1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340
  
     | 
    
      # hmmscan :: search sequence(s) against a profile database
# HMMER 3.1b1 (May 2013); http://hmmer.org/
# Copyright (C) 2013 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             prot_multi.fa
# target HMM database:             /home/bow/db/hmmer/protdb/Pfam-A.hmm
# output directed to file:         hmmscan/text_31b1_hmmscan_001.out
# per-seq hits tabular output:     hmmscan/tab_31b1_hmmscan_001.out
# per-dom hits tabular output:     hmmscan/domtab_31b1_hmmscan_001.out
# pfam-style tabular hit output:   hmmscan/pfamtab_31b1_hmmscan_001.out
# number of worker threads:        2
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:       random_s00  [L=22]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
   [No hits detected that satisfy reporting thresholds]
Domain annotation for each model (and alignments):
   [No targets detected that satisfy reporting thresholds]
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (22 residues searched)
Target model(s):                       14831  (2610332 nodes)
Passed MSV filter:                        57  (0.0038433); expected 296.6 (0.02)
Passed bias filter:                       44  (0.00296676); expected 296.6 (0.02)
Passed Vit filter:                         1  (6.74263e-05); expected 14.8 (0.001)
Passed Fwd filter:                         0  (0); expected 0.1 (1e-05)
Initial search space (Z):              14831  [actual number of targets]
Domain search space  (domZ):               0  [number of targets reported over threshold]
# CPU time: 0.30u 0.23s 00:00:00.53 Elapsed: 00:00:03.04
# Mc/sec: 18.89
//
Query:       gi|4885477|ref|NP_005359.1|  [L=154]
Description: myoglobin [Homo sapiens]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      1e-22   80.5   0.3    1.6e-22   79.8   0.3    1.3  1  Globin    Globin
Domain annotation for each model (and alignments):
>> Globin  Globin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   79.8   0.3   1.1e-26   1.6e-22       1     109 [.       7     112 ..       7     113 .. 0.97
  Alignments for each domain:
  == domain 1  score: 79.8 bits;  conditional E-value: 1.1e-26
                                  HHHHHHHHHHHHHTHHHHHHHHHHHHHHHHSGGGGGGSTTTTTTT-HHHHCTSHHHHHHHHHHHHHHHHHHHTTTSHHHHHH CS
                       Globin   1 dkalvkaswekvkanaeelgaeilkrlFkaypdtkklFkkfgdlssaedlksspkfkahakkvlaalgeavknldndealka 82 
                                  +++lv   w+kv+a+++ +g+e+l rlFk +p+t ++F kf++l+s +++k s+++k+h+++vl+alg ++k+   ++ ++a
  gi|4885477|ref|NP_005359.1|   7 EWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKK---KGHHEA 85 
                                  5789*********************************************************************...689*** PP
                                  HHHHHHHHHHTSTT--HHHHHHHHHHH CS
                       Globin  83 alkklaarHaergkvdpanFklfgeal 109
                                   +k la++Ha+++k++ ++ + ++e++
  gi|4885477|ref|NP_005359.1|  86 EIKPLAQSHATKHKIPVKYLEFISECI 112
                                  ************************998 PP
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (154 residues searched)
Target model(s):                       14831  (2610332 nodes)
Passed MSV filter:                       494  (0.0333086); expected 296.6 (0.02)
Passed bias filter:                      402  (0.0271054); expected 296.6 (0.02)
Passed Vit filter:                        35  (0.00235992); expected 14.8 (0.001)
Passed Fwd filter:                         1  (6.74263e-05); expected 0.1 (1e-05)
Initial search space (Z):              14831  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.38u 0.31s 00:00:00.69 Elapsed: 00:00:03.72
# Mc/sec: 108.06
//
Query:       gi|126362951|ref|NP_001075106.1|  [L=106]
Description: leukocyte immunoglobulin-like receptor subfamily B member 1 isoform 2 precursor [Homo sapiens]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    9.3e-10   38.8   0.4    1.4e-09   38.3   0.4    1.3  1  Ig_3      Immunoglobulin domain
    1.6e-06   28.1   0.1      2e-06   27.8   0.1    1.1  1  Ig_2      Immunoglobulin domain
Domain annotation for each model (and alignments):
>> Ig_3  Immunoglobulin domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.3   0.4   1.8e-13   1.4e-09       1      73 [.       8      83 ..       8      87 .. 0.95
  Alignments for each domain:
