1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256
|
# Copyright 2010 by Thomas Schmitt. All rights reserved.
# This code is part of the Biopython distribution and governed by its
# license. Please see the LICENSE file that should have been included
# as part of this package.
"""Tests for SeqIO SeqXML module."""
import unittest
from io import BytesIO
from Bio import SeqIO
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
class TestSimpleRead(unittest.TestCase):
def test_check_SeqIO(self):
"""Files readable using parser via SeqIO."""
records = list(SeqIO.parse("SeqXML/dna_example.xml", "seqxml"))
self.assertEqual(len(records), 4)
records = list(SeqIO.parse("SeqXML/rna_example.xml", "seqxml"))
self.assertEqual(len(records), 5)
records = list(SeqIO.parse("SeqXML/protein_example.xml", "seqxml"))
self.assertEqual(len(records), 5)
records = list(SeqIO.parse("SeqXML/global_species_example.xml", "seqxml"))
self.assertEqual(len(records), 2)
class TestDetailedRead(unittest.TestCase):
records = {}
def setUp(self):
self.records["dna"] = list(SeqIO.parse("SeqXML/dna_example.xml", "seqxml"))
self.records["rna"] = list(SeqIO.parse("SeqXML/rna_example.xml", "seqxml"))
self.records["protein"] = list(
SeqIO.parse("SeqXML/protein_example.xml", "seqxml")
)
self.records["globalSpecies"] = list(
SeqIO.parse("SeqXML/global_species_example.xml", "seqxml")
)
def test_special_characters_desc(self):
"""Read special XML characters in description."""
self.assertEqual(
self.records["dna"][2].description,
'some special characters in the description\n<tag> "quoted string"',
)
def test_unicode_characters_desc(self):
"""Test special unicode characters in the description."""
self.assertEqual(self.records["rna"][2].description, "åÅüöÖ߸䢣$€香肠")
def test_full_characters_set_read(self):
"""Read full characters set for each type."""
self.assertEqual(self.records["dna"][1].seq, "ACGTMRWSYKVHDBXN.-")
self.assertEqual(self.records["rna"][1].seq, "ACGUMRWSYKVHDBXN.-")
self.assertEqual(
self.records["protein"][1].seq, "ABCDEFGHIJKLMNOPQRSTUVWXYZ.-*"
)
def test_duplicated_property(self):
"""Read property with multiple values."""
self.assertEqual(
self.records["protein"][2].annotations["test"], ["1", "2", "3"]
)
def test_duplicated_dbxref(self):
"""Read multiple cross references to a single source."""
self.assertEqual(
self.records["protein"][2].dbxrefs, ["someDB:G001", "someDB:G002"]
)
def test_read_minimal_required(self):
"""Check minimal record."""
minimalRecord = SeqRecord(id="test", seq=Seq("abc"))
minimalRecord.annotations["source"] = "Ensembl"
minimalRecord.annotations["molecule_type"] = "DNA"
self.assertEqual(self.records["rna"][3].name, minimalRecord.name)
self.assertEqual(self.records["dna"][3].annotations, minimalRecord.annotations)
self.assertEqual(self.records["rna"][3].dbxrefs, minimalRecord.dbxrefs)
self.assertEqual(
self.records["protein"][3].description, minimalRecord.description
)
def test_local_species(self):
"""Check local species."""
self.assertEqual(self.records["rna"][1].annotations["organism"], "Mus musculus")
self.assertEqual(self.records["rna"][1].annotations["ncbi_taxid"], "10090")
self.assertEqual(
self.records["rna"][0].annotations["organism"], "Gallus gallus"
)
self.assertEqual(self.records["rna"][0].annotations["ncbi_taxid"], "9031")
def test_global_species(self):
"""Check global species."""
self.assertEqual(
self.records["globalSpecies"][0].annotations["organism"], "Mus musculus"
)
self.assertEqual(
self.records["globalSpecies"][0].annotations["ncbi_taxid"], "10090"
)
self.assertEqual(
self.records["globalSpecies"][1].annotations["organism"], "Homo sapiens"
)
self.assertEqual(
self.records["globalSpecies"][1].annotations["ncbi_taxid"], "9606"
)
def test_local_source_definition(self):
"""Check local source."""
self.assertEqual(self.records["protein"][4].annotations["source"], "Uniprot")
def test_empty_description(self):
"""Check empty description."""
self.assertEqual(
self.records["rna"][4].description,
SeqRecord(id="", seq=Seq("")).description,
)
class TestReadHeader(unittest.TestCase):
def test_check_dna_header(self):
"""Check if the header information is parsed."""
records = SeqIO.parse("SeqXML/dna_example.xml", "seqxml")
self.assertEqual(records.source, "Ensembl")
self.assertEqual(records.sourceVersion, "56")
self.assertEqual(records.seqXMLversion, "0.4")
def test_check_rna_header(self):
"""Check if the header information is parsed."""
