File: pswdb.out

package info (click to toggle)
wise 2.4.1-21
  • links: PTS, VCS
  • area: main
  • in suites: bullseye, buster, sid
  • size: 27,140 kB
  • sloc: ansic: 276,365; makefile: 1,003; perl: 886; lex: 93; yacc: 81; sh: 24
file content (170 lines) | stat: -rw-r--r-- 6,575 bytes parent folder | download
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
-------------------------------------------------------------
Wise2 - Protein vs. Protein
Program: pswdb version: $Name: wise2-4-1 $ released: unreleased
This program is freely distributed under a GNU General Public License.
   See -version for more info on copyright
Bugs and credits to: Richard Copley <copley@embl-heidelberg.de>
                     Ewan Birney <birney@sanger.ac.uk>
-------------------------------------------------------------

Algorithm type: Smith/Waterman
Gap open:       12
Gap extension:  2
Query info from:     road.pep
Database info from:  pep.fa
Comp Matrix:         /usr/share/wise/BLOSUM62.bla
[Warning: Can't fit histogram to a db smaller than 1,000]


#High Score list
-------------------------------------------------------------
Probe roa1_drome               Dbase ROA1_HUMAN               +  833 0
Probe roa1_drome               Dbase SW:ROA1_XENLA            +  773 0
Probe roa1_drome               Dbase Q22037                   +  662 0


#Alignments
-------------------------------------------------------------



>roa1_drome vs ROA1_HUMAN [1]

P: 0 Sc: 833 aln_len: 368 p_len: 365 t_len: 371 match: 93.7% ID: 47.8%

probe:      22       DSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKR 
                     +S  EPE +RKLFIGGL + TTDE+L++HFE+WG + D VVM+DP TKR 
target:     4        ESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKR 


probe:      71       SRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGA 
                     SRGFGF+TY+    +D A  +RPHK+DGRVVEPKRAV R+D   P A   
target:     53       SRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHL 


probe:      120      TVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFV 
                     TVKK+FVG +K+D +E  +RDYF+ +G I  I I+ D+ +GKKRGFAFV 
target:     102      TVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFV 


probe:      169      EFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQ------NDQQGGGGGR 
                      FDD+D VDK+V+QK H +NG   +V+KAL KQ      + Q+G  G   
target:     151      TFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSG 


probe:      212      GGPGGRAGGNRGNMGGGNYGNQNGGGNW--NNGGNNWGNNRGGNDNWGN 
                        GGR GG  GN   G  GN +G G +  + GG  +G +  G + +GN 
target:     200      NFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGN 


probe:      259      NS-FGGGG----GGGGGYGGGNNSWGNN----------NPWDNGNGGGN 
                     +  +GGGG    GG  GYG G   +GN           + ++NG G G  
target:     249      DGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGRGF 


probe:      293      FGGGGNNWNNGG--NDFGGYQ-QNYGGGPQRGGGNFNNNRMQPYQGGGG 
                      GG G+N+  GG  NDFG Y  Q+   GP +GG NF      PY GGG  
target:     298      GGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGG-NFGGRSSGPYGGGGQ 


probe:      339      FKAGGGNQGNYGGNNQGFNNGGNNR                         
                     + A   NQG YGG++   + G   R                         
target:     346      YFAKPRNQGGYGGSSSSSSYGSGRR                         



-------------------------------------------------------------



>roa1_drome vs SW:ROA1_XENLA [2]