  == domain 1  score: 38.3 bits;  conditional E-value: 1.8e-13
                              Ig_3  1 kPvisvspsptvtsggnvtLtCsaeggpppptisWy.....ietppelqgsegssssestLtissvtsedsGtYtCva 73
                                      kP++s++psp+v+sggnv L+C ++     + +s +     +++   +++++ ++ss +++++ +v+++ +  Y+C+a
  gi|126362951|ref|NP_001075106.1|  8 KPTLSAQPSPVVNSGGNVILQCDSQVA--FDGFSLCkegedEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYA 83
                                      8************************99..78888888****************************************9 PP
>> Ig_2  Immunoglobulin domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.8   0.1   2.6e-10     2e-06       1      80 []       8     103 ..       8     103 .. 0.75
  Alignments for each domain:
  == domain 1  score: 27.8 bits;  conditional E-value: 2.6e-10
                              Ig_2   1 kpvlsapp.tvvtegenvtLtCqapgnptpkvqwykdg.....eelsqsqna.......lfipnvsaedsGtYtCra 64 
                                       kp+lsa+p +vv+ g nv L C ++   ++ +++ k+g     + l++++ a       + +  vs++    Y+C+a
  gi|126362951|ref|NP_001075106.1|   8 KPTLSAQPsPVVNSGGNVILQCDSQVA-FDGFSLCKEGedehpQCLNSQPHArgssraiFSVGPVSPSRRWWYRCYA 83 
                                       799**9997779*************86.9*******98643333333333335555553444669************ PP
                              Ig_2  65 ....snsegskqsnsvevtv 80 
                                           s +e+s +s+ +e+ v
  gi|126362951|ref|NP_001075106.1|  84 ydsnSPYEWSLPSDLLELLV 103
                                       88554455699999999876 PP
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (106 residues searched)
Target model(s):                       14831  (2610332 nodes)
Passed MSV filter:                       171  (0.0115299); expected 296.6 (0.02)
Passed bias filter:                      140  (0.00943969); expected 296.6 (0.02)
Passed Vit filter:                        11  (0.00074169); expected 14.8 (0.001)
Passed Fwd filter:                         2  (0.000134853); expected 0.1 (1e-05)
Initial search space (Z):              14831  [actual number of targets]
Domain search space  (domZ):               2  [number of targets reported over threshold]
# CPU time: 0.31u 0.24s 00:00:00.55 Elapsed: 00:00:01.22
# Mc/sec: 226.80
//
Query:       gi|22748937|ref|NP_065801.1|  [L=1204]
Description: exportin-5 [Homo sapiens]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    8.5e-34  116.6   7.8    1.2e-33  116.1   4.9    2.8  2  Xpo1      Exportin 1-like protein
     0.0044   16.9   0.0      0.036   13.9   0.0    2.7  2  IBN_N     Importin-beta N-terminal domain
  ------ inclusion threshold ------
      0.095   11.7   0.3        1.3    8.0   0.3    2.3  2  Rac1      Rac1-binding domain
Domain annotation for each model (and alignments):
>> Xpo1  Exportin 1-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  116.1   4.9   2.3e-37   1.2e-33       2     148 .]     110     271 ..     109     271 .. 0.98
   2 ?   -1.8   0.0      0.52   2.6e+03     112     139 ..     499     525 ..     496     529 .. 0.86
  Alignments for each domain:
  == domain 1  score: 116.1 bits;  conditional E-value: 2.3e-37
                                   HHHHHHHHHHHHHHHHHHTTTTSTTHHHHHHHHHCT-HHHHHHHHHHHHHHHHHHCTSXTTCSHHHHHHHHHHHHHHHHHH CS
                          Xpo1   2 kflrnklaealaelflqeypnqWpsffddllsllssspsglelllriLkvlpeEiadfsrskleqerrnelkdllrsqvqk 82 
                                   +++++ l+++++e++++e+p++Wp+++ +l  l++++++++el++ iL++l+e++++f  ++l  +rr++++++l++++++
  gi|22748937|ref|NP_065801.1| 110 NHIKDALSRIVVEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTF--QTLPPQRRRDIQQTLTQNMER 188
                                   89******************************************************99..79******************* PP
                                   HHHHHHHHHHHHHHCC...............HHHHHHHHHHHHHHHTTTS-HHHHHSSC..HHHHHHHHTTSCCCHHHHHH CS
                          Xpo1  83 ilelllqileqsvskk...............sselveatLkclsswvswidiglivnsp..llsllfqlLndpelreaAve 146
                                   i+++ll+ l+++v+k+               ++++  a+L++l+ +++w+++++i +++  ll++l+ lLn++el+  A+e
  gi|22748937|ref|NP_065801.1| 189 IFSFLLNTLQENVNKYqqvktdtsqeskaqaNCRVGVAALNTLAGYIDWVSMSHITAENckLLEILCLLLNEQELQLGAAE 269
                                   **************99*****************************************8889******************** PP
                                   HH CS
                          Xpo1 147 cL 148
