File: genewise-db.out

package info (click to toggle)
wise 2.4.1-21
  • links: PTS, VCS
  • area: main
  • in suites: bullseye, buster, sid
  • size: 27,140 kB
  • sloc: ansic: 276,365; makefile: 1,003; perl: 886; lex: 93; yacc: 81; sh: 24
file content (515 lines) | stat: -rw-r--r-- 18,182 bytes parent folder | download
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362
363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410
411
412
413
414
415
416
417
418
419
420
421
422
423
424
425
426
427
428
429
430
431
432
433
434
435
436
437
438
439
440
441
442
443
444
445
446
447
448
449
450
451
452
453
454
455
456
457
458
459
460
461
462
463
464
465
466
467
468
469
470
471
472
473
474
475
476
477
478
479
480
481
482
483
484
485
486
487
488
489
490
491
492
493
494
495
496
497
498
499
500
501
502
503
504
505
506
507
508
509
510
511
512
513
514
515
Wise2 - database searching mode
Program: genewisedb version: $Name: wise2-4-1 $ released: unreleased
This program is freely distributed under a GNU General Public License.
   See -version for more info on copyright
Bugs and credits to Ewan Birney <birney@sanger.ac.uk>
-----------------------------------------------------

Algorithm type:        GeneWise
Search algorithm used: 623
Implementation:        Single Threaded processor (serial)
Search mode:           Single protein vs genomic db
Protein info from:     rrm.HMM
Dna info from:         dna.db
Start/End (protein)    global
Gene Paras:            /usr/share/wise/human.gf
Codon Table:           /usr/share/wise/codon.table
Subs error:            1e-05
Indel error:           1e-05
Model splice?          model
Model codon bias?      flat
Model intron bias?     tied
Null model             syn
Alignment Alg          623L
[Warning: Can't fit histogram to a db smaller than 1,000]


#
#WARNING!
#
# Your alignment algorithm is different from your search algorithm.
# This is probably quite sensible but will lead to differing scores.
# Use the search score as an indicator of the significance of the match
# Read the docs for more information
#


#High Score list
#Protein ID                 DNA Str  ID                        Bits Evalue
--------------------------------------------------------------------------
Protein SEED                DNA [+] MMD728                   101.74
Protein SEED                DNA [+] MMD729                   101.74
Protein SEED                DNA [+] MMFLI2X                  101.74
Protein SEED                DNA [+] SAHNRNPH                 86.11


#Alignments
-----------------------------------------------------------------------

>Results for SEED vs MMD728 (forward) [0]

genewisedb output
Score 179.66 bits over entire alignment.
This will be different from per-alignment scores. See manual for details
For computer parsable output, try genewisedb -help or read the manual
Scores as bits over a synchronous coding model

                                                                       
                                                                       
                                                                       
                                                                       
                                                                       
                     Alignment 1 Score 86.15 (Bits)                    


SEED               1 LFVGNLPPDVTEEDLKDLFSKFGPIVSIKIVRDIIEKPKETGKSKGFAF 
                     LF+G+L++++T+E L+ +F++ G  +++ ++RD     ++T++S+GF+F 
                     LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRD-----PNTKRSRGFGF 
MMD728            70 ctaggcatgaaggacaactgctgacagtggaag     caaaatagtgt 
                     tttggtgtaccaagtggataaggctcagtttga     cacagcggtgt 
                     cccaggccaaccgtggcttgagaaaactgagat     accgacgctgt 


SEED              50 VEFESEEDAEKALEALNGKELGGRKLRV                      
                     V+++++E++++A++    ++++GR+++                       
                     VTYATVEEVDAAMN-ARPHKVDGRVVEP                      
MMD728           202 gatgagggggggaa gaccagggagggc                      
                     tcacctaataccta cgcaataggttac                      
                     catctgaagttcgt aaacggtaatgat                      


                                                                       
                                                                       
                                                                       
                                                                       
                                                                       
                     Alignment 2 Score 93.51 (Bits)                    


