1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255
|
# Copyright 2003-2004 by Iddo Friedberg. All rights reserved.
# Revisions copyright 2008-2010 by Peter Cock. All rights reserved.
# Revisions copyright 2012 by Matt Fenwick. All rights reserved.
# Revisions copyright 2012 by Kai Blin. All rights reserved.
# This code is part of the Biopython distribution and governed by its
# license. Please see the LICENSE file that should have been included
# as part of this package.
"""Tests for Bio.SeqUtils.ProtParam and related code."""
import unittest
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.SeqUtils import ProtParam, ProtParamData
from Bio.SeqUtils import molecular_weight
class ProtParamTest(unittest.TestCase):
"""Tests for ProtParam."""
def setUp(self):
"""Initialise objects."""
text = "MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV"
seq = Seq(text)
record = SeqRecord(seq)
analysis_text = ProtParam.ProteinAnalysis(text)
analysis_seq = ProtParam.ProteinAnalysis(seq)
analysis_record = ProtParam.ProteinAnalysis(record)
self.text = text
self.sequences = (text, seq, record)
self.analyses = (analysis_text, analysis_seq, analysis_record)
def test_count_amino_acids(self):
"""Calculate amino acid counts."""
for analysis in self.analyses:
count_dict = analysis.count_amino_acids()
for i in count_dict:
self.assertEqual(count_dict[i], self.text.count(i))
def test_get_amino_acids_percent(self):
"""Calculate amino acid percentages."""
for analysis in self.analyses:
percent_dict = analysis.get_amino_acids_percent()
seq_len = len(self.text)
for i in percent_dict:
self.assertAlmostEqual(percent_dict[i], self.text.count(i) / seq_len)
def test_get_molecular_weight(self):
"""Calculate protein molecular weight."""
for analysis in self.analyses:
self.assertAlmostEqual(analysis.molecular_weight(), 17103.16, 2)
def test_get_monoisotopic_molecular_weight(self):
"""Calculate monoisotopic molecular weight."""
for sequence in self.sequences:
analysis = ProtParam.ProteinAnalysis(sequence, monoisotopic=True)
self.assertAlmostEqual(analysis.molecular_weight(), 17092.61, 2)
def test_get_molecular_weight_identical(self):
"""Confirm protein molecular weight agrees with calculation from Bio.SeqUtils."""
# This test is somehow useless, since ProteinAnalysis.molecular_weight
# is internally calling SeqUtils.molecular_weight.
mw_2 = molecular_weight(self.text, seq_type="protein")
for analysis in self.analyses:
mw_1 = analysis.molecular_weight()
self.assertAlmostEqual(mw_1, mw_2)
def test_get_monoisotopic_molecular_weight_identical(self):
"""Confirm protein molecular weight agrees with calculation from Bio.SeqUtils."""
# This test is somehow useless, since ProteinAnalysis.molecular_weight
# is internally calling SeqUtils.molecular_weight.
mw_2 = molecular_weight(self.text, seq_type="protein", monoisotopic=True)
for sequence in self.sequences:
analysis = ProtParam.ProteinAnalysis(sequence, monoisotopic=True)
mw_1 = analysis.molecular_weight()
self.assertAlmostEqual(mw_1, mw_2)
def test_aromaticity(self):
"""Calculate protein aromaticity."""
for analysis in self.analyses:
# Old test used a number rounded to two digits, so use the same
self.assertAlmostEqual(analysis.aromaticity(), 0.10, 2)
def test_instability_index(self):
"""Calculate protein instability index."""
for analysis in self.analyses:
# Old test used a number rounded to two digits, so use the same
self.assertAlmostEqual(analysis.instability_index(), 41.98, 2)
def test_flexibility(self):
"""Calculate protein flexibility."""
