1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653
|
# This program is public domain
# Author: Paul Kienzle
"""
Biomolecule support.
:class:`Molecule` lets you define biomolecules with labile hydrogen atoms
specified using H[1] in the chemical formula. The biomolecule object creates
forms with natural isotope ratio, all hydrogen and all deuterium. Density can be
provided as natural density or cell volume. A %D2O contrast match value is
computed for matching the molecule SLD in the presence of labile hydrogens.
:meth:`Molecule.D2Osld` computes the neutron SLD for the solvated molecule in a
%D2O solvent.
:class:`Sequence` lets you read amino acid and DNA/RNA sequences from FASTA
files.
Tables for common molecules are provided[1]:
*AMINO_ACID_CODES* : amino acids indexed by FASTA code
*RNA_CODES*, DNA_CODES* : nucleic bases indexed by FASTA code
*RNA_BASES*, DNA_BASES* : individual nucleic acid bases
*NUCLEIC_ACID_COMPONENTS*, *LIPIDS*, *CARBOHYDRATE_RESIDUES*
Neutron SLD for water at 20C is also provided as *H2O_SLD* and *D2O_SLD*.
For unmodified protein an H and an OH are added for terminations.
Assumes that proteins were created in an environment with the usual H/D isotope
ratio on the nonlabile hydrogen.
The value of residue volumes differs from that used by the bio scattering
calculators from ISIS and ORSO, which will lead to different values for SLD.
There are small differences for the number of hydrogen in His and Cys residues,
where one table considers them present but labile and the other considers them
absent.
DNA and RNA residues from the source[1] included sodium in the chemical formula,
but these have been removed and will not appear in the sequence. Volumes for DNA
and RNA residues come from Buckin (1989) as reported in Durchlag (1997), with
correction for phosphorylation and dehydration. The correction value of 30.39
comes from comparison of the volume given in Harroun (2006) to the volumes of
the RNA ACGU and DNA T nucleosides given in Buckin (1989) after correcting for
units. Harroun doesn't give volumes for DNA AGC nucleosides despite them being
different (especially guanosine). This code uses the values from Buckin for
these as well, rather than the RNA nucleoside values given in Harroun. Note that
the computed density for equal parts AGCT is 1.67, compared to the measured
average of 1.70 given in Arrighi (1970).
[1] Perkins, S.J. (1988). Chapter 6 X-Ray and Neutron Solution Scattering, in:
New Comprehensive Biochemistry. Elsevier, pp. 143-265.
https://doi.org/10.1016/S0167-7306(08)60575-X
[2] Buckin, V. A., B. I. Kankiya, and R. L. Kazaryan (1989). Hydration of
nucleosides in dilute aqueous solutions: ultrasonic velocity and density
measurements. Biophysical chemistry 34.3 211-223.
https://doi.org/10.1016/0301-4622(89)80060-2
[3] Durchschlag, H. and Zipper, P. (1997). Calculation of partial specific
volumes and other volumetric properties of small molecules and polymers. Journal
of Applied Chemistry 30 803-807. https://doi.org/10.1107/S0021889897003348
[4] Harroun, T.A., Wignall, G.D., Katsaras, J. (2006). Neutron Scattering for
Biology. In: Neutron Scattering in Biology. Springer, Berlin, Heidelberg.
https://doi.org/10.1007/3-540-29111-3_1
[5] Arrighi, F.E., Mandel, M., Bergendahl, J. et al. (1970). Buoyant densities
of DNA of mammals. Biochem Genet 4, 367–376. https://doi.org/10.1007/BF00485753
"""
import warnings
from pathlib import Path
# Warning: name clash with Sequence
from collections.abc import Iterator
from typing import IO, cast
from .formulas import formula as parse_formula, Formula, FormulaInput
from .nsf import neutron_sld
from .xsf import xray_sld
from .core import default_table, Atom
from .constants import avogadro_number
# CRUFT 1.5.2: retaining fasta.isotope_substitution for compatibility
def isotope_substitution(formula: Formula, source: Atom, target: Atom, portion: float=1.0):
"""
Substitute one atom/isotope in a formula with another in some proportion.