SEED               1 LFVGNLPPDVTEEDLKDLFSKFGPIVSIKIVRDIIEKPKETGKSKGFAF 
                      FVG++ +D+ E+ L+D+F+++G+I+ I+I++D     +  GK +GFAF 
                     IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTD-----RGSGKKRGFAF 
MMD728           343 atgggaaggaggccccgttgctgaaggagaaag     agagaaagtgt 
                     tttggtaaacaaaatgaataaagatattattca     ggggaaggtct 
                     ctttttaactaatcaatttggtggtagaatgtc     actgaggcttt 


SEED              50 VEFESEEDAEKALEALNGKELGGRKLRV                      
                     V+F+++++++K +     ++++G++++V                      
                     VTFDDHDSVDKIVI-QKYHTVNGHNCEV                      
MMD728           475 gatggcgtggaaga catcagagcatgg                      
                     tctaaaactaattt aaaactagaagat                      
                     tcttctctgtgttt gacttgtccctaa                      


//
Gene 1
Gene 70 282 
  Exon 70 282 phase 0
Gene 2
Gene 343 555 
  Exon 343 555 phase 0
//
>MMD728.[70:282].sp.tr
LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNAR
PHKVDGRVVEP
>MMD728.[343:555].sp.tr
IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQK
YHTVNGHNCEV
//
>MMD728.[70:282].sp
CTCTTCATCGGAGGGCTGAGCTTCGAAACAACCGACGAGAGTCTGAGGAGCCATTTTGAG
CAATGGGGAACACTAACAGACTGTGTGGTAATGAGAGATCCAAACACCAAGAGATCCAGG
GGCTTTGGGTTTGTCACATATGCCACTGTGGAAGAAGTGGATGCTGCCATGAATGCAAGA
CCACACAAGGTGGATGGAAGAGTTGTGGAACCT
>MMD728.[343:555].sp
ATCTTTGTTGGTGGTATTAAAGAAGACACTGAAGAACATCACCTACGAGATTATTTTGAG
CAGTATGGGAAGATTGAAGTGATAGAAATTATGACTGACAGAGGCAGTGGGAAAAAGAGG
GGCTTTGCTTTTGTTACCTTTGATGACCATGACTCTGTGGATAAGATTGTTATTCAGAAA
TACCATACTGTGAATGGCCACAACTGTGAAGTA
//
Sequence MMD728
subsequence MMD728.1 70 282

Sequence MMD728.1
CDS
Start_not_found
End_not_found
CDS_predicted_by genewise 86.15
source_Exons 1 213

Sequence MMD728
subsequence MMD728.2 343 555

Sequence MMD728.2
CDS
Start_not_found
End_not_found
CDS_predicted_by genewise 93.51
source_Exons 1 213

//
Gene 0
Gene 69 - 282
Transcript 0
Exon 0-213
Translation 0 - 213

Gene 1
Gene 342 - 555
Transcript 0
Exon 0-213
Translation 0 - 213

//

>Results for SEED vs MMD729 (forward) [1]

genewisedb output
Score 179.66 bits over entire alignment.
This will be different from per-alignment scores. See manual for details
For computer parsable output, try genewisedb -help or read the manual
Scores as bits over a synchronous coding model

                                                                       
                                                                       
                                                                       
                                                                       
                                                                       
                     Alignment 1 Score 86.15 (Bits)                    


SEED               1 LFVGNLPPDVTEEDLKDLFSKFGPIVSIKIVRDIIEKPKETGKSKGFAF 
                     LF+G+L++++T+E L+ +F++ G  +++ ++RD     ++T++S+GF+F 
                     LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRD-----PNTKRSRGFGF 
MMD729            70 ctaggcatgaaggacaactgctgacagtggaag     caaaatagtgt 
                     tttggtgtaccaagtggataaggctcagtttga     cacagcggtgt 
                     cccaggccaaccgtggcttgagaaaactgagat     accgacgctgt 


SEED              50 VEFESEEDAEKALEALNGKELGGRKLRV                      
                     V+++++E++++A++    ++++GR+++                       
                     VTYATVEEVDAAMN-ARPHKVDGRVVEP                      
MMD729           202 gatgagggggggaa gaccagggagggc                      
                     tcacctaataccta cgcaataggttac                      
                     catctgaagttcgt aaacggtaatgat                      


                                                                       
                                                                       
                                                                       
                                                                       