# Turn black code style off
# fmt: off
expected_flexibility = [
0.9825119047619049, 1.0166904761904763, 0.9947857142857144,
0.9660238095238095, 0.9890714285714285, 0.9737261904761906,
0.9789166666666669, 1.004547619047619, 1.0235357142857144,
1.0163214285714286, 0.981297619047619, 1.0388809523809523,
0.9956309523809524, 1.0379047619047619, 1.014654761904762,
1.015154761904762, 1.0317619047619049, 1.0100833333333334,
1.0738333333333334, 1.0460952380952382, 1.0333571428571429,
1.0429761904761905, 0.9842738095238095, 0.9984404761904762,
0.9814404761904763, 0.9715357142857144, 1.0063690476190477,
0.988952380952381, 0.9930952380952381, 0.9962619047619047,
0.9774523809523811, 0.9747857142857144, 0.9701547619047618,
0.9759404761904762, 0.9515119047619047, 0.9745714285714286,
1.007642857142857, 1.0024523809523809, 1.0019761904761904,
1.0053571428571428, 1.000595238095238, 1.0385238095238094,
1.0090357142857143, 1.0095, 1.0207142857142857, 1.0371071428571428,
1.0223690476190477, 1.0373809523809523, 1.030095238095238,
1.0166190476190475, 0.9939404761904762, 0.9935833333333335,
1.009547619047619, 0.9678095238095237, 1.0027380952380953,
0.9720595238095241, 1.0215952380952382, 0.996904761904762,
1.0330238095238098, 1.0140714285714285, 0.9977976190476192,
1.0319285714285715, 1.016714285714286, 0.9713928571428571,
0.9921666666666669, 0.9904404761904763, 1.0350238095238096,
1.0021904761904763, 1.0092738095238096, 1.0462380952380952,
1.012392857142857, 1.0289761904761903, 1.0108095238095236,
0.9762619047619049, 0.9885357142857144, 0.9901428571428571,
0.9795119047619048, 1.014059523809524, 0.9857976190476189,
1.0114404761904763, 0.9970357142857144, 0.9755238095238097,
0.9871428571428573, 0.9820952380952382, 1.006095238095238,
0.9997023809523811, 1.0065238095238094, 1.0149047619047618,
1.0451071428571428, 1.0396785714285717, 1.0452142857142857,
1.0262619047619048, 0.9735952380952381, 0.998404761904762,
0.9777976190476191, 0.9773809523809524, 1.008214285714286,
0.9772619047619048, 0.9955000000000002, 1.0482261904761907,
1.0262499999999999, 1.0189404761904763, 0.9988452380952382,
1.0009285714285714, 1.0204404761904762, 0.9839880952380953,
0.9809166666666669, 1.01475, 1.0234166666666669, 1.0355476190476192,
1.033107142857143, 1.011154761904762, 1.0480714285714288,
1.0591190476190477, 1.033809523809524, 1.008107142857143,
0.9757261904761906, 0.9885714285714287, 0.9831428571428572,
1.000595238095238, 0.9739761904761908, 1.0377619047619049,
1.0295357142857142, 1.0269642857142858, 1.0371904761904762,
1.0385476190476193, 1.0057023809523808, 1.06075, 1.006714285714286,
1.0269642857142858, 1.0229761904761905, 1.0046309523809522,
1.0053690476190476, 0.9886666666666667, 0.9931666666666669, 1.01775,
1.003297619047619, 1.0161666666666667, 0.977440476190476,
0.9762738095238096, 0.9785833333333332, 0.9609642857142857,
0.9650833333333334]
# Turn black code style on
# fmt: on
for analysis in self.analyses:
flexibility = analysis.flexibility()
self.assertEqual(
len(flexibility), len(expected_flexibility), "Output length differs"
)
for f, e in zip(flexibility, expected_flexibility):
self.assertAlmostEqual(f, e)
def test_isoelectric_point(self):
"""Calculate the isoelectric point."""
for analysis in self.analyses:
# Old test used a number rounded to two digits, so use the same
self.assertAlmostEqual(analysis.isoelectric_point(), 7.72, 2)
def test_charge_at_pH(self):
"""Test charge_at_pH function."""
for analysis in self.analyses:
self.assertAlmostEqual(analysis.charge_at_pH(7.72), 0.00, 2)
def test_secondary_structure_fraction(self):
"""Calculate secondary structure fractions."""
for analysis in self.analyses:
helix, turn, sheet = analysis.secondary_structure_fraction()
# Old test used numbers rounded to two digits, so use the same
self.assertAlmostEqual(helix, 0.28, 2)
self.assertAlmostEqual(turn, 0.26, 2)
self.assertAlmostEqual(sheet, 0.25, 2)
def test_protein_scale(self):
"""Calculate the Kite Doolittle scale."""
