1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110
|
<?xml version='1.0' encoding='UTF-8'?>
<uniprot xmlns="http://uniprot.org/uniprot" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://uniprot.org/uniprot http://www.uniprot.org/support/docs/uniprot.xsd">
<entry dataset="Swiss-Prot" created="2004-07-19" modified="2015-01-07" version="25">
<accession>P84001</accession>
<name>29C0_ANCSP</name>
<protein>
<recommendedName>
<fullName>U3-ctenitoxin-Asp1a</fullName>
<shortName>U3-CNTX-Asp1a</shortName>
</recommendedName>
<alternativeName>
<fullName>Venom protein ANC29C0</fullName>
</alternativeName>
</protein>
<organism>
<name type="scientific">Ancylometes sp.</name>
<name type="common">South American fishing spider</name>
<dbReference type="NCBI Taxonomy" id="280265"/>
<lineage>
<taxon>Eukaryota</taxon>
<taxon>Metazoa</taxon>
<taxon>Ecdysozoa</taxon>
<taxon>Arthropoda</taxon>
<taxon>Chelicerata</taxon>
<taxon>Arachnida</taxon>
<taxon>Araneae</taxon>
<taxon>Araneomorphae</taxon>
<taxon>Entelegynae</taxon>
<taxon>Lycosoidea</taxon>
<taxon>Ctenidae</taxon>
<taxon>Ancylometes</taxon>
</lineage>
</organism>
<reference key="1" evidence="3">
<citation type="submission" date="2004-06" db="UniProtKB">
<title>Protein ANC29C0 from venom of South American fishing spider (Ancylometes spp.) has sequence similarities to neurotoxic peptide Caeron precursor from Bark spider (Caerostris extrusa).</title>
<authorList>
<person name="Richardson M."/>
<person name="Pimenta A.M.C."/>
<person name="Bemquerer M.P."/>
<person name="Santoro M.M."/>
<person name="Figueiredo S.G."/>
<person name="Cordeiro M.N."/>
</authorList>
</citation>
<scope>PROTEIN SEQUENCE</scope>
<scope>SUBCELLULAR LOCATION</scope>
<scope>TISSUE SPECIFICITY</scope>
<scope>MASS SPECTROMETRY</scope>
<source>
<tissue>Venom</tissue>
</source>
</reference>
<comment type="function">
<text evidence="2">Possible neurotoxin.</text>
</comment>
<comment type="subcellular location">
<subcellularLocation>
<location evidence="1">Secreted</location>
</subcellularLocation>
</comment>
<comment type="tissue specificity">
<text evidence="1">Expressed by the venom gland.</text>
</comment>
<comment type="mass spectrometry" mass="9571" method="Electrospray" evidence="1">
<location>
<begin position="1"/>
<end status="unknown"/>
</location>
</comment>
<dbReference type="ArachnoServer" id="AS000014">
<property type="toxin name" value="U3-ctenitoxin-Asp1a"/>
</dbReference>
<dbReference type="GO" id="GO:0005576">
<property type="term" value="C:extracellular region"/>
<property type="evidence" value="ECO:0000501"/>
<property type="project" value="UniProtKB-SubCell"/>
</dbReference>
<proteinExistence type="evidence at protein level"/>
<keyword id="KW-0903">Direct protein sequencing</keyword>
<keyword id="KW-0528">Neurotoxin</keyword>
<keyword id="KW-0964">Secreted</keyword>
<keyword id="KW-0800">Toxin</keyword>
<feature type="chain" description="U3-ctenitoxin-Asp1a" id="PRO_0000087682">
<location>
<begin position="1"/>
<end position="50" status="greater than"/>
</location>
</feature>
<feature type="non-terminal residue" evidence="2">
<location>
<position position="50"/>
</location>
</feature>
<evidence key="1" type="ECO:0000269">
<source ref="1"/>
</evidence>
<evidence key="2" type="ECO:0000303">
<source ref="1"/>
</evidence>
<evidence key="3" type="ECO:0000305"/>
<sequence length="50" mass="5679" checksum="3B06738CA0940B53" modified="2004-07-19" version="1" fragment="single">
ANACTKQADCAEDECCLDNLFFKRPYCEMRYGAGKRCAAASVYKEDKDLY
</sequence>
</entry>
<copyright>
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
</copyright>
</uniprot>
|