*formula* is the formula being updated.
*source* is the isotope/element to be substituted.
*target* is the replacement isotope/element.
*portion* is the proportion of source which is substituted for target.
.. deprecated:: 1.5.3
Use formula.replace(source, target, portion) instead.
"""
return formula.replace(source, target, portion=portion)
# TODO: allow Molecule to be used as compound in formulas.formula()
class Molecule:
"""
Specify a biomolecule by name, chemical formula, cell volume and charge.
Labile hydrogen positions should be coded using H[1] rather than H.
H[1] will be substituded with H for solutions with natural water
or D for solutions with heavy water. Any deuterated non-labile hydrogen
can be marked with D, and they will stay as D regardless of the solvent.
*name* is the molecule name.
*formula* is the chemical formula as string or atom dictionary, with
H[1] for labile hydrogen.
*cell_volume* is the volume of the molecule. If None, cell volume will
be inferred from the natural density of the molecule. Cell volume is
assumed to be independent of isotope.
*density* is the natural density of the molecule. If None, density will
be inferred from cell volume.
*charge* is the overall charge on the molecule. Note that charge can be
fractional if the molecule is the average of a statistical ensemble.
**Attributes**
*labile_formula* is the original formula, with H[1] for the labile H.
You can retrieve the deuterated from using::
molecule.labile_formula.replace(elements.H[1], elements.D)
*natural_formula* has H substituted for H[1] in *labile_formula*.
*D2Omatch* is percentage of D2O by volume in H2O required to match the
SLD of the molecule, including substitution of labile hydrogen in
proportion to the D/H ratio in the solvent. Values will be outside
the range [0, 100] if the contrast match is impossible.
*sld*/*Dsld* are the the SLDs of the molecule with H[1] replaced by
naturally occurring H/D ratios and pure D respectively.
*mass*/*Dmass* are the masses for natural H/D and pure D respectively.
*charge* is the charge on the molecule
*cell_volume* is the estimated cell volume for the molecule
*density* is the estimated molecule density
Change 1.5.3: drop *Hmass* and *Hsld*. Move *formula* to *labile_formula*.
Move *Hnatural* to *formula*.
"""
name: str
cell_volume: float
sld: float
Dsld: float
mass: float
Dmass: float
D2Omatch: float
charge: float # fractional to allow ensemble average molecules
natural_formula: Formula
labile_formula: Formula
formula: Formula
code: str # fasta code for dna/rna
def __init__(
self,
name: str,
formula: FormulaInput,
cell_volume: float|None=None,
density: float|None=None,
charge: float=0,
):
# TODO: fasta does not work with table substitution
elements = default_table()
# Fill in density or cell_volume.
M = parse_formula(formula, natural_density=density)
# CRUFT: use of T rather than H[1] is deprecated since 1.5.3
if elements.T in M.atoms:
warnings.warn("Use of tritium for labile hydrogen is deprecated."
" Use H[1] instead of T in your formula.")
M = M.replace(elements.T, elements.H[1])
if cell_volume is not None:
# Note: cell_volume is only zero if there are no components
M.density = 1e24*M.molecular_mass/cell_volume if cell_volume > 0 else 0
#print name, M.molecular_mass, cell_volume, M.density
else:
assert M.density is not None, "Need density to compute cell volume"
cell_volume = 1e24*M.molecular_mass/M.density
H = M.replace(elements.H[1], elements.H)
D = M.replace(elements.H[1], elements.D)
self.name = name
self.cell_volume = cell_volume
self.sld, self.Dsld = neutron_sld(H)[0], neutron_sld(D)[0]
self.mass, self.Dmass = H.mass, D.mass
self.D2Omatch = D2Omatch(self.sld, self.Dsld)
self.charge = charge
self.natural_formula = H
self.labile_formula = M
# TODO: formula should be natural_formula to be consistent
# with sld and mass, which are computed with H-substitution.
self.formula = self.labile_formula
# TODO: are sld values float or complex?
def D2Osld(self, volume_fraction: float=1., D2O_fraction: float=0.) -> float:
"""
Neutron SLD of the molecule in a deuterated solvent.