# Turn black code style off
# fmt: off
expected = [-0.0783, +0.0358, +0.1258, +0.6950, +0.8775, +0.8350, +0.2925, +0.3383,
-0.1733, -0.4142, -0.5292, -0.6108, -0.8308, -0.8100, -0.8208, -1.0283,
-1.6300, -1.8233, -2.4267, -2.2292, -1.7817, -1.4742, -0.7467, -0.1608,
+0.1108, +0.2142, +0.1792, -0.1217, -0.4808, -0.4333, -0.5167, -0.2833,
+0.3758, +0.7225, +0.4958, +0.6033, +0.5625, +0.3108, -0.2408, -0.0575,
-0.3717, -0.7800, -1.1242, -1.4083, -1.7550, -2.2642, -2.8575, -2.9175,
-2.5358, -2.5325, -1.8142, -1.4667, -0.6058, -0.4483, +0.1300, +0.1225,
+0.2825, +0.1650, +0.3317, -0.2000, +0.2683, +0.1233, +0.4092, +0.1392,
+0.4192, +0.2758, -0.2350, -0.5750, -0.5983, -1.2067, -1.3867, -1.3583,
-0.8708, -0.5383, -0.3675, +0.0667, +0.0825, -0.0150, +0.1817, +0.4692,
+0.3017, +0.3800, +0.4825, +0.4675, +0.1575, -0.1783, -0.5175, -1.2017,
-1.7033, -1.5500, -1.2375, -0.8500, -0.0583, +0.3125, +0.4242, +0.7133,
+0.5633, +0.0483, -0.7167, -1.3158, -1.9217, -2.5033, -2.4117, -2.2483,
-2.3758, -2.0633, -1.8900, -1.8667, -1.9292, -1.8625, -2.0050, -2.2708,
-2.4050, -2.3508, -2.1758, -1.5533, -1.0350, -0.1983, -0.0233, +0.1800,
+0.0317, -0.0917, -0.6375, -0.9650, -1.4500, -1.6008, -1.7558, -1.5450,
-1.7900, -1.8133, -2.0125, -2.1383, -2.3142, -2.1525, -2.1425, -1.9733,
-1.4742, -0.8083, -0.2100, +0.8067, +1.3092, +1.8367, +2.0283, +2.3558]
# Turn black code style on
# fmt: on
for analysis in self.analyses:
for i, e in zip(analysis.protein_scale(ProtParamData.kd, 9, 0.4), expected):
# Expected values have 4 decimal places, so restrict to that exactness
self.assertAlmostEqual(i, e, places=4)
def test_gravy(self):
"""Calculate gravy. Tests all pre-defined scales."""
expected_values = {
"KyteDoolitle": -0.5974,
"Aboderin": 4.5671,
"AbrahamLeo": 0.2378,
"Argos": 0.8607,
"BlackMould": 0.5074,
"BullBreese": -0.0445,
"Casari": -0.2414,
"Cid": -0.0678,
"Cowan3.4": 0.0234,
"Cowan7.5": -0.0733,
"Eisenberg": -0.0435,
"Engelman": 1.600,
"Fasman": -0.3614,
"Fauchere": 0.327,
"GoldSack": 1.1564,
"Guy": 0.0675,
"Jones": 1.223,
"Juretic": -0.6672,
"Kidera": 0.1383,
"Miyazawa": 5.3109,
"Parker": 1.7487,
"Ponnuswamy": 0.3491,
"Rose": 0.7147,
"Roseman": -0.4729,
"Sweet": -0.0791,
"Tanford": 0.0625,
"Wilson": 1.5493,
"Zimmerman": 1.2841,
}
for analysis in self.analyses:
for scale, exp_v in expected_values.items():
self.assertAlmostEqual(analysis.gravy(scale=scale), exp_v, places=4)
with self.assertRaises(ValueError) as cm:
analysis.gravy("Wrong Scale")
self.assertEqual("scale: Wrong Scale not known", str(cm.exception))
def test_molar_extinction_coefficient(self):
"""Molar extinction coefficient."""
for analysis in self.analyses:
self.assertAlmostEqual(
analysis.molar_extinction_coefficient()[0], 17420, places=5
)
self.assertAlmostEqual(
analysis.molar_extinction_coefficient()[1], 17545, places=5
)
if __name__ == "__main__":
runner = unittest.TextTestRunner(verbosity=2)
unittest.main(testRunner=runner)
|