P: 0 Sc: 773 aln_len: 359 p_len: 365 t_len: 365 match: 90.1% ID: 47.4%

probe:      26       EPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGF 
                     EPE +RKLFIGGL + TTDE+L+ HFE+WG + D VVM+DP +KRSRGF 
target:     9        EPEQLRKLFIGGLSFETTDESLREHFEQWGTLTDCVVMRDPNSKRSRGF 


probe:      75       GFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKK 
                     GF+TY  +  +D A  +RPHK+DGRVVEPKRAV R+D   P A  TVKK 
target:     58       GFVTYLSTDEVDAAMTARPHKVDGRVVEPKRAVSREDSSRPGAHLTVKK 


probe:      124      LFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDD 
                     +FVG +K+D +E  +R+YF+ +G I  I I+ D+ +GKKRGFAFV F+D 
target:     107      IFVGGIKEDTEEDHLREYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFED 


probe:      173      YDPVDKVVLQKQHQLNGKMVDVKKALPKQ-------NDQQGGGGGR--- 
                     +D VDK+V+QK H +N     V+KAL KQ       + ++ GG G     
target:     156      HDSVDKIVIQKYHTVNNHNSQVRKALSKQEMASVSGSQRERGGSGNYGS 


probe:      212      ---------GGPGGRAGGNRGNMGGGNYGNQNGGGNWNNG-GNNWGNNR 
                              GG GG  GGNRG  GGG +GN+  GG+  NG G  W     
target:     205      RGGFGNDNFGGRGGNFGGNRG--GGGGFGNRGYGGDGYNGDGQLWWQPS 


probe:      251      --GGNDNWGNNSFGG-GGGGGGGYGGGNNS--WGNNNPWDNGNGGGN-F 
                       G N  +G    GG G G GGGYGGG     +G N  +D  NGGG+ F 
target:     252      LLGWNRGYGAGQGGGYGAGQGGGYGGGGQGGGYGGNGGYDGYNGGGSGF 


probe:      294      GGGGNNWNNGG--NDFGGY--QQNYGGGPQRGGGNFNNNRMQPYQGGGG 
                      G G N+ + G  NDFG Y  Q +   GP +GG         PY GG G 
target:     301      SGSGGNFGSSGGYNDFGNYNSQSSSNFGPMKGGNYGGGRNSGPYGGGYG 


probe:      339      FKAGGGNQGNYGGNNQ                                  
                       +   + G YGG  +                                  
target:     350      GGSASSSSG-YGGGRR                                  



-------------------------------------------------------------



>roa1_drome vs Q22037 [3]

P: 0 Sc: 662 aln_len: 338 p_len: 365 t_len: 346 match: 91.8% ID: 40.2%

probe:      22       DSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKR 
                     D+  EPE++RK+F+GGL   TTD+ ++  + ++G I D++VM+DP TKR 
target:     14       DASLEPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKR 


probe:      71       SRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGA 
                     SRGFGF+T+S  + +D A K RPH IDG+ V+PKRAVPR D +   +   
target:     63       SRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNV 


probe:      120      TVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFV 
                     + K+L+V  +++DH E  + +YF  +G +    I++DK T K RGF FV 
target:     112      STKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFV 


probe:      169      EFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQNDQQGGGGGRGGPGGR 
                      FDD+D VD+ VLQK H +NG   DV+K L K  D+            R 
target:     161      TFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSK--DEMSKAQMNRDRETR 


probe:      218      AGGNRGNMGGGNYGNQNGGGNWNNGGNNWGNNR-GGNDNWGNNSFGGGG 
                      G +R    GG  G   GGG W       G    GG    G   +GG   
target:     208      GGRSRDGQRGGYNGGGGGGGGWGGPAQRGGPGAYGGPGGGGQGGYGGDY 


probe:      266      GGGGGY--GGGNNSWGNNNPWDNGNGGGNFGGGGNNWNNGGNDFGGYQQ 
                     GGG G   GGG   WG       G G G  GGGG     G       QQ 
target:     257      GGGWGQQGGGGQGGWGGPQQQQGGGGWGQQGGGGQGGWGGPQQ---QQQ 


probe:      313      NYGGGPQRGGGNFNNNRMQPYQGGGGFKAGGGNQGNYGGNNQGF      
                        GGPQ+GGG          QGG G ++G     +  G N+ +      
target:     303      GGWGGPQQGGGGGGWGGQGQQQGGWGGQSGAQQWAHAQGGNRNY      



-------------------------------------------------------------