1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623
|
<?xml version='1.0' encoding='UTF-8'?>
<uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry dataset="Swiss-Prot" created="1997-11-01" modified="2010-01-19" version="95">
<accession>Q13639</accession>
<accession>Q96KH9</accession>
<accession>Q96KI0</accession>
<accession>Q9H199</accession>
<accession>Q9NY73</accession>
<accession>Q9UBM6</accession>
<accession>Q9UBT4</accession>
<accession>Q9UE22</accession>
<accession>Q9UE23</accession>
<accession>Q9UQR6</accession>
<name>5HT4R_HUMAN</name>
<protein>
<recommendedName>
<fullName>5-hydroxytryptamine receptor 4</fullName>
<shortName>5-HT-4</shortName>
<shortName>5-HT4</shortName>
</recommendedName>
<alternativeName>
<fullName>Serotonin receptor 4</fullName>
</alternativeName>
</protein>
<gene>
<name type="primary">HTR4</name>
</gene>
<organism key="1">
<name type="scientific">Homo sapiens</name>
<name type="common">Human</name>
<dbReference type="NCBI Taxonomy" id="9606" key="2" />
<lineage>
<taxon>Eukaryota</taxon>
<taxon>Metazoa</taxon>
<taxon>Chordata</taxon>
<taxon>Craniata</taxon>
<taxon>Vertebrata</taxon>
<taxon>Euteleostomi</taxon>
<taxon>Mammalia</taxon>
<taxon>Eutheria</taxon>
<taxon>Euarchontoglires</taxon>
<taxon>Primates</taxon>
<taxon>Haplorrhini</taxon>
<taxon>Catarrhini</taxon>
<taxon>Hominidae</taxon>
<taxon>Homo</taxon>
</lineage>
</organism>
<reference key="3">
<citation type="journal article" date="1998" name="J. Neurochem." volume="70" first="2252" last="2261">
<title>Cloning, expression, and pharmacology of four human 5-hydroxytryptamine 4 receptor isoforms produced by alternative splicing in the carboxyl terminus.</title>
<authorList>
<person name="Blondel O." />
<person name="Gastineau M." />
<person name="Dahmoune Y." />
<person name="Langlois M." />
<person name="Fischmeister R." />
</authorList>
<dbReference type="MEDLINE" id="98264328" key="4" />
<dbReference type="PubMed" id="9603189" key="5" />
</citation>
<scope>NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(B); 5-HT4(C) AND 5-HT4(D))</scope>
<source>
<tissue>Gut</tissue>
</source>
</reference>
<reference key="6">
<citation type="submission" date="1997-06" db="EMBL/GenBank/DDBJ databases">
<title>Cloning and expression of 5-HT4 receptor species and splice variants.</title>
<authorList>
<person name="Van den Wyngaert I." />
<person name="Gommeren W." />
<person name="Jurzak M." />
<person name="Verhasselt P." />
<person name="Gordon R." />
<person name="Leysen J." />
<person name="Luyten W." />
<person name="Bender E." />
</authorList>
</citation>
<scope>NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A) AND 5-HT4(B))</scope>
<source>
<tissue>Brain</tissue>
</source>
</reference>
<reference key="7">
<citation type="journal article" date="1997" name="NeuroReport" volume="8" first="3189" last="3195">
<title>Cloning and expression of human 5-HT4S receptors. Effect of receptor density on their coupling to adenylyl cyclase.</title>
<authorList>
<person name="Claeysen S." />
<person name="Faye P." />
<person name="Sebben M." />
<person name="Lemaire S." />
<person name="Bockaert J." />
<person name="Dumuis A." />
</authorList>
<dbReference type="MEDLINE" id="98012006" key="8" />
<dbReference type="PubMed" id="9351641" key="9" />
</citation>
<scope>NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(A))</scope>
<source>
<tissue>Heart</tissue>
</source>
</reference>
<reference key="10">
<citation type="journal article" date="1999" name="Mol. Pharmacol." volume="55" first="910" last="920">
<title>Novel brain-specific 5-HT4 receptor splice variants show marked constitutive activity: role of the C-terminal intracellular domain.</title>
<authorList>
<person name="Claeysen S." />
<person name="Sebben M." />
<person name="Becamel C." />
<person name="Bockaert J." />
<person name="Dumuis A." />
</authorList>
<dbReference type="MEDLINE" id="99238795" key="11" />
<dbReference type="PubMed" id="10220570" key="12" />
</citation>
<scope>NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(E))</scope>
<source>
<tissue>Brain</tissue>
</source>
</reference>
<reference key="13">
<citation type="submission" date="2000-09" db="EMBL/GenBank/DDBJ databases">
