1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107
|
<?xml version='1.0' encoding='UTF-8'?>
<uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry dataset="TrEMBL" created="2012-03-21" modified="2014-10-29" version="13">
<accession>H2CNN8</accession>
<name>H2CNN8_9ARCH</name>
<protein>
<submittedName>
<fullName evidence="2">Ammonia monooxygenase subunit A</fullName>
</submittedName>
</protein>
<gene>
<name type="primary" evidence="2">amoA</name>
</gene>
<organism evidence="2">
<name type="scientific">uncultured ammonia-oxidizing archaeon</name>
<dbReference type="NCBI Taxonomy" id="418404"/>
<lineage>
<taxon>Archaea</taxon>
<taxon>environmental samples</taxon>
</lineage>
</organism>
<reference key="1" evidence="2">
<citation type="journal article" date="2012" name="Biol. Fertil. Soils" volume="48" first="827" last="837">
<title>Responses of bacterial and archaeal ammonia oxidisers of an acidic luvisols soil to different nitrogen fertilization rates after 9 years.</title>
<authorList>
<person name="Xu Y.G."/>
<person name="Yu W.T."/>
<person name="Ma Q."/>
<person name="Zhou H."/>
</authorList>
</citation>
<scope>NUCLEOTIDE SEQUENCE</scope>
<source>
<strain evidence="2">DGGE gel band AOASY-10</strain>
<strain evidence="3">DGGE gel band AOASY-11</strain>
<strain evidence="1">DGGE gel band AOASY-9</strain>
</source>
</reference>
<dbReference type="EMBL" id="JN040443">
<property type="protein sequence ID" value="AEX14552.1"/>
<property type="molecule type" value="Genomic_DNA"/>
</dbReference>
<dbReference type="EMBL" id="JN040444">
<property type="protein sequence ID" value="AEX14553.1"/>
<property type="molecule type" value="Genomic_DNA"/>
</dbReference>
<dbReference type="EMBL" id="JN040445">
<property type="protein sequence ID" value="AEX14554.1"/>
<property type="molecule type" value="Genomic_DNA"/>
</dbReference>
<dbReference type="GO" id="GO:0004497">
<property type="term" value="F:monooxygenase activity"/>
<property type="evidence" value="IEA:UniProtKB-KW"/>
</dbReference>
<dbReference type="Gene3D" id="1.20.1450.10">
<property type="match status" value="1"/>
</dbReference>
<dbReference type="InterPro" id="IPR024656">
<property type="entry name" value="AmoA_arc"/>
</dbReference>
<dbReference type="InterPro" id="IPR003393">
<property type="entry name" value="NH3_CH4_mOase_A"/>
</dbReference>
<dbReference type="Pfam" id="PF12942">
<property type="entry name" value="Archaeal_AmoA"/>
<property type="match status" value="1"/>
</dbReference>
<proteinExistence type="predicted"/>
<keyword id="KW-0503" evidence="2">Monooxygenase</keyword>
<keyword id="KW-0560" evidence="2">Oxidoreductase</keyword>
<feature type="non-terminal residue" evidence="2">
<location>
<position position="1"/>
</location>
</feature>
<feature type="non-terminal residue" evidence="2">
<location>
<position position="196"/>
</location>
</feature>
<evidence key="1" type="ECO:0000313">
<source>
<dbReference type="EMBL" id="AEX14552.1"/>
</source>
</evidence>
<evidence key="2" type="ECO:0000313">
<source>
<dbReference type="EMBL" id="AEX14553.1"/>
</source>
</evidence>
<evidence key="3" type="ECO:0000313">
<source>
<dbReference type="EMBL" id="AEX14554.1"/>
</source>
</evidence>
<sequence length="196" mass="21641" checksum="1E4E6A76ECF7AAA4" modified="2012-03-21" version="1" fragment="single">
FIVVVAVNSTLLTINAGDYIFYTDWAWTSFVVFSISQSTMLVVGAIYYMLFTGVPGTATY
YATIMTIYTWVAKGAWFALGYPYDFIVTPVWIPSAMLLDLTYWATRRNKHAAIIIGGTLV
GLSLPIFNMINLLLVRDPLEVAFKYPRPTLPPYMTPIEPQVGKFYNSPVALGSGAGAVLS
VPIAALGAKLNTWTYR
</sequence>
</entry>
<copyright>
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
</copyright>
</uniprot>
|