                                   cL
  gi|22748937|ref|NP_065801.1| 270 CL 271
                                   *8 PP
  == domain 2  score: -1.8 bits;  conditional E-value: 0.52
                                   HHTTTS-HHHHHSSCHHHHHHHHTTSCC CS
                          Xpo1 112 swvswidiglivnspllsllfqlLndpe 139
                                   s+v+w  ++l+++s +++ +f+ Ln++e
  gi|22748937|ref|NP_065801.1| 499 SFVQWEAMTLFLES-VITQMFRTLNREE 525
                                   899*********98.8888899998776 PP
>> IBN_N  Importin-beta N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   13.9   0.0   7.3e-06     0.036       4      75 ..      36      98 ..      33     100 .. 0.87
   2 ?   -3.5   0.0         2     1e+04      57      74 ..     168     185 ..     165     186 .. 0.84
  Alignments for each domain:
  == domain 1  score: 13.9 bits;  conditional E-value: 7.3e-06
                                  HHHHHHHSTTHHHHHHHHHHHTTTSTHHHHHHHHHHHHHHHHHSCCHHHHHHHHCSSHHHHHHHHHHHHHHH CS
                         IBN_N  4 qLnqlekqkPgflsallqilanksldlevRqlAalyLknlItkhWkseeaqrqqqlpeeekelIrnnllnll 75
                                   ++++++  P ++++ l+++ +k+    vR++++++L++ ++ +W+         ++  ek +++n++ +l+
  gi|22748937|ref|NP_065801.1| 36 FCEEFKEKCPICVPCGLRLA-EKTQVAIVRHFGLQILEHVVKFRWN--------GMSRLEKVYLKNSVMELI 98
                                  56788886699*********.6555899******************........999999****99999887 PP
  == domain 2  score: -3.5 bits;  conditional E-value: 2
                                   HCSSHHHHHHHHHHHHHH CS
                         IBN_N  57 qqlpeeekelIrnnllnl 74 
                                   q+lp++ + +I ++l + 
  gi|22748937|ref|NP_065801.1| 168 QTLPPQRRRDIQQTLTQN 185
                                   6899*******9999876 PP
>> Rac1  Rac1-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.3   0.00026       1.3      94     171 ..      89     169 ..      82     254 .. 0.75
   2 ?    0.8   0.0     0.041     2e+02     150     181 ..     310     341 ..     296     354 .. 0.82
  Alignments for each domain:
  == domain 1  score: 8.0 bits;  conditional E-value: 0.00026
                          Rac1  94 qlrsnimksvvepslkriqkqldqshslvdia..slerar.khletllevlvtlsqqgekvssevydflyrlaevkvslsv 171
                                   +l++ +m  +++ +l+ ++++     +l+ i    ++r   +h   +l  l tls+qge  +  v  +l rlae  v++  
  gi|22748937|ref|NP_065801.1|  89 YLKNSVMELIANGTLNILEEENHIKDALSRIVveMIKREWpQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQT 169
                                   788899999******9998766666666666511555543499*9*****************999999******9888642 PP
  == domain 2  score: 0.8 bits;  conditional E-value: 0.041
                          Rac1 150 kvssevydflyrlaevkvslsvrldtlkqqqe 181
                                    +  + y fl+rl +v  +l+ +l +l + + 
  gi|22748937|ref|NP_065801.1| 310 GLVEKHYVFLKRLCQVLCALGNQLCALLGADS 341
                                   556678******************99977665 PP
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (1204 residues searched)
Target model(s):                       14831  (2610332 nodes)
Passed MSV filter:                       567  (0.0382307); expected 296.6 (0.02)
Passed bias filter:                      414  (0.0279145); expected 296.6 (0.02)
Passed Vit filter:                        32  (0.00215764); expected 14.8 (0.001)
Passed Fwd filter:                         3  (0.000202279); expected 0.1 (1e-05)
Initial search space (Z):              14831  [actual number of targets]
Domain search space  (domZ):               3  [number of targets reported over threshold]
# CPU time: 0.78u 0.28s 00:00:01.06 Elapsed: 00:00:03.60
# Mc/sec: 873.01
//
Query:       gi|125490392|ref|NP_038661.2|  [L=352]
Description: POU domain, class 5, transcription factor 1 isoform 1 [Mus musculus]
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.6e-37  124.8   0.5    1.5e-36  123.9   0.5    1.5  1  Pou          Pou domain - N-terminal to homeobox domain
    1.8e-18   65.8   1.1    3.4e-18   64.9   1.1    1.5  1  Homeobox     Homeobox domain
  ------ inclusion threshold ------
      0.013   15.6   0.0       0.18   12.0   0.0    2.2  2  HTH_31       Helix-turn-helix domain
      0.043   13.5   0.0        0.1   12.2   0.0    1.6  1  Homeobox_KN  Homeobox KN domain
       0.15   10.5   0.1       0.28    9.6   0.1    1.4  1  DUF521       Protein of unknown function (DUF521)