Changed 1.5.3: fix errors in SLD calculations.
"""
solvent_sld = D2O_fraction*D2O_SLD + (1-D2O_fraction)*H2O_SLD
solute_sld = D2O_fraction*self.Dsld + (1-D2O_fraction)*self.sld
return volume_fraction*solute_sld + (1-volume_fraction)*solvent_sld
class Sequence(Molecule):
"""
Convert FASTA sequence into chemical formula.
*name* sequence name
*sequence* code string
*type* is one of::
aa: amino acid sequence
dna: dna sequence
rna: rna sequence
Note: rna sequence files treat T as U and dna sequence files treat U as T.
"""
sequence: str
@staticmethod
def loadall(filename: Path|str, type: str|None=None) -> Iterator["Sequence"]:
"""
Iterate over sequences in FASTA file, loading each in turn.
Yields one FASTA sequence each cycle.
"""
type = _guess_type_from_filename(str(filename), type)
with open(filename, 'rt') as fh:
for name, seq in read_fasta(fh):
yield Sequence(name, seq, type=type)
@staticmethod
def load(filename: Path|str, type=None) -> "Sequence":
"""
Load the first FASTA sequence from a file.
"""
type = _guess_type_from_filename(str(filename), type)
with open(filename, 'rt') as fh:
name, seq = next(read_fasta(fh))
return Sequence(name, seq, type=type)
def __init__(self, name: str, sequence: str, type: str='aa'):
# TODO: duplicated in Molecule.__init__
# TODO: fasta does not work with table substitution
elements = default_table()
codes = CODE_TABLES[type]
sequence = sequence.split('*', 1)[0] # stop at first '*'
sequence = sequence.replace(' ', '') # ignore spaces
parts = tuple(codes[c] for c in sequence)
cell_volume = sum(p.cell_volume for p in parts)
charge = sum(p.charge for p in parts)
structure = []
for p in parts:
structure.extend(list(p.labile_formula.structure))
# Add H + OH terminators to the sequence
structure.extend(((2, elements.H[1]), (1, elements.O)))
formula = parse_formula(structure).hill
Molecule.__init__(
self, name, formula, cell_volume=cell_volume, charge=charge)
self.sequence = sequence
def _guess_type_from_filename(filename: str, type: str|None) -> str:
if type is None:
if filename.endswith('.fna'):
type = 'dna'
elif filename.endswith('.ffn'):
type = 'dna'
elif filename.endswith('.faa'):
type = 'aa'
elif filename.endswith('.frn'):
type = 'rna'
else:
type = 'aa'
return type
# PAK: Fixed in 1.5.3. Previous calculation used H2O density rather than D2O.
#: real portion of H2O sld at 20 C
H2O_SLD = neutron_sld("H2O@0.9982n")[0]
#: real portion of D2O sld at 20 C
#: Change 1.5.2: Use correct density in SLD calculation
D2O_SLD = neutron_sld("D2O@0.9982n")[0]
def D2Omatch(Hsld: float, Dsld: float) -> float:
"""
Find the D2O% concentration of solvent such that neutron SLD of the
material matches the neutron SLD of the solvent.
*Hsld*, *Dsld* are the SLDs for the hydrogenated and deuterated forms
of the material respectively, where *D* includes all the labile protons
swapped for deuterons. Water SLD is calculated at 20 C.
Note that the resulting percentage is only meaningful between
0% to 100%. Beyond 100% you will need an additional constrast agent
in the 100% D2O solvent to increase the SLD enough to match.
.. deprecated:: 1.5.3
Use periodictable.nsf.D2O_match(formula) instead.