                                                                       
                     Alignment 2 Score 93.51 (Bits)                    


SEED               1 LFVGNLPPDVTEEDLKDLFSKFGPIVSIKIVRDIIEKPKETGKSKGFAF 
                      FVG++ +D+ E+ L+D+F+++G+I+ I+I++D     +  GK +GFAF 
                     IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTD-----RGSGKKRGFAF 
MMD729           343 atgggaaggaggccccgttgctgaaggagaaag     agagaaagtgt 
                     tttggtaaacaaaatgaataaagatattattca     ggggaaggtct 
                     ctttttaactaatcaatttggtggtagaatgtc     actgaggcttt 


SEED              50 VEFESEEDAEKALEALNGKELGGRKLRV                      
                     V+F+++++++K +     ++++G++++V                      
                     VTFDDHDSVDKIVI-QKYHTVNGHNCEV                      
MMD729           475 gatggcgtggaaga catcagagcatgg                      
                     tctaaaactaattt aaaactagaagat                      
                     tcttctctgtgttt gacttgtccctaa                      


//
Gene 1
Gene 70 282 
  Exon 70 282 phase 0
Gene 2
Gene 343 555 
  Exon 343 555 phase 0
//
>MMD729.[70:282].sp.tr
LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNAR
PHKVDGRVVEP
>MMD729.[343:555].sp.tr
IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQK
YHTVNGHNCEV
//
>MMD729.[70:282].sp
CTCTTCATCGGAGGGCTGAGCTTCGAAACAACCGACGAGAGTCTGAGGAGCCATTTTGAG
CAATGGGGAACACTAACAGACTGTGTGGTAATGAGAGATCCAAACACCAAGAGATCCAGG
GGCTTTGGGTTTGTCACATATGCCACTGTGGAAGAAGTGGATGCTGCCATGAATGCAAGA
CCACACAAGGTGGATGGAAGAGTTGTGGAACCT
>MMD729.[343:555].sp
ATCTTTGTTGGTGGTATTAAAGAAGACACTGAAGAACATCACCTACGAGATTATTTTGAG
CAGTATGGGAAGATTGAAGTGATAGAAATTATGACTGACAGAGGCAGTGGGAAAAAGAGG
GGCTTTGCTTTTGTTACCTTTGATGACCATGACTCTGTGGATAAGATTGTTATTCAGAAA
TACCATACTGTGAATGGCCACAACTGTGAAGTA
//
Sequence MMD729
subsequence MMD729.1 70 282

Sequence MMD729.1
CDS
Start_not_found
End_not_found
CDS_predicted_by genewise 86.15
source_Exons 1 213

Sequence MMD729
subsequence MMD729.2 343 555

Sequence MMD729.2
CDS
Start_not_found
End_not_found
CDS_predicted_by genewise 93.51
source_Exons 1 213

//
Gene 0
Gene 69 - 282
Transcript 0
Exon 0-213
Translation 0 - 213

Gene 1
Gene 342 - 555
Transcript 0
Exon 0-213
Translation 0 - 213

//

>Results for SEED vs MMFLI2X (forward) [2]

genewisedb output
Score 179.66 bits over entire alignment.
This will be different from per-alignment scores. See manual for details
For computer parsable output, try genewisedb -help or read the manual
Scores as bits over a synchronous coding model

                                                                       
                                                                       
                                                                       
                                                                       
                                                                       
                     Alignment 1 Score 86.15 (Bits)                    


SEED               1 LFVGNLPPDVTEEDLKDLFSKFGPIVSIKIVRDIIEKPKETGKSKGFAF 
                     LF+G+L++++T+E L+ +F++ G  +++ ++RD     ++T++S+GF+F 
                     LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRD-----PNTKRSRGFGF 
MMFLI2X          105 ctaggcatgaaggacaactgctgacagtggaag     caaaatagtgt 
                     tttggtgtaccaagtggataaggctcagtttga     cacagcggtgt 
                     cccaggccaaccgtggcttgagaaaactgagat     accgacgctgt 


SEED              50 VEFESEEDAEKALEALNGKELGGRKLRV                      
                     V+++++E++++A++    ++++GR+++                       
                     VTYATVEEVDAAMN-ARPHKVDGRVVEP                      
MMFLI2X          237 gatgagggggggaa gaccagggagggc                      
                     tcacctaataccta cgcaataggttac                      
                     catctgaagttcgt aaacggtaatgat                      


