1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98
|
<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
<BlastOutput_program>psiblast</BlastOutput_program>
<BlastOutput_version>PSIBLAST 2.15.0+</BlastOutput_version>
<BlastOutput_reference>Alejandro A. Sch&auml;ffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005.</BlastOutput_reference>
<BlastOutput_db>swissprot</BlastOutput_db>
<BlastOutput_query-ID>Query_1</BlastOutput_query-ID>
<BlastOutput_query-def>WP_001234791.1 Sec-independent protein translocase subunit TatA [Shigella flexneri]</BlastOutput_query-def>
<BlastOutput_query-len>103</BlastOutput_query-len>
<BlastOutput_param>
<Parameters>
<Parameters_matrix>BLOSUM62</Parameters_matrix>
<Parameters_expect>1e-30</Parameters_expect>
<Parameters_gap-open>11</Parameters_gap-open>
<Parameters_gap-extend>1</Parameters_gap-extend>
<Parameters_filter>F</Parameters_filter>
</Parameters>
</BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
<Iteration_iter-num>1</Iteration_iter-num>
<Iteration_query-ID>Query_1</Iteration_query-ID>
<Iteration_query-def>WP_001234791.1 Sec-independent protein translocase subunit TatA [Shigella flexneri]</Iteration_query-def>
<Iteration_query-len>103</Iteration_query-len>
<Iteration_hits>
<Hit>
<Hit_num>1</Hit_num>
<Hit_id>sp|P69428.1|</Hit_id>
<Hit_def>RecName: Full=Sec-independent protein translocase protein TatA [Escherichia coli K-12] >sp|P69429.1| RecName: Full=Sec-independent protein translocase protein TatA [Escherichia coli CFT073] >sp|P69430.1| RecName: Full=Sec-independent protein translocase protein TatA [Escherichia coli O157:H7] >sp|P69431.1| RecName: Full=Sec-independent protein translocase protein TatA [Shigella flexneri]</Hit_def>
<Hit_accession>P69428</Hit_accession>
<Hit_len>89</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>177.178</Hsp_bit-score>
<Hsp_score>448</Hsp_score>
<Hsp_evalue>2.3039e-58</Hsp_evalue>
<Hsp_query-from>15</Hsp_query-from>
<Hsp_query-to>103</Hsp_query-to>
<Hsp_hit-from>1</Hsp_hit-from>
<Hsp_hit-to>89</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>89</Hsp_identity>
<Hsp_positive>89</Hsp_positive>
<Hsp_gaps>0</Hsp_gaps>
<Hsp_align-len>89</Hsp_align-len>
<Hsp_qseq>MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV</Hsp_qseq>
<Hsp_hseq>MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV</Hsp_hseq>
<Hsp_midline>MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>2</Hit_num>
<Hit_id>sp|P0A2H3.1|</Hit_id>
<Hit_def>RecName: Full=Sec-independent protein translocase protein TatA [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] >sp|P0A2H4.1| RecName: Full=Sec-independent protein translocase protein TatA [Salmonella enterica subsp. enterica serovar Typhi]</Hit_def>
<Hit_accession>P0A2H3</Hit_accession>
<Hit_len>84</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>142.51</Hsp_bit-score>
<Hsp_score>358</Hsp_score>
<Hsp_evalue>1.0691e-44</Hsp_evalue>
<Hsp_query-from>15</Hsp_query-from>
<Hsp_query-to>103</Hsp_query-to>
<Hsp_hit-from>1</Hsp_hit-from>
<Hsp_hit-to>84</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>75</Hsp_identity>
<Hsp_positive>79</Hsp_positive>
<Hsp_gaps>5</Hsp_gaps>
<Hsp_align-len>89</Hsp_align-len>
<Hsp_qseq>MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV</Hsp_qseq>
<Hsp_hseq>MGGISIWQLLIVAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDDAKQDKTSQDADFTAKSIADKQG-----EAKKEDAKSQDKEQV</Hsp_hseq>
<Hsp_midline>MGGISIWQLLI+AVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDD+ KQDKTSQDADFTAK+IADKQ +AK EDAK DKEQV</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
</Iteration_hits>
<Iteration_stat>
<Statistics>
<Statistics_db-num>482816</Statistics_db-num>
<Statistics_db-len>183558113</Statistics_db-len>
<Statistics_hsp-len>72</Statistics_hsp-len>
<Statistics_eff-space>4627826878</Statistics_eff-space>
<Statistics_kappa>0.041</Statistics_kappa>
<Statistics_lambda>0.267</Statistics_lambda>
<Statistics_entropy>0.14</Statistics_entropy>
</Statistics>
</Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>
|