Change 1.5.3: corrected D2O sld, which will change the computed match point.
"""
# SLD(%Dsample + (1-%)Hsample) = SLD(%D2O + (1-%)H2O)
# => %SLD(Dsample) + (1-%)SLD(Hsample) = %SLD(D2O) + (1-%)SLD(H2O)
# => %(SLD(Dsample) - SLD(Hsample) + SLD(H2O) - SLD(D2O))
# = SLD(H2O) - SLD(Hsample)
# => % = 100*(SLD(H2O) - SLD(Hsample))
# / (SLD(Dsample) - SLD(Hsample) + SLD(H2O) - SLD(D2O))
return 100 * (H2O_SLD - Hsld) / (Dsld - Hsld + H2O_SLD - D2O_SLD)
def read_fasta(fp: IO[str]) -> Iterator[tuple[str, str]]:
"""
Iterate over the sequences in a FASTA file.
Each iteration is a pair (sequence name, sequence codes).
Change 1.5.3: Now uses H[1] rather than T for labile hydrogen.
"""
name = ""
seq: list[str] = []
for line in fp:
line = line.rstrip()
if line.startswith(">"):
if name:
yield name, ''.join(seq)
name, seq = line, []
else:
seq.append(line)
if name:
yield name, ''.join(seq)
def _code_average(bases, code_table) -> tuple[Formula, float, float]:
"""
Compute average over possible nucleotides, assuming equal weight if
precise nucleotide is not known.
Note: averaging can lead to a fractional charge on the returned molecule.
"""
n = len(bases)
formula, cell_volume, charge = parse_formula(), 0., 0.
for c in bases:
base = code_table[c]
formula += base.labile_formula
cell_volume += base.cell_volume
charge += base.charge
if n > 0:
formula, cell_volume, charge = (1/n) * formula, cell_volume/n, charge/n
return formula, cell_volume, charge
def _set_amino_acid_average(target: str, codes: str, name: str|None=None) -> None:
"""
Fill in partial unknowns for amino acids, such as "B" for aspartic acid or asparagine.
"""
formula, cell_volume, charge = _code_average(codes, AMINO_ACID_CODES)
if name is None:
name = "/".join(AMINO_ACID_CODES[c].name for c in codes)
molecule = Molecule(name, formula, cell_volume=cell_volume, charge=charge)
AMINO_ACID_CODES[target] = molecule
# TODO: importing fasta does work, computing the neutron SLD for each molecule.
# This triggers nsf.init() which defines the neutron data for each isotope.
# Further, this does not allow private tables for fasta calculations.
# FASTA code table
def _(code: str, V: float, formula: str, name: str) -> tuple[str, Molecule]:
if formula[-1] == '-':
charge = -1
formula = formula[:-1]
elif formula[-1] == '+':
charge = +1
formula = formula[:-1]
else:
charge = 0
molecule = Molecule(name, formula, cell_volume=V, charge=charge)
molecule.code = code # Add code attribute so we can write as well as read
return code, molecule
# pylint: disable=bad-whitespace
AMINO_ACID_CODES: dict[str, Molecule] = dict((
#code, volume, formula, name
_("A", 91.5, "C3H4H[1]NO", "alanine"),
#B: D or N
_("C", 105.6, "C3H3H[1]NOS", "cysteine"),
_("D", 124.5, "C4H3H[1]NO3-", "aspartic acid"),
_("E", 155.1, "C5H5H[1]NO3-", "glutamic acid"),
_("F", 203.4, "C9H8H[1]NO", "phenylalanine"),
_("G", 66.4, "C2H2H[1]NO", "glycine"),
_("H", 167.3, "C6H5H[1]3N3O+", "histidine"),
_("I", 168.8, "C6H10H[1]NO", "isoleucine"),
#J: L or I
_("K", 171.3, "C6H9H[1]4N2O+", "lysine"),
_("L", 168.8, "C6H10H[1]NO", "leucine"),
_("M", 170.8, "C5H8H[1]NOS", "methionine"),