records = SeqIO.parse("SeqXML/rna_example.xml", "seqxml")
self.assertEqual(records.source, "Ensembl")
self.assertEqual(records.sourceVersion, "56")
self.assertEqual(records.seqXMLversion, "0.3")
def test_check_protein_header(self):
"""Check if the header information is parsed."""
records = SeqIO.parse("SeqXML/protein_example.xml", "seqxml")
self.assertEqual(records.source, "Ensembl")
self.assertEqual(records.sourceVersion, "56")
self.assertEqual(records.seqXMLversion, "0.4")
def test_check_global_species_example_header(self):
"""Check if the header information is parsed."""
records = SeqIO.parse("SeqXML/global_species_example.xml", "seqxml")
self.assertEqual(records.speciesName, "Mus musculus")
self.assertEqual(records.ncbiTaxID, "10090")
self.assertEqual(records.source, "Ensembl")
self.assertEqual(records.sourceVersion, "56")
self.assertEqual(records.seqXMLversion, "0.4")
class TestReadAndWrite(unittest.TestCase):
def test_read_write_rna(self):
"""Read and write RNA."""
read1_records = list(SeqIO.parse("SeqXML/rna_example.xml", "seqxml"))
self._write_parse_and_compare(read1_records)
def test_read_write_dna(self):
"""Read and write DNA."""
read1_records = list(SeqIO.parse("SeqXML/dna_example.xml", "seqxml"))
self._write_parse_and_compare(read1_records)
def test_read_write_protein(self):
"""Read and write protein."""
read1_records = list(SeqIO.parse("SeqXML/protein_example.xml", "seqxml"))
self._write_parse_and_compare(read1_records)
def test_read_write_globalSpecies(self):
"""Read and write global species."""
read1_records = list(SeqIO.parse("SeqXML/global_species_example.xml", "seqxml"))
self._write_parse_and_compare(read1_records)
def _write_parse_and_compare(self, read1_records):
handle = BytesIO()
SeqIO.write(read1_records, handle, "seqxml")
handle.seek(0)
read2_records = list(SeqIO.parse(handle, "seqxml"))
self.assertEqual(len(read1_records), len(read2_records))
for record1, record2 in zip(read1_records, read2_records):
self.assertEqual(record1.id, record2.id)
self.assertEqual(record1.name, record2.name)
self.assertEqual(record1.description, record2.description)
self.assertEqual(record1.seq, record2.seq)
self.assertEqual(record1.dbxrefs, record2.dbxrefs)
self.assertEqual(record1.annotations, record2.annotations)
def test_write_species(self):
"""Test writing species from annotation tags."""
record = SeqIO.read("SwissProt/sp016", "swiss")
self.assertEqual(record.annotations["organism"], "Homo sapiens (Human)")
self.assertEqual(record.annotations["ncbi_taxid"], ["9606"])
handle = BytesIO()
SeqIO.write(record, handle, "seqxml")
handle.seek(0)
output = handle.getvalue()
text = output.decode("UTF-8")
self.assertIn("Homo sapiens (Human)", text)
self.assertIn("9606", text)
self.assertIn(
'<species name="Homo sapiens (Human)" ncbiTaxID="9606"></species>',
text,
msg=f"Missing expected <species> tag: {text!r}",
)
class TestReadCorruptFiles(unittest.TestCase):
def test_for_errors(self):
"""Handling of corrupt files."""
# SeqIO.parse reads the file in blocks until it finds the seqXML
# element with global information such as the source and sourceVersion.
# Since one block is likely large enough to cover the first few
# entries in the file, the ValueError may be raised after we call
# SeqIO.parse, before we start iterating over the file.
def f(path):
records = SeqIO.parse(path, "seqxml")
for record in records:
pass
self.assertRaises(ValueError, f, "SeqXML/corrupt_example1.xml")
self.assertRaises(ValueError, f, "SeqXML/corrupt_example2.xml")
self.assertRaises(ValueError, f, "SeqXML/corrupt_example3.xml")
class TestOldVersions(unittest.TestCase):
def test_version01(self):
"""Test for version 0.1 specific features."""
records = list(SeqIO.parse("SeqXML/version_01_example.xml", "seqxml"))
self.assertEqual(records[0].seq, "AAAAAACGTAAA")
self.assertEqual(records[0].dbxrefs[0], "db:1")
self.assertEqual(records[1].seq, "AAAUUUUCTGAA")
self.assertEqual(records[2].seq, "GAKKVFIEDVSKEFVEEFIWPAVQSSALYE")
def test_wrong_version(self):
"""Handling of wrong versions."""
def f(path):
records = SeqIO.parse(path, "seqxml")
for record in records:
pass
self.assertRaises(ValueError, f, "SeqXML/wrong_version1.xml")
self.assertRaises(ValueError, f, "SeqXML/wrong_version2.xml")
self.assertRaises(ValueError, f, "SeqXML/wrong_version3.xml")
if __name__ == "__main__":
runner = unittest.TextTestRunner(verbosity=2)
unittest.main(testRunner=runner)
|