                                                                       
                                                                       
                                                                       
                                                                       
                                                                       
                     Alignment 2 Score 93.51 (Bits)                    


SEED               1 LFVGNLPPDVTEEDLKDLFSKFGPIVSIKIVRDIIEKPKETGKSKGFAF 
                      FVG++ +D+ E+ L+D+F+++G+I+ I+I++D     +  GK +GFAF 
                     IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTD-----RGSGKKRGFAF 
MMFLI2X          378 atgggaaggaggccccgttgctgaaggagaaag     agagaaagtgt 
                     tttggtaaacaaaatgaataaagatattattca     ggggaaggtct 
                     ctttttaactaatcaatttggtggtagaatgtc     actgaggcttt 


SEED              50 VEFESEEDAEKALEALNGKELGGRKLRV                      
                     V+F+++++++K +     ++++G++++V                      
                     VTFDDHDSVDKIVI-QKYHTVNGHNCEV                      
MMFLI2X          510 gatggcgtggaaga catcagagcatgg                      
                     tctaaaactaattt aaaactagaagat                      
                     tcttctctgtgttt gacttgtccctaa                      


//
Gene 1
Gene 105 317 
  Exon 105 317 phase 0
Gene 2
Gene 378 590 
  Exon 378 590 phase 0
//
>MMFLI2X.[105:317].sp.tr
LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNAR
PHKVDGRVVEP
>MMFLI2X.[378:590].sp.tr
IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQK
YHTVNGHNCEV
//
>MMFLI2X.[105:317].sp
CTCTTCATCGGAGGGCTGAGCTTCGAAACAACCGACGAGAGTCTGAGGAGCCATTTTGAG
CAATGGGGAACACTAACAGACTGTGTGGTAATGAGAGATCCAAACACCAAGAGATCCAGG
GGCTTTGGGTTTGTCACATATGCCACTGTGGAAGAAGTGGATGCTGCCATGAATGCAAGA
CCACACAAGGTGGATGGAAGAGTTGTGGAACCT
>MMFLI2X.[378:590].sp
ATCTTTGTTGGTGGTATTAAAGAAGACACTGAAGAACATCACCTACGAGATTATTTTGAG
CAGTATGGGAAGATTGAAGTGATAGAAATTATGACTGACAGAGGCAGTGGGAAAAAGAGG
GGCTTTGCTTTTGTTACCTTTGATGACCATGACTCTGTGGATAAGATTGTTATTCAGAAA
TACCATACTGTGAATGGCCACAACTGTGAAGTA
//
Sequence MMFLI2X
subsequence MMFLI2X.1 105 317

Sequence MMFLI2X.1
CDS
Start_not_found
End_not_found
CDS_predicted_by genewise 86.15
source_Exons 1 213

Sequence MMFLI2X
subsequence MMFLI2X.2 378 590

Sequence MMFLI2X.2
CDS
Start_not_found
End_not_found
CDS_predicted_by genewise 93.51
source_Exons 1 213

//
Gene 0
Gene 104 - 317
Transcript 0
Exon 0-213
Translation 0 - 213

Gene 1
Gene 377 - 590
Transcript 0
Exon 0-213
Translation 0 - 213

//

>Results for SEED vs SAHNRNPH (forward) [3]

genewisedb output
Score 150.47 bits over entire alignment.
This will be different from per-alignment scores. See manual for details
For computer parsable output, try genewisedb -help or read the manual
Scores as bits over a synchronous coding model

                                                                       
                                                                       
                                                                       
                                                                       
                                                                       
                     Alignment 1 Score 77.89 (Bits)                    


SEED               1 LFVGNLPPDVTEEDLKDLFSKFGPIVSIKIVRDIIEKPKETGKSKGFAF 
                     LF+G+L + +T+E LK++F++ G+IV++ +++D     ++T++S+GF+F 
                     LFIGGLDYRTTDESLKQHFEQWGEIVDVVVMKD-----PKTKRSRGFGF 
SAHNRNPH         148 ctaggtgtaaaggtcacctgctggagggggaag     caaaatagtgt 
                     tttggtaagccaactaaataaggattattttaa     cacagcggtgt 
                     atttagctaatcgcagattaagtaattggtggc     taggggagtgc 