_("N", 135.2, "C4H3H[1]3N2O2", "asparagine"),
#O: _("O", ???.?, "C12H21N3O3", "pyrrolysine") -- update X below
_("P", 129.3, "C5H7NO", "proline"),
_("Q", 161.1, "C5H5H[1]3N2O2", "glutamine"),
_("R", 202.1, "C6H7H[1]6N4O+", "arginine"),
_("S", 99.1, "C3H3H[1]2NO2", "serine"),
_("T", 122.1, "C4H5H[1]2NO2", "threonine"),
#U: selenocysteine -- update X below
_("V", 141.7, "C5H8H[1]NO", "valine"),
_("W", 237.6, "C11H8H[1]2N2O", "tryptophan"),
#X: any
_("Y", 203.6, "C9H7H[1]2NO2", "tyrosine"),
#Z: E or Q
#-: gap
))
_set_amino_acid_average('B', 'DN')
_set_amino_acid_average('J', 'LI')
_set_amino_acid_average('Z', 'EQ')
_set_amino_acid_average('X', 'ACDEFGHIKLMNPQRSTVWY', name='any')
_set_amino_acid_average('-', '', name='gap')
__doc__ += "\n\n*AMINO_ACID_CODES*::\n\n " + "\n ".join(
"%s: %s"%(k, v.name) for k, v in sorted(AMINO_ACID_CODES.items()))
# mypy doesn't like redefinitions
def _1(formula: str, V: float, name: str) -> tuple[str, Molecule]:
molecule = Molecule(name, formula, cell_volume=V)
return name, molecule
NUCLEIC_ACID_COMPONENTS: dict[str, Molecule] = dict((
# formula, volume, name
_1("NaPO3", 60, "phosphate"),
_1("C5H6H[1]O3", 125, "ribose"),
_1("C5H7O2", 115, "deoxyribose"),
_1("C5H2H[1]2N5", 114, "adenine"),
_1("C4H2H[1]N2O2", 99, "uracil"),
_1("C5H4H[1]N2O2", 126, "thymine"),
_1("C5HH[1]3N5O", 119, "guanine"),
_1("C4H2H[1]2N3O", 103, "cytosine"),
))
__doc__ += "\n\n*NUCLEIC_ACID_COMPONENTS*::\n\n " + "\n ".join(
"%s: %s"%(k, v.formula) for k, v in sorted(NUCLEIC_ACID_COMPONENTS.items()))
CARBOHYDRATE_RESIDUES: dict[str, Molecule] = dict((
# formula, volume, name
_1("C6H7H[1]3O5", 171.9, "Glc"),
_1("C6H7H[1]3O5", 166.8, "Gal"),
_1("C6H7H[1]3O5", 170.8, "Man"),
_1("C6H7H[1]4O5", 170.8, "Man (terminal)"),
_1("C8H10H[1]3NO5", 222.0, "GlcNAc"),
_1("C8H10H[1]3NO5", 232.9, "GalNAc"),
_1("C6H7H[1]3O4", 160.8, "Fuc (terminal)"),
_1("C11H11H[1]5NO8", 326.3, "NeuNac (terminal)"),
# Glycosaminoglycans
_1("C14H15H[1]5NO11Na", 390.7, "hyaluronate"), # GlcA.GlcNAc
_1("C14H17H[1]5NO13SNa", 473.5, "keratan sulphate"), # Gal.GlcNAc.SO4
_1("C14H15H[1]4NO14SNa", 443.5, "chondroitin sulphate"), # GlcA.GalNAc.SO4
))
__doc__ += "\n\n*CARBOHYDRATE_RESIDUES*::\n\n " + "\n ".join(
"%s: %s"%(k, v.formula) for k, v in sorted(CARBOHYDRATE_RESIDUES.items()))
LIPIDS: dict[str, Molecule] = dict((
# formula, volume, name
_1("CH2", 27, "methylene"),
_1("CD2", 27, "methylene-D"),
_1("C10H18NO8P", 350, "phospholipid headgroup"),
_1("C6H5O6", 240, "triglyceride headgroup"),
_1("C36H72NO8P", 1089, "DMPC"),
_1("C36H20D52NO8P", 1089, "DMPC-D52"),
_1("C29H55H[1]3NO8P", 932, "DLPE"),
_1("C27H45H[1]O", 636, "cholesteral"),
_1("C45H78O2", 1168, "oleate"),
_1("C57H104O6", 1617, "trioleate form"),
_1("C39H77H[1]2N2O2P", 1166, "palmitate ester"),
))
__doc__ += "\n\n*LIPIDS*::\n\n " + "\n ".join(
"%s: %s"%(k, v.formula) for k, v in sorted(LIPIDS.items()))
RNA_BASES: dict[str, Molecule] = {}
RNA_CODES: dict[str, Molecule] = {}
DNA_BASES: dict[str, Molecule] = {}
DNA_CODES: dict[str, Molecule] = {}
def _set_rna_dna_codes() -> None:
"""
Convert RNA/DNA table values into Molecule.
