1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322
  
     | 
    
      <?xml version="1.0" encoding="UTF-8"?>
<uniprot xmlns="http://uniprot.org/uniprot"
 xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
 xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry version="21" modified="2009-07-07" dataset="Swiss-Prot" created="2009-06-16">
  <accession>Q91G55</accession>
  <name>043L_IIV6</name>
  <protein>
    <recommendedName>
      <fullName>Uncharacterized protein 043L</fullName>
    </recommendedName>
  </protein>
  <gene>
    <name type="ORF">IIV6-043L</name>
  </gene>
  <organism key="1">
    <name type="scientific">Invertebrate iridescent virus 6</name>
    <name type="common">IIV-6</name>
    <name type="synonym">Chilo iridescent virus</name>
    <dbReference type="NCBI Taxonomy" key="2" id="176652"/>
    <lineage>
      <taxon>Viruses</taxon>
      <taxon>dsDNA viruses, no RNA stage</taxon>
      <taxon>Iridoviridae</taxon>
      <taxon>Iridovirus</taxon>
    </lineage>
  </organism>
  <organismHost key="3">
    <name type="scientific">Acheta domesticus</name>
    <name type="common">House cricket</name>
    <dbReference type="NCBI Taxonomy" key="4" id="6997"/>
  </organismHost>
  <organismHost key="5">
    <name type="scientific">Chilo suppressalis</name>
    <name type="common">striped riceborer</name>
    <dbReference type="NCBI Taxonomy" key="6" id="168631"/>
  </organismHost>
  <organismHost key="7">
    <name type="scientific">Gryllus bimaculatus</name>
    <name type="common">Two-spotted cricket</name>
    <dbReference type="NCBI Taxonomy" key="8" id="6999"/>
  </organismHost>
  <organismHost key="9">
    <name type="scientific">Gryllus campestris</name>
    <dbReference type="NCBI Taxonomy" key="10" id="58607"/>
  </organismHost>
  <organismHost key="11">
    <name type="scientific">Spodoptera frugiperda</name>
    <name type="common">Fall armyworm</name>
    <dbReference type="NCBI Taxonomy" key="12" id="7108"/>
  </organismHost>
  <reference key="13">
    <citation volume="286" type="journal article" name="Virology" last="196" first="182" date="2001">
      <title>Analysis of the first complete DNA sequence of an invertebrate iridovirus: coding strategy of the genome of Chilo iridescent virus.</title>
      <authorList>
        <person name="Jakob N.J."/>
        <person name="Mueller K."/>
        <person name="Bahr U."/>
        <person name="Darai G."/>
      </authorList>
      <dbReference type="DOI" key="14" id="10.1006/viro.2001.0963"/>
      <dbReference type="MEDLINE" key="15" id="21342589"/>
      <dbReference type="PubMed" key="16" id="11448171"/>
    </citation>
    <scope>NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]</scope>
  </reference>
  <reference key="17">
    <citation volume="4" type="journal article" name="Virol. J." last="11" first="11" date="2007">
      <title>Comparative genomic analysis of the family Iridoviridae: re-annotating and defining the core set of iridovirus genes.</title>
      <authorList>
        <person name="Eaton H.E."/>
        <person name="Metcalf J."/>
        <person name="Penny E."/>
        <person name="Tcherepanov V."/>
        <person name="Upton C."/>
        <person name="Brunetti C.R."/>
      </authorList>
      <dbReference type="DOI" key="18" id="10.1186/1743-422X-4-11"/>
      <dbReference type="PubMed" key="19" id="17239238"/>
    </citation>
    <scope>GENOME REANNOTATION</scope>
  </reference>
  <dbReference type="EMBL" key="20" id="AF303741">
    <property value="AAK81977.1" type="protein sequence ID"/>
    <property value="Genomic_DNA" type="molecule type"/>
  </dbReference>
  <dbReference type="RefSeq" key="21" id="NP_149506.1"/>
  <dbReference type="GeneId" key="22" id="1733003"/>
  <proteinExistence type="Predicted"/>
  <keyword id="KW-0181">Complete proteome</keyword>
  <keyword id="KW-1019">Virus reference strain</keyword>
  <feature type="chain" id="PRO_0000377969" description="Uncharacterized protein 043L">
    <location>
      <begin position="1"/>
      <end position="116"/>
    </location>
  </feature>
  <sequence version="1" modified="2001-12-01" mass="13673" length="116" checksum="4A29B35FB716523C">MDLINNKLNIEIQKFCLDLEKKYNINYNNLIDLWFNKESTERLIKCEVNLENKIKFNQKYNSDTIKIMNILFLICSDGVFGKIENNDVKPLTDEDEKICVKFGYKIMIGCLNDIPI</sequence>
</entry>
<entry version="30" modified="2009-07-07" dataset="Swiss-Prot" created="2009-06-16">
  <accession>O55717</accession>
  <name>094L_IIV6</name>