SEED              50 VEFESEEDAEKALEALNGKELGGRKLRV                      
                     +++     +++A +    ++++GR+++                       
                     ITYSRAHMVDDAQN-ARPHKVDGRVVEP                      
SAHNRNPH         280 aattagcaggggca gcccagggcgggc                      
                     tcacgcattaacaa cgcaataggttac                      
                     atccaatggtttgt tcacatttttggg                      


                                                                       
                                                                       
                                                                       
                                                                       
                                                                       
                     Alignment 2 Score 72.58 (Bits)                    


SEED               1 LFVGNLPPDVTEEDLKDLFSKFGPIVSIKIVRDIIEKPKETGKSKGFAF 
                     LFVG++ +++ E DL+D+F+++G +VS+ IV D     KET K +GFAF 
                     LFVGGIKEEMEENDLRDYFKQYGTVVSAAIVVD-----KETRKKRGFAF 
SAHNRNPH         421 ctgggaaggaggagccgttactgaggtggaggg     agacaacgtgt 
                     tttggtaaataaaatgaataaagcttcccttta     aacgaaggtct 
                     atttatgaggaactgcttcagtctccttacctc     ggtcggtcctc 


SEED              50 VEFESEEDAEKALEALNGKELGGRKLRV                      
                     VEF++ + ++K      +++++G+ + V                      
                     VEFDDYDPVDKICL-SRNHQIRGKHIDV                      
SAHNRNPH         553 ggtggtgcggaatt acaccacgacagg                      
                     tataaaactaatgt ggaaatggaatat                      
                     aatctttatcaatg tctcgctggtatc                      


//
Gene 1
Gene 148 360 
  Exon 148 360 phase 0
Gene 2
Gene 421 633 
  Exon 421 633 phase 0
//
>SAHNRNPH.[148:360].sp.tr
LFIGGLDYRTTDESLKQHFEQWGEIVDVVVMKDPKTKRSRGFGFITYSRAHMVDDAQNAR
PHKVDGRVVEP
>SAHNRNPH.[421:633].sp.tr
LFVGGIKEEMEENDLRDYFKQYGTVVSAAIVVDKETRKKRGFAFVEFDDYDPVDKICLSR
NHQIRGKHIDV
//
>SAHNRNPH.[148:360].sp
CTATTTATTGGTGGATTGGACTATAGAACAACTGACGAGTCCCTAAAGCAACATTTTGAA
CAATGGGGTGAAATAGTTGATGTGGTGGTTATGAAGGACCCTAAAACGAAGAGGTCGAGA
GGGTTTGGGTTCATAACTTACTCCAGAGCACATATGGTGGATGATGCTCAGAATGCTCGC
CCACACAAAGTTGATGGTCGTGTTGTGGAGCCG
>SAHNRNPH.[421:633].sp
CTATTTGTTGGTGGAATTAAGGAAGAGATGGAAGAAAACGATCTGCGCGATTATTTCAAA
CAGTATGGCACTGTCGTCTCTGCTGCAATCGTCGTTGACAAGGAGACTCGCAAGAAGCGT
GGCTTCGCTTTCGTAGAATTTGACGATTATGATCCAGTTGACAAAATATGTTTGAGTCGC
AATCACCAGATCCGTGGGAAGCATATAGATGTC
//
Sequence SAHNRNPH
subsequence SAHNRNPH.1 148 360

Sequence SAHNRNPH.1
CDS
Start_not_found
End_not_found
CDS_predicted_by genewise 77.89
source_Exons 1 213

Sequence SAHNRNPH
subsequence SAHNRNPH.2 421 633

Sequence SAHNRNPH.2
CDS
Start_not_found
End_not_found
CDS_predicted_by genewise 72.58
source_Exons 1 213

//
Gene 0
Gene 147 - 360
Transcript 0
Exon 0-213
Translation 0 - 213

Gene 1
Gene 420 - 633
Transcript 0
Exon 0-213
Translation 0 - 213

//