Domain annotation for each model (and alignments):
>> Pou  Pou domain - N-terminal to homeobox domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  123.9   0.5     5e-40   1.5e-36       3      75 .]     133     205 ..     131     205 .. 0.97
  Alignments for each domain:
  == domain 1  score: 123.9 bits;  conditional E-value: 5e-40
                            Pou   3 eldleeleefakefkqrrikLgltqadvgsalgalyGkefsqttIcrFEalqLslknmckLkpllekWLeeae 75 
                                    ++ ++ele+fak +kq+ri+Lg+tqadvg +lg+l+Gk+fsqttIcrFEalqLslknmckL+pllekW+eea+
  gi|125490392|ref|NP_038661.2| 133 KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWVEEAD 205
                                    67899******************************************************************96 PP
>> Homeobox  Homeobox domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   64.9   1.1   1.2e-21   3.4e-18       1      57 []     224     280 ..     224     280 .. 0.98
  Alignments for each domain:
  == domain 1  score: 64.9 bits;  conditional E-value: 1.2e-21
                                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                    +rkRt++++     Le++F k+++ps ++++++A++lgL++++V+vWF+NrR+k k+
  gi|125490392|ref|NP_038661.2| 224 KRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKR 280
                                    79****************************************************997 PP
>> HTH_31  Helix-turn-helix domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.0   0.0   5.9e-05      0.18       1      35 [.     141     181 ..     141     185 .. 0.95
   2 ?    0.9   0.0      0.18   5.3e+02      39      62 ..     245     268 ..     243     270 .. 0.85
  Alignments for each domain:
  == domain 1  score: 12.0 bits;  conditional E-value: 5.9e-05
                         HTH_31   1 aLGarLralReraGLsqeevAerag......vSastlsriE 35 
                                    +++ +L++ R + G +q++v+  +g      +S++t++r E
  gi|125490392|ref|NP_038661.2| 141 QFAKLLKQKRITLGYTQADVGLTLGvlfgkvFSQTTICRFE 181
                                    7999**************************99*******99 PP
  == domain 2  score: 0.9 bits;  conditional E-value: 0.18
                         HTH_31  39 rgrpslavlaalaralgldeaera 62 
                                    ++ psl++++ +a+ lgl+ + ++
  gi|125490392|ref|NP_038661.2| 245 CPKPSLQQITHIANQLGLEKDVVR 268
                                    678**************9988765 PP
>> Homeobox_KN  Homeobox KN domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.2   0.0   3.5e-05       0.1       7      39 ..     244     276 ..     241     277 .. 0.91
  Alignments for each domain:
  == domain 1  score: 12.2 bits;  conditional E-value: 3.5e-05
                    Homeobox_KN   7 hnPYPskevkeelakqTglsrkqidnWFiNaRr 39 
                                    + P Ps +++  +a+q gl  + +  WF N R 
  gi|125490392|ref|NP_038661.2| 244 KCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQ 276
                                    56779*************************996 PP
>> DUF521  Protein of unknown function (DUF521)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.6   0.1   9.4e-05      0.28     273     334 ..     221     280 ..     197     294 .. 0.77
  Alignments for each domain:
  == domain 1  score: 9.6 bits;  conditional E-value: 9.4e-05
                         DUF521 273 adlaavleelnkakkeevdlvvlGcPhlsleeleelaellkgrkkkvsvelvvttsravlsk 334
                                    + +++ + +++++   +++ ++l cP  sl++++++a++l  +k    v+++ +  r+  ++
  gi|125490392|ref|NP_038661.2| 221 QARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEK--DVVRVWFCNRRQKGKR 280
                                    345666667778888899************************99..9999999988876554 PP
Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (352 residues searched)
Target model(s):                       14831  (2610332 nodes)
Passed MSV filter:                       663  (0.0447037); expected 296.6 (0.02)
Passed bias filter:                      493  (0.0332412); expected 296.6 (0.02)
Passed Vit filter:                        45  (0.00303419); expected 14.8 (0.001)
Passed Fwd filter:                         5  (0.000337132); expected 0.1 (1e-05)
Initial search space (Z):              14831  [actual number of targets]
Domain search space  (domZ):               5  [number of targets reported over threshold]
# CPU time: 0.43u 0.33s 00:00:00.76 Elapsed: 00:00:04.08
# Mc/sec: 225.21
//
[ok]
 
     |