  <protein>
    <recommendedName>
      <fullName>Uncharacterized protein 094L</fullName>
    </recommendedName>
  </protein>
  <gene>
    <name type="ORF">IIV6-094L</name>
  </gene>
  <organism key="1">
    <name type="scientific">Invertebrate iridescent virus 6</name>
    <name type="common">IIV-6</name>
    <name type="synonym">Chilo iridescent virus</name>
    <dbReference type="NCBI Taxonomy" key="2" id="176652"/>
    <lineage>
      <taxon>Viruses</taxon>
      <taxon>dsDNA viruses, no RNA stage</taxon>
      <taxon>Iridoviridae</taxon>
      <taxon>Iridovirus</taxon>
    </lineage>
  </organism>
  <organismHost key="3">
    <name type="scientific">Acheta domesticus</name>
    <name type="common">House cricket</name>
    <dbReference type="NCBI Taxonomy" key="4" id="6997"/>
  </organismHost>
  <organismHost key="5">
    <name type="scientific">Chilo suppressalis</name>
    <name type="common">striped riceborer</name>
    <dbReference type="NCBI Taxonomy" key="6" id="168631"/>
  </organismHost>
  <organismHost key="7">
    <name type="scientific">Gryllus bimaculatus</name>
    <name type="common">Two-spotted cricket</name>
    <dbReference type="NCBI Taxonomy" key="8" id="6999"/>
  </organismHost>
  <organismHost key="9">
    <name type="scientific">Gryllus campestris</name>
    <dbReference type="NCBI Taxonomy" key="10" id="58607"/>
  </organismHost>
  <organismHost key="11">
    <name type="scientific">Spodoptera frugiperda</name>
    <name type="common">Fall armyworm</name>
    <dbReference type="NCBI Taxonomy" key="12" id="7108"/>
  </organismHost>
  <reference key="13">
    <citation volume="286" type="journal article" name="Virology" last="196" first="182" date="2001">
      <title>Analysis of the first complete DNA sequence of an invertebrate iridovirus: coding strategy of the genome of Chilo iridescent virus.</title>
      <authorList>
        <person name="Jakob N.J."/>
        <person name="Mueller K."/>
        <person name="Bahr U."/>
        <person name="Darai G."/>
      </authorList>
      <dbReference type="DOI" key="14" id="10.1006/viro.2001.0963"/>
      <dbReference type="MEDLINE" key="15" id="21342589"/>
      <dbReference type="PubMed" key="16" id="11448171"/>
    </citation>
    <scope>NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]</scope>
  </reference>
  <reference key="17">
    <citation volume="4" type="journal article" name="Virol. J." last="11" first="11" date="2007">
      <title>Comparative genomic analysis of the family Iridoviridae: re-annotating and defining the core set of iridovirus genes.</title>
      <authorList>
        <person name="Eaton H.E."/>
        <person name="Metcalf J."/>
        <person name="Penny E."/>
        <person name="Tcherepanov V."/>
        <person name="Upton C."/>
        <person name="Brunetti C.R."/>
      </authorList>
      <dbReference type="DOI" key="18" id="10.1186/1743-422X-4-11"/>
      <dbReference type="PubMed" key="19" id="17239238"/>
    </citation>
    <scope>GENOME REANNOTATION</scope>
  </reference>
  <dbReference type="EMBL" key="20" id="AF303741">
    <property value="AAB94428.1" type="protein sequence ID"/>
    <property value="Genomic_DNA" type="molecule type"/>
  </dbReference>
  <dbReference type="PIR" key="21" id="T03054">
    <property value="T03054" type="entry name"/>
  </dbReference>
  <dbReference type="RefSeq" key="22" id="NP_149557.1"/>
  <dbReference type="GeneId" key="23" id="1733205"/>
  <proteinExistence type="Predicted"/>
  <keyword id="KW-0181">Complete proteome</keyword>
  <keyword id="KW-1019">Virus reference strain</keyword>
  <feature type="chain" id="PRO_0000377984" description="Uncharacterized protein 094L">
    <location>
      <begin position="1"/>
      <end position="118"/>
    </location>
  </feature>
  <sequence version="1" modified="1998-06-01" mass="13689" length="118" checksum="426CF04C1B8387E7">MSGGSLINSIAINTRIKKIKKSLLQNYTKEKTDMIKILYLLSTPKIVIKNNGCFEKHYTICNFISKNQQNLNENNLNFHLNGYDKYEYLSNNDKNACTCINMDFIVERLMISSEHMTV</sequence>
</entry>
<entry version="5" modified="2009-11-03" dataset="Swiss-Prot" created="2009-05-05">
  <accession>P0C9J6</accession>
  <name>11011_ASFP4</name>
  <protein>
    <recommendedName>
      <fullName>Protein MGF 360-1L</fullName>
    </recommendedName>
  </protein>
  <gene>
    <name type="ordered locus">Pret-022</name>
  </gene>
  <organism key="1">
    <name type="scientific">African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996)</name>