<title>Cloning and characterization of multiple human 5-HT4 receptor variants including a novel variant that lacks the alternatively spliced C-terminal exon.</title>
<authorList>
<person name="Vilaro M.T." />
<person name="Domenech T." />
<person name="Palacios J.M." />
<person name="Mengod G." />
</authorList>
</citation>
<scope>NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5-HT4(A); 5-HT4(E) AND 5-HT4(G))</scope>
<source>
<tissue>Hippocampus</tissue>
</source>
</reference>
<reference key="14">
<citation type="journal article" date="2004" name="Genome Res." volume="14" first="2121" last="2127">
<title>The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).</title>
<authorList>
<consortium name="The MGC Project Team" />
</authorList>
<dbReference type="PubMed" id="15489334" key="15" />
<dbReference type="DOI" id="10.1101/gr.2596504" key="16" />
</citation>
<scope>NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5-HT4(B))</scope>
</reference>
<reference key="17">
<citation type="journal article" date="2000" name="J. Neurochem." volume="74" first="478" last="489">
<title>Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant.</title>
<authorList>
<person name="Bender E." />
<person name="Pindon A." />
<person name="van Oers I." />
<person name="Zhang Y.B." />
<person name="Gommeren W." />
<person name="Verhasselt P." />
<person name="Jurzak M." />
<person name="Leysen J." />
<person name="Luyten W." />
</authorList>
<dbReference type="MEDLINE" id="20110418" key="18" />
<dbReference type="PubMed" id="10646498" key="19" />
<dbReference type="DOI" id="10.1046/j.1471-4159.2000.740478.x" key="20" />
</citation>
<scope>NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 10-388 (ISOFORM 5-HT4(F))</scope>
</reference>
<reference key="21">
<citation type="journal article" date="1995" name="FEBS Lett." volume="370" first="215" last="221">
<title>Expression of serotonin receptor mRNAs in blood vessels.</title>
<authorList>
<person name="Ullmer C." />
<person name="Schmuck K." />
<person name="Kalkman H.O." />
<person name="Luebbert H." />
</authorList>
<dbReference type="MEDLINE" id="95385798" key="22" />
<dbReference type="PubMed" id="7656980" key="23" />
<dbReference type="DOI" id="10.1016/0014-5793(95)00828-W" key="24" />
</citation>
<scope>NUCLEOTIDE SEQUENCE [MRNA] OF 112-255</scope>
<source>
<tissue>Brain</tissue>
</source>
</reference>
<comment type="function">
<text>This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.</text>
</comment>
<comment type="subunit">
<text>Isoform 5-HT4(A) interacts with MAGI2, MPP3, SLC9A3R1 and SNX27 isoforms 1 and 2. Isoform 5-HT4(E) interacts with INADL, NOS1 and SEC23A. Isoform 5-HT4(A) forms a complex including SLC9A3R1 and EZR (By similarity).</text>
</comment>
<comment type="subcellular location">
<subcellularLocation>
<location>Cell membrane</location>
<topology>Multi-pass membrane protein</topology>
</subcellularLocation>
<subcellularLocation>
<location>Endosome</location>
</subcellularLocation>
<text>Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli (By similarity).</text>
</comment>
<comment type="alternative products">
<event type="alternative splicing" />
<isoform>
<id>Q13639-1</id>
<name>5-HT4(B)</name>
<sequence type="displayed" />
</isoform>
<isoform>
<id>Q13639-2</id>
<name>5-HT4(A)</name>
<name>5-HT4S</name>
<sequence type="described" ref="VSP_001849" />
</isoform>
<isoform>
<id>Q13639-3</id>
<name>5-HT4(C)</name>
<sequence type="described" ref="VSP_001848" />
</isoform>
<isoform>
<id>Q13639-4</id>
<name>5-HT4(D)</name>
<sequence type="described" ref="VSP_001847" />
</isoform>
<isoform>
<id>Q13639-5</id>
<name>5-HT4(E)</name>
<name>H5-HT4(g)</name>
<sequence type="described" ref="VSP_001846" />
</isoform>
<isoform>
<id>Q13639-6</id>
<name>5-HT4(F)</name>
<sequence type="described" ref="VSP_001845" />
</isoform>
<isoform>
<id>Q13639-7</id>
<name>5-HT4(G)</name>
<sequence type="described" ref="VSP_001850" />
</isoform>
<text>Additional isoforms seem to exist.</text>
</comment>
<comment type="tissue specificity">
<text>Isoform 5-HT4(A) is expressed in ileum, brain, and atrium, but not in the ventricle.</text>
</comment>
<comment type="similarity">
<text>Belongs to the G-protein coupled receptor 1 family.</text>
</comment>
<dbReference type="EMBL" id="Y08756" key="25">