Measured volumes from isolated mers reported in Durchschlag 1997, converted
from mL/mol, with an addition of 30.39 to account for phosphorylation and
dehydration in sequence. The value of 30.39 comes from comparison of the
volume given in Harroun (2006) to the volumes of the RNA + T nucleosides
given in Buckin (1989) after correcting for units. Harroun (2006) doesn't
give volumes for AGC in the DNA nucleosides despite them being different in
the Buckin source (especially guanosine).
"""
# code, formula, volume (mL/mol), name
rna_bases = (
("A", "C10H8H[1]3N5O6P", 170.8, "adenosine"),
("T", "C9H8H[1]2N2O8P", 151.7, "uridine"), # Use H[1] for U in RNA
("G", "C10H7H[1]4N5O7P", 178.2, "guanosine"),
("C", "C9H8H[1]3N3O7P", 153.7, "cytidine"),
)
dna_bases = (
("A", "C10H9H[1]2N5O5P", 169.8, "adenosine"),
("T", "C10H11H[1]1N2O7P", 167.6, "thymidine"),
("G", "C10H8H[1]3N5O6P", 173.7, "guanosine"),
("C", "C9H9H[1]2N3O6P", 153.4, "cytidine"),
)
codes = (
#code, nucleotides, name
("A", "A", "adenosine"),
("C", "C", "cytidine"),
("G", "G", "guanosine"),
("T", "T", "thymidine"),
("U", "T", "uridine"), # RNA_BASES["T"] is uridine
("R", "AG", "purine"),
("Y", "CT", "pyrimidine"),
("K", "GT", "ketone"),
("M", "AC", "amino"),
("S", "CG", "strong"),
("W", "AT", "weak"),
("B", "CGT", "not A"),
("D", "AGT", "not C"),
("H", "ACT", "not G"),
("V", "ACG", "not T"),
("N", "ACGT", "any base"),
("X", "", "masked"),
("-", "", "gap"),
)
for code, formula, volume, name in rna_bases:
cell_volume = volume * 1e24/avogadro_number + 30.39
molecule = Molecule(name, formula, cell_volume=cell_volume)
molecule.code = code
RNA_BASES[code] = molecule
for code, formula, volume, name in dna_bases:
cell_volume = volume * 1e24/avogadro_number + 30.39
molecule = Molecule(name, formula, cell_volume=cell_volume)
molecule.code = code
DNA_BASES[code] = molecule
for code, bases, name in codes:
D, V, _ = _code_average(bases, RNA_BASES)
rna = Molecule(name, D.hill, cell_volume=V)
rna.code = code
D, V, _ = _code_average(bases, DNA_BASES)
dna = Molecule(name, D.hill, cell_volume=V)
dna.code = code
RNA_CODES[code] = rna
DNA_CODES[code] = dna
_set_rna_dna_codes()
# pylint: enable=bad-whitespace
__doc__ += "\n\n*RNA_BASES*::\n\n " + "\n ".join(
"%s:%s"%(k, v.name) for k, v in sorted(RNA_BASES.items()))
__doc__ += "\n\n*DNA_BASES*::\n\n " + "\n ".join(
"%s:%s"%(k, v.name) for k, v in sorted(DNA_BASES.items()))
CODE_TABLES: dict[str, dict[str, Molecule]] = {
'aa': AMINO_ACID_CODES,
'dna': DNA_CODES,
'rna': RNA_CODES,
}
def fasta_table() -> None:
elements = default_table()
rows = []
