Protein of unknown function (DUF521)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.6   0.1   9.4e-05      0.26     273     334 ..     221     280 ..     197     294 .. 0.77
  Alignments for each domain:
  == domain 1    score: 9.6 bits;  conditional E-value: 9.4e-05
                         DUF521 273 adlaavleelnkakkeevdlvvlGcPhlsleeleelaellkgrkkkvsvelvvttsravlsk 334
                                    + +++ + +++++   +++ ++l cP  sl++++++a++l  +k    v+++ +  r+  ++
  gi|125490392|ref|NP_038661.2| 221 QARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEK--DVVRVWFCNRRQKGKR 280
                                    345666667778888899************************99..9999999988876554 PP
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (352 residues)
Target model(s):                       13672  (2396357 nodes)
Passed MSV filter:                       603  (0.0441047); expected 273.4 (0.02)
Passed bias filter:                      465  (0.0340111); expected 273.4 (0.02)
Passed Vit filter:                        44  (0.00321826); expected 13.7 (0.001)
Passed Fwd filter:                         5  (0.000365711); expected 0.1 (1e-05)
Initial search space (Z):              13672  [actual number of targets]
Domain search space  (domZ):               5  [number of targets reported over threshold]
# CPU time: 0.51u 0.15s 00:00:00.66 Elapsed: 00:00:00.23
# Mc/sec: 3667.47
//
 
     |