<property type="protein sequence ID" value="CAA70002.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="Y12505" key="26">
<property type="protein sequence ID" value="CAA73107.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="Y12506" key="27">
<property type="protein sequence ID" value="CAA73108.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="Y12507" key="28">
<property type="protein sequence ID" value="CAA73109.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="Y10437" key="29">
<property type="protein sequence ID" value="CAA71462.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="Y13584" key="30">
<property type="protein sequence ID" value="CAA73911.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="Y09586" key="31">
<property type="protein sequence ID" value="CAA70774.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="AJ011371" key="32">
<property type="protein sequence ID" value="CAA09600.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="AJ278979" key="33">
<property type="protein sequence ID" value="CAC22248.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="AJ278981" key="34">
<property type="protein sequence ID" value="CAC22250.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="AJ278982" key="35">
<property type="protein sequence ID" value="CAC22251.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="BC074755" key="36">
<property type="protein sequence ID" value="AAH74755.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="EMBL" id="AJ243213" key="37">
<property type="protein sequence ID" value="CAB71316.1" />
<property type="molecule type" value="Genomic_DNA" />
</dbReference>
<dbReference type="EMBL" id="Z48150" key="38">
<property type="protein sequence ID" value="CAA88167.1" />
<property type="molecule type" value="mRNA" />
</dbReference>
<dbReference type="IPI" id="IPI00014378" key="39" />
<dbReference type="IPI" id="IPI00064638" key="40" />
<dbReference type="IPI" id="IPI00186777" key="41" />
<dbReference type="IPI" id="IPI00216427" key="42" />
<dbReference type="IPI" id="IPI00216428" key="43" />
<dbReference type="IPI" id="IPI00216429" key="44" />
<dbReference type="IPI" id="IPI00291659" key="45" />
<dbReference type="PIR" id="S66493" key="46">
<property type="entry name" value="S66493" />
</dbReference>
<dbReference type="RefSeq" id="NP_000861.1" key="47" />
<dbReference type="RefSeq" id="NP_001035259.1" key="48" />
<dbReference type="RefSeq" id="NP_001035261.1" key="49" />
<dbReference type="RefSeq" id="NP_001035264.1" key="50" />
<dbReference type="RefSeq" id="NP_955525.1" key="51" />
<dbReference type="UniGene" id="Hs.483773" key="52" />
<dbReference type="SMR" id="Q13639" key="53">
<property type="residue range" value="18-329" />
</dbReference>
<dbReference type="STRING" id="Q13639" key="54" />
<dbReference type="Ensembl" id="ENST00000377888" key="55">
<property type="protein sequence ID" value="ENSP00000367120" />
<property type="gene designation" value="ENSG00000164270" />
<property type="organism name" value="Homo sapiens" />
</dbReference>
<dbReference type="GeneID" id="3360" key="56" />
<dbReference type="KEGG" id="hsa:3360" key="57" />
<dbReference type="UCSC" id="uc003lpj.1" key="58">
<property type="organism name" value="human" />
</dbReference>
<dbReference type="UCSC" id="uc003lpk.1" key="59">
<property type="organism name" value="human" />
</dbReference>
<dbReference type="UCSC" id="uc003lpl.1" key="60">
<property type="organism name" value="human" />
</dbReference>
<dbReference type="UCSC" id="uc003lpn.1" key="61">
<property type="organism name" value="human" />
</dbReference>
<dbReference type="UCSC" id="uc003lpo.1" key="62">
<property type="organism name" value="human" />
</dbReference>
<dbReference type="CTD" id="3360" key="63" />
<dbReference type="GeneCards" id="GC05M147810" key="64" />
<dbReference type="H-InvDB" id="HIX0005295" key="65" />
<dbReference type="H-InvDB" id="HIX0078165" key="66" />
<dbReference type="HGNC" id="HGNC:5299" key="67">
<property type="gene designation" value="HTR4" />
</dbReference>
<dbReference type="MIM" id="602164" key="68">
<property type="type" value="gene" />
</dbReference>
<dbReference type="PharmGKB" id="PA29557" key="69" />
<dbReference type="eggNOG" id="prNOG13487" key="70" />
<dbReference type="HOVERGEN" id="Q13639" key="71" />
<dbReference type="Reactome" id="REACT_14797" key="72">
<property type="pathway name" value="Signaling by GPCR" />
</dbReference>
<dbReference type="DrugBank" id="DB00604" key="73">
<property type="generic name" value="Cisapride" />
</dbReference>
<dbReference type="DrugBank" id="DB00953" key="74">
<property type="generic name" value="Rizatriptan" />
</dbReference>
<dbReference type="DrugBank" id="DB01079" key="75">
<property type="generic name" value="Tegaserod" />
</dbReference>
<dbReference type="DrugBank" id="DB00315" key="76">
<property type="generic name" value="Zolmitriptan" />
</dbReference>
<dbReference type="NextBio" id="13288" key="77" />
<dbReference type="ArrayExpress" id="Q13639" key="78" />
<dbReference type="Bgee" id="Q13639" key="79" />
<dbReference type="Genevestigator" id="Q13639" key="80" />
<dbReference type="GermOnline" id="ENSG00000164270" key="81">
<property type="organism name" value="Homo sapiens" />
</dbReference>
<dbReference type="GO" id="GO:0005768" key="82">
<property type="term" value="C:endosome" />
<property type="evidence" value="IEA:UniProtKB-SubCell" />
</dbReference>
<dbReference type="GO" id="GO:0005887" key="83">
<property type="term" value="C:integral to plasma membrane" />
<property type="evidence" value="TAS:ProtInc" />
</dbReference>
<dbReference type="GO" id="GO:0005624" key="84">
<property type="term" value="C:membrane fraction" />
<property type="evidence" value="IDA:MGI" />
</dbReference>
<dbReference type="GO" id="GO:0004993" key="85">
<property type="term" value="F:serotonin receptor activity" />
<property type="evidence" value="IDA:MGI" />
</dbReference>
<dbReference type="GO" id="GO:0007187" key="86">
<property type="term" value="P:G-protein signaling, coupled to cyclic nucl..." />
<property type="evidence" value="TAS:ProtInc" />
</dbReference>
<dbReference type="InterPro" id="IPR001520" key="87">
<property type="entry name" value="5HT4_rcpt" />
</dbReference>
<dbReference type="InterPro" id="IPR000276" key="88">
<property type="entry name" value="7TM_GPCR_Rhodpsn" />
</dbReference>
<dbReference type="InterPro" id="IPR017452" key="89">
<property type="entry name" value="GPCR_Rhodpsn_supfam" />
</dbReference>
<dbReference type="Pfam" id="PF00001" key="90">
<property type="entry name" value="7tm_1" />
<property type="match status" value="1" />
</dbReference>
<dbReference type="PRINTS" id="PR01059" key="91">
<property type="entry name" value="5HT4RECEPTR" />
</dbReference>
<dbReference type="PRINTS" id="PR00237" key="92">
<property type="entry name" value="GPCRRHODOPSN" />
</dbReference>
<dbReference type="PROSITE" id="PS00237" key="93">
<property type="entry name" value="G_PROTEIN_RECEP_F1_1" />
<property type="match status" value="1" />
</dbReference>
<dbReference type="PROSITE" id="PS50262" key="94">
<property type="entry name" value="G_PROTEIN_RECEP_F1_2" />
<property type="match status" value="1" />
</dbReference>
<proteinExistence type="Evidence at transcript level" />
<keyword id="KW-0025">Alternative splicing</keyword>
<keyword id="KW-1003">Cell membrane</keyword>
<keyword id="KW-0181">Complete proteome</keyword>
<keyword id="KW-1015">Disulfide bond</keyword>
<keyword id="KW-0967">Endosome</keyword>
<keyword id="KW-0297">G-protein coupled receptor</keyword>
<keyword id="KW-0325">Glycoprotein</keyword>
<keyword id="KW-0449">Lipoprotein</keyword>
<keyword id="KW-0472">Membrane</keyword>
<keyword id="KW-0564">Palmitate</keyword>
<keyword id="KW-0621">Polymorphism</keyword>
<keyword id="KW-0675">Receptor</keyword>
<keyword id="KW-0807">Transducer</keyword>
<keyword id="KW-0812">Transmembrane</keyword>
<feature type="chain" description="5-hydroxytryptamine receptor 4" id="PRO_0000068965">
<location>
<begin position="1" />
<end position="388" />
</location>
</feature>
<feature type="topological domain" description="Extracellular" status="by similarity">
<location>
<begin position="1" />
<end position="19" />
</location>
</feature>
<feature type="transmembrane region" description="1" status="by similarity">
<location>
<begin position="20" />
<end position="40" />
</location>
</feature>
<feature type="topological domain" description="Cytoplasmic" status="by similarity">
<location>
<begin position="41" />
<end position="58" />
</location>