rows += [v for k, v in sorted(AMINO_ACID_CODES.items())]
rows += [v for k, v in sorted(NUCLEIC_ACID_COMPONENTS.items())]
rows += [Sequence("beta casein", beta_casein)]
print("%25s %7s %7s %7s %5s %5s %5s %5s %5s %5s"
% ("name", "M(H2O)", "M(D2O)", "volume",
"den", "#el", "xray", "nH2O", "nD2O", "%D2O match"))
for v in rows:
protons = sum(num*el.number for el, num in v.natural_formula.atoms.items())
electrons = protons - v.charge
Xsld = xray_sld(v.formula, wavelength=cast(float, elements.Cu.K_alpha))
print("%25s %7.1f %7.1f %7.1f %5.2f %5d %5.2f %5.2f %5.2f %5.1f"%(
v.name, v.mass, v.Dmass, v.cell_volume, v.natural_formula.density or 0.,
electrons, Xsld[0], v.sld, v.Dsld, v.D2Omatch))
beta_casein = "RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV"
## Uncomment to show package path on CI infrastructure
#def doctestpath():
# """
# Checking import path for doctests::
#
# >>> import periodictable
# >>> print(f"Path to imported periodictable in docstr is {periodictable.__file__}")
# some path printed here
# """
def test():
from periodictable.constants import avogadro_number
from .formulas import formula
elements = default_table()
## Uncomment to show package path on CI infrastructure
#import periodictable
#print(f"Path to imported periodictable in package is {periodictable.__file__}")
#print(fail_test)
# Beta casein results checked against Duncan McGillivray's spreadsheet
# name Hmass Dmass vol den #el xray Hsld Dsld
# =========== ======= ======= ======= ===== ===== ===== ===== =====
# beta casein 23561.9 23880.9 30872.9 1.27 12614 11.55 1.68 2.75
# ... updated for new mass table [2023-08]
# same 23562.3 23881.2 same 1.27 same 1.68 2.75
seq = Sequence("beta casein", beta_casein)
density = seq.mass/avogadro_number/seq.cell_volume*1e24
# print(seq.formula)
# print(seq.mass, seq.Dmass, density, seq.sld, seq.Dsld)
# Sequence now includes terminators: H[1]-...-OH[1], so adjust the masses
# slightly from the spreadsheet values.
H2O = formula("H2O@1n")
D2O = formula("D2O@1n")
assert abs(seq.mass - (23562.3 + H2O.mass)) < 0.1
assert abs(seq.Dmass - (23881.2 + D2O.mass)) < 0.1
assert abs(seq.cell_volume - 30872.9) < 0.1
assert abs(density - 1.267) < 0.01
assert abs(seq.sld - 1.68) < 0.01
assert abs(seq.Dsld - 2.75) < 0.01
# Check that X-ray sld is independent of isotope
H = seq.labile_formula.replace(elements.H[1], elements.H)
D = seq.labile_formula.replace(elements.H[1], elements.D)
Hsld, Dsld = xray_sld(H, wavelength=1.54), xray_sld(D, wavelength=1.54)
#print Hsld, Dsld
assert abs(Hsld[0]-Dsld[0]) < 1e-10
if __name__ == "__main__":
fasta_table()
#test()
|