    <name type="common">ASFV</name>
    <dbReference type="NCBI Taxonomy" key="2" id="561443"/>
    <lineage>
      <taxon>Viruses</taxon>
      <taxon>dsDNA viruses, no RNA stage</taxon>
      <taxon>Asfarviridae</taxon>
      <taxon>Asfivirus</taxon>
    </lineage>
  </organism>
  <organismHost key="3">
    <name type="scientific">Ornithodoros</name>
    <name type="common">relapsing fever ticks</name>
    <dbReference type="NCBI Taxonomy" key="4" id="6937"/>
  </organismHost>
  <organismHost key="5">
    <name type="scientific">Phacochoerus aethiopicus</name>
    <name type="common">Warthog</name>
    <dbReference type="NCBI Taxonomy" key="6" id="85517"/>
  </organismHost>
  <organismHost key="7">
    <name type="scientific">Phacochoerus africanus</name>
    <name type="common">Warthog</name>
    <dbReference type="NCBI Taxonomy" key="8" id="41426"/>
  </organismHost>
  <organismHost key="9">
    <name type="scientific">Potamochoerus larvatus</name>
    <name type="common">Bushpig</name>
    <dbReference type="NCBI Taxonomy" key="10" id="273792"/>
  </organismHost>
  <organismHost key="11">
    <name type="scientific">Sus scrofa</name>
    <name type="common">Pig</name>
    <dbReference type="NCBI Taxonomy" key="12" id="9823"/>
  </organismHost>
  <reference key="13">
    <citation type="submission" db="EMBL/GenBank/DDBJ databases" date="2003-03">
      <title>African swine fever virus genomes.</title>
      <authorList>
        <person name="Kutish G.F."/>
        <person name="Rock D.L."/>
      </authorList>
    </citation>
    <scope>NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]</scope>
  </reference>
  <comment type="function">
    <text status="By similarity">Plays a role in virus cell tropism, and may be required for efficient virus replication in macrophages.</text>
  </comment>
  <comment type="subcellular location">
    <subcellularLocation>
      <location>Host membrane; Multi-pass membrane protein</location>
    </subcellularLocation>
  </comment>
  <comment type="similarity">
    <text>Belongs to the asfivirus MGF 110 family.</text>
  </comment>
  <dbReference type="EMBL" key="14" id="AY261363">
    <property value="NOT_ANNOTATED_CDS" type="status"/>
    <property value="Genomic_DNA" type="molecule type"/>
  </dbReference>
  <dbReference type="Go" key="15" id="GO:0016021">
    <property value="C:integral to membrane" type="term"/>
    <property value="IEA:UniProtKB-SubCell" type="evidence"/>
  </dbReference>
  <dbReference type="InterPro" key="16" id="IPR004848">
    <property value="V110_vir" type="entry name"/>
  </dbReference>
  <dbReference type="Pfam" key="17" id="PF01639">
    <property value="v110" type="entry name"/>
    <property value="2" type="match status"/>
  </dbReference>
  <proteinExistence type="Inferred from homology"/>
  <keyword id="KW-0325">Glycoprotein</keyword>
  <keyword id="KW-1043">Host membrane</keyword>
  <keyword id="KW-0472">Membrane</keyword>
  <keyword id="KW-0812">Transmembrane</keyword>
  <feature type="chain" id="PRO_0000373218" description="Protein MGF 360-1L">
    <location>
      <begin position="1"/>
      <end position="302"/>
    </location>
  </feature>
  <feature type="transmembrane region" status="Potential">
    <location>
      <begin position="26"/>
      <end position="46"/>
    </location>
  </feature>
  <feature type="transmembrane region" status="Potential">
    <location>
      <begin position="154"/>
      <end position="174"/>
    </location>
  </feature>
  <feature type="transmembrane region" status="Potential">
    <location>
      <begin position="183"/>
      <end position="203"/>
    </location>
  </feature>
  <feature type="glycosylation site" status="Potential" description="N-linked (GlcNAc...); by host">
    <location>
      <position position="97"/>
    </location>
  </feature>
  <feature type="glycosylation site" status="Potential" description="N-linked (GlcNAc...); by host">
    <location>
      <position position="294"/>
    </location>
  </feature>
  <sequence version="1" modified="2009-05-05" mass="35742" length="302" checksum="7121F87EC41D9595">MYFYKKYLHFFFVVSKFKFFLKMQVPFGCNMKGLGVLLGLFSLILAQQLPDLPRTQHPPKRELKYWCTYVPQCDFCWDCQNGICKNKIMETQLIDSNHSIVNCRVSRNSETQTCFYEISSKMPNHFSMSCSHPTPYIGNEIFMKKVGGDYMTLLTLKQYCLYFIISIAFAGCFVYAVRKNLRLNTTIKLLTLLSILVYLAQPVLNRPLSIFYTKQFLPRTYTPPTRELDYWCTYAKHCDFCWECRKGICKNKVLDDMPPFIIQNDYINKCSIARYFDRCMYFIEPKIPYIHYMNCSLPTYYG</sequence>
</entry>
</uniprot>
 
     |