</feature>
<feature type="transmembrane region" description="2" status="by similarity">
<location>
<begin position="59" />
<end position="79" />
</location>
</feature>
<feature type="topological domain" description="Extracellular" status="by similarity">
<location>
<begin position="80" />
<end position="93" />
</location>
</feature>
<feature type="transmembrane region" description="3" status="by similarity">
<location>
<begin position="94" />
<end position="116" />
</location>
</feature>
<feature type="topological domain" description="Cytoplasmic" status="by similarity">
<location>
<begin position="117" />
<end position="137" />
</location>
</feature>
<feature type="transmembrane region" description="4" status="by similarity">
<location>
<begin position="138" />
<end position="158" />
</location>
</feature>
<feature type="topological domain" description="Extracellular" status="by similarity">
<location>
<begin position="159" />
<end position="192" />
</location>
</feature>
<feature type="transmembrane region" description="5" status="by similarity">
<location>
<begin position="193" />
<end position="213" />
</location>
</feature>
<feature type="topological domain" description="Cytoplasmic" status="by similarity">
<location>
<begin position="214" />
<end position="260" />
</location>
</feature>
<feature type="transmembrane region" description="6" status="by similarity">
<location>
<begin position="261" />
<end position="281" />
</location>
</feature>
<feature type="topological domain" description="Extracellular" status="by similarity">
<location>
<begin position="282" />
<end position="294" />
</location>
</feature>
<feature type="transmembrane region" description="7" status="by similarity">
<location>
<begin position="295" />
<end position="315" />
</location>
</feature>
<feature type="topological domain" description="Cytoplasmic" status="by similarity">
<location>
<begin position="316" />
<end position="388" />
</location>
</feature>
<feature type="lipid moiety-binding region" description="S-palmitoyl cysteine" status="by similarity">
<location>
<position position="329" />
</location>
</feature>
<feature type="glycosylation site" description="N-linked (GlcNAc...)" status="potential">
<location>
<position position="7" />
</location>
</feature>
<feature type="disulfide bond" status="by similarity">
<location>
<begin position="93" />
<end position="184" />
</location>
</feature>
<feature type="splice variant" description="In isoform 5-HT4(F)." id="VSP_001845">
<original>L</original>
<variation>LERSLNQGLGQDFHA</variation>
<location>
<position position="169" />
</location>
</feature>
<feature type="splice variant" description="In isoform 5-HT4(D)." id="VSP_001847">
<original>RDAVECGGQWESQCHPPATSPLVAAQPSDT</original>
<variation>SSGTETDRRNFGIRKRRLTKPS</variation>
<location>
<begin position="359" />
<end position="388" />
</location>
</feature>
<feature type="splice variant" description="In isoform 5-HT4(E)." id="VSP_001846">
<original>RDAVECGGQWESQCHPPATSPLVAAQPSDT</original>
<variation>SGCSPVSSFLLLFCNRPVPV</variation>
<location>
<begin position="359" />
<end position="388" />
</location>
</feature>
<feature type="splice variant" description="In isoform 5-HT4(A)." id="VSP_001849">
<original>DAVECGGQWESQCHPPATSPLVAAQPSDT</original>
<variation>YTVLHRGHHQELEKLPIHNDPESLESCF</variation>
<location>
<begin position="360" />
<end position="388" />
</location>
</feature>
<feature type="splice variant" description="In isoform 5-HT4(C)." id="VSP_001848">
<original>DAVECGGQWESQCHPPATSPLVAAQPSDT</original>
<variation>F</variation>
<location>
<begin position="360" />
<end position="388" />
</location>
</feature>
<feature type="splice variant" description="In isoform 5-HT4(G)." id="VSP_001850">
<location>
<begin position="360" />
<end position="388" />
</location>
</feature>
<feature type="sequence variant" description="In dbSNP:rs34826744." id="VAR_049364">
<original>C</original>
<variation>Y</variation>
<location>
<position position="372" />
</location>
</feature>
<sequence length="388" mass="43761" checksum="7FCFEC60E7BDF560" modified="2001-01-11" version="2">
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
</sequence>
</entry>
<copyright>
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
</copyright